Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102198.848ON50050025750.0
KLTH0C03696g8.848ON47447516730.0
SAKL0D01276g8.848ON50250614030.0
TDEL0A079708.848ON48948813330.0
Ecym_46238.848ON48047413021e-176
KLLA0D01386g8.848ON48949212681e-171
ZYRO0G14344g8.848ON47248112641e-171
Skud_13.4558.848ON49449512651e-170
KNAG0J002208.848ON49949112631e-170
NCAS0C003508.848ON48649012621e-170
YMR283C (RIT1)8.848ON51349512631e-170
Kpol_1068.28.848ON49148512591e-169
TPHA0I003008.848ON49349412521e-168
Suva_13.4728.848ON51049612471e-167
NDAI0K003508.848ON50450112461e-167
Smik_13.4968.848ON49449512411e-167
KAFR0B039808.848ON48348312041e-161
AFR451C8.848ON40841110041e-132
NDAI0A022207.297ON476127742.0
TDEL0F042208.295ON490998742.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10219
         (500 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   996   0.0  
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   649   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   545   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   518   0.0  
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   506   e-176
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   493   e-171
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   491   e-171
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   491   e-170
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   491   e-170
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   490   e-170
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   491   e-170
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   489   e-169
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   486   e-168
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   484   e-167
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   484   e-167
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   482   e-167
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   468   e-161
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   391   e-132
NDAI0A02220 Chr1 (500381..501811) [1431 bp, 476 aa] {ON} Anc_7.2...    33   2.0  
TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] ...    33   2.2  

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/500 (96%), Positives = 483/500 (96%)

Query: 1   MSCSPLTHIRDECILLDPVSCLPNLNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDH 60
           MSCSPLTHIRDECILLDPVSCLPNLNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDH
Sbjct: 1   MSCSPLTHIRDECILLDPVSCLPNLNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDH 60

Query: 61  RFLEEQVLALFPNYPLIPNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLL 120
           RFLEEQVLALFPNYPLIPNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLL
Sbjct: 61  RFLEEQVLALFPNYPLIPNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLL 120

Query: 121 PTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSG 180
           PTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSG
Sbjct: 121 PTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSG 180

Query: 181 SEFERIKSRIPSLVARFKELGLFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDI 240
           SEFERIKSRIPSLVARFKELGLFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDI
Sbjct: 181 SEFERIKSRIPSLVARFKELGLFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDI 240

Query: 241 VTPTWEAQNENFMPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHI 300
           VTPTWEAQNENFMPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHI
Sbjct: 241 VTPTWEAQNENFMPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHI 300

Query: 301 EIFKDTALSDQELSTYVNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAENIEL 360
           EIFKDTALSDQELSTYVNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAENIEL
Sbjct: 301 EIFKDTALSDQELSTYVNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAENIEL 360

Query: 361 DKNLVDQXXXXXXXXXXXXXXXXXYEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEA 420
           DKNLVDQ                 YEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEA
Sbjct: 361 DKNLVDQLKLKYSLVVLLSTSISVYEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEA 420

Query: 421 NLQNSLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKL 480
           NLQNSLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKL
Sbjct: 421 NLQNSLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKL 480

Query: 481 DGRNLNPPRVSLNSVNDYLM 500
           DGRNLNPPRVSLNSVNDYLM
Sbjct: 481 DGRNLNPPRVSLNSVNDYLM 500

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/475 (64%), Positives = 376/475 (79%), Gaps = 2/475 (0%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           M+LT DQT+N LN+EIKKE ++LRNRLQSI+FDH+FL+EQV A+FP+YP+IPNERCG+WY
Sbjct: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           CDP+ Y QTSYFKSTDGH+NQWDFSLRRLN HLLP +   GGIV+VDSTRRGKRMPDALS
Sbjct: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120

Query: 147 KTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSD 206
           KTVPIWCAVLNS++LE +  E EVLFCPP TVS  EFERIKSRIP LVA+FK++ + T  
Sbjct: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180

Query: 207 ELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSYQCQ 265
           ++ ++  GKILRP+WV+PGASLL+S RDPFTG++++  W  A+ ENF+PVVLCTVSYQCQ
Sbjct: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQ 240

Query: 266 DGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGD 325
           DGVDKRHGFTYVQGAADDHELWA+GLTAELFW+HI I  +  LSDQEL ++V + +   +
Sbjct: 241 DGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQE 300

Query: 326 ANNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXXXXXXXY 385
            N+     L LD +L  + LT ELHLG+++ N+ L ++LV +                  
Sbjct: 301 PNSA-ENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLS 359

Query: 386 EEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCNNGKDMSVCVVLS 445
           E+   I+IFKLQS  KKSS+ALR  L +ICPL EA L NSLP+L+CCN GKDMSVCV L+
Sbjct: 360 EDEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLA 419

Query: 446 VLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYLM 500
           +LCRN+NV SW L  + S+HK  IKKHL+K+ITKL+GRN+NPPR SLNSVN YLM
Sbjct: 420 ILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/506 (54%), Positives = 355/506 (70%), Gaps = 15/506 (2%)

Query: 2   SCSPLTHI-RDECILLDPVSCLPNL--NMDLTFDQTLNSLNKEIKKENKALRNRLQSILF 58
           SCS +  + R  C+        PN   NMD    ++LN + KEIKKE K+LRNRLQSI++
Sbjct: 5   SCSSIDEVTRRTCVY-------PNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIW 57

Query: 59  DHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVH 118
           DH+FL   V+  FP+YPL+PNERCGLWYC+PE +SQ SYFKSTDGH NQWDFS RRLN H
Sbjct: 58  DHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFH 117

Query: 119 LLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTV 178
           LLP+I Q GGIVI+DSTRRGK++PDALSKT+PIWCAV+N+++LE     EEVLFCPP TV
Sbjct: 118 LLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVLFCPPGTV 177

Query: 179 SGSEFERIKSRIPSLVARFKELGLFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTG 238
             SE++RIK+RIPSLV + K LG+ + DEL K   GKILRP+WVYPG+SL +S  D FTG
Sbjct: 178 PQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTG 237

Query: 239 DIV-TPTWEA-QNENFMPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELF 296
               +  WE  ++++F+PV+LCT SYQCQDGVDKR+GFTYVQGAADDHELWAEGLT ++F
Sbjct: 238 KQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMF 297

Query: 297 WQHIEIFKDTALSDQELSTYVNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAE 356
           W +     D   S+QEL  YVN          K      L+   + + +T+ELHLG V +
Sbjct: 298 WDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVD 357

Query: 357 NIELDKNLVDQ--XXXXXXXXXXXXXXXXXYEEAENIRIFKLQSGSKKSSRALRAALTQI 414
            +EL++ L+ Q                    +E  N +IF L SG+KKSS+ LR+ L +I
Sbjct: 358 GLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEI 417

Query: 415 CPLIEANLQNSLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLA 474
           CPLI+A+L + LP+LICCN GKDMSV V+L+ LC+N++ E W +    S +K+II+KHL 
Sbjct: 418 CPLIQASLNSPLPILICCNTGKDMSVGVLLATLCQNYD-EDWCIGSPNSFNKTIIRKHLT 476

Query: 475 KMITKLDGRNLNPPRVSLNSVNDYLM 500
           ++I+ L GRN+NP R +LNSVN YLM
Sbjct: 477 RLISHLKGRNVNPSRATLNSVNAYLM 502

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/488 (53%), Positives = 336/488 (68%), Gaps = 18/488 (3%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD  F  +L  +NK+IKKE K+LRNRLQSIL D+ FL  +VL  FP YPL+PNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           C+P+ ++QTSYFKSTDGH+NQWDFS RRLN H++PTI +  GI+IVDSTRRGK++PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 147 KTVPIWCAVLNSIMLE--GRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204
           KT+PIWCAVLN +MLE  G   ++E L+ PP TVS SEF  IKSRIP LV + K L +  
Sbjct: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185

Query: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEAQNENFMPVVLCTVSYQC 264
             EL K L GK+LRP W+YPG+S+L S  D FTG++ +  W   + + +P++LCTVSYQ 
Sbjct: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQA 245

Query: 265 QDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSG 324
           QDGVDKR GFTYVQGAADDHELW+ GL A++FW +I+I  +   S++EL  +V+ L   G
Sbjct: 246 QDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRG 305

Query: 325 DANNKLTKSLRLDDMLNANEL-TRELHLGQVAENIELDKNLVD---QXXXXXXXXXXXXX 380
                L+K ++  D     +L T EL LG V +N+E +  L+    Q             
Sbjct: 306 ---CDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVN 362

Query: 381 XXXXYEEAEN----IRIFKLQSGSKKSSRALRAALTQICPLIEANL----QNSLPVLICC 432
                 E EN    I I KLQSGSK SSR L+  L +I PLIE ++    +   PVLICC
Sbjct: 363 FPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICC 422

Query: 433 NNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSL 492
           N+G DMS+ ++L VLCRN+N++ WQL    SV K ++KKHLAK+I+ L GRN+NPPR +L
Sbjct: 423 NSGTDMSIGLLLVVLCRNYNMD-WQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATL 481

Query: 493 NSVNDYLM 500
           NSVN YLM
Sbjct: 482 NSVNSYLM 489

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  506 bits (1302), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 337/474 (71%), Gaps = 9/474 (1%)

Query: 34  TLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYS 93
           TL  + KEI+++  +LRNRLQS+ +D +F+  +VL +FPNYPL+PNERCGLWYC+P +Y 
Sbjct: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68

Query: 94  QTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWC 153
           QT YFKSTDGH+NQWDFS RRLN H+L  + + GGI+IVDSTRRGK+MPDALSKT+PIWC
Sbjct: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128

Query: 154 AVLNSIMLEGRQSEEEV--LFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDELFKI 211
           AVLN++ML+ +  E+ +  LFCPP TVS  EF+ I S++P LV + K+L + + +EL+ +
Sbjct: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188

Query: 212 LDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEAQNENFMPVVLCTVSYQCQDGVDKR 271
             GK+LRP WVYPG+ LL++ RD FTG+++   W+++ +N +PV+LCT SYQCQDG DK 
Sbjct: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSE-QNSIPVILCTASYQCQDGEDKH 247

Query: 272 HGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGD---ANN 328
           HGFTYVQGAADDHELWA GL  E+FW++IE   D   S+ EL  +V  +  +      +N
Sbjct: 248 HGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTAQSN 307

Query: 329 KLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXXXXXXXYEE- 387
           K +        +  +E+T+ L+LG VAE I L +N+  +                   + 
Sbjct: 308 KQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKADC 367

Query: 388 -AENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCNNGKDMSVCVVLSV 446
             E I+++ + + SKKSSR LR AL +I  LI+ ++ + LP+LICCN GKD+S+ ++L+ 
Sbjct: 368 NCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIMLTA 427

Query: 447 LCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYLM 500
           LC++++++ W LE++ +V+K+I+KKHLA++ITKL G N+NP R +L +VN +L+
Sbjct: 428 LCQHYDLQ-WHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  493 bits (1268), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 255/492 (51%), Positives = 335/492 (68%), Gaps = 21/492 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD    + +  ++KE++KE+K+L+NRLQSI+FD+ FL+EQV   F  YP++PNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           CDP+ Y  TSYFKSTDGH NQWDFS RRLN HLLP + + GG+VI+DSTRRGK++PDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 147 KTVPIWCAVLNSIMLE--GRQ--SEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGL 202
           KTVPIWCAVLN +MLE  G+Q   EEE+LF PP+TV  SEF+R+ +++P LV + K+L +
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 203 FTSDELFKILD-----GKILRPIWVYPGASLLNSHRDPFTGDIVTPT-WEAQNENFMPVV 256
               +L K L       K+LRPIWVYPG+SLL    D F+G+++  T WE  + N +PV+
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPPS-NIIPVI 238

Query: 257 LCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTY 316
           LCTVSYQCQDG DKR+GFTYVQGAADDHELWAE LT +LFW++I+   D + SD EL   
Sbjct: 239 LCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDS 298

Query: 317 VNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLV---DQXXXXXX 373
            N ++      N L  S  +  ML  + +T  LHLG++     +    V   +Q      
Sbjct: 299 YNAVILRAKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAVV 358

Query: 374 XXXXXXXXXXXYEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQN-----SLPV 428
                       E   +I IF L SGSKKSSR LR+ L +I  LIE  L       +LP+
Sbjct: 359 LCHEAISVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLPI 418

Query: 429 LICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPP 488
           LI C++GKD+SV ++L  LC+ +N++ W+L+ + SV+K+IIKKHLAK+I  L GRN+NP 
Sbjct: 419 LIACDSGKDISVSILLVALCKYYNLD-WELQPQDSVNKTIIKKHLAKIIESLQGRNVNPS 477

Query: 489 RVSLNSVNDYLM 500
           R SLNSVN +LM
Sbjct: 478 RASLNSVNSFLM 489

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  491 bits (1264), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 333/481 (69%), Gaps = 14/481 (2%)

Query: 25  LNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGL 84
           ++ DL F  +LN +N++IKKE  +LRNR+QSILFD+ F+ ++V+  FPNYPLIPNERCGL
Sbjct: 1   MDPDLAF--SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGL 58

Query: 85  WYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDA 144
           WYCDP+ + QTSYFKSTDGH+NQWDFS RRLN+HLLP + +K GI+IVDSTRRGK MPDA
Sbjct: 59  WYCDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDA 118

Query: 145 LSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204
           LSKT+PIWCAVLNS+M   +  + EVLF PP  VS SE + IK+RIPSLV R ++L +  
Sbjct: 119 LSKTIPIWCAVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILD 175

Query: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSYQ 263
           + +L     GKILRP WVYPG+ +L S  DPFTG+I+   WE   NE  +P++LCT SY+
Sbjct: 176 AQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYR 235

Query: 264 CQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTS 323
            QDGVDKRHGFTYVQGAADDHELW+ GL  +L W +   F D   +D+EL ++V  L+  
Sbjct: 236 AQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIEL 295

Query: 324 GDANNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXXXXXX 383
            +  +       L D++  + +T+EL LG++ ++  +  N+  +                
Sbjct: 296 AETTDHRN---HLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVT 352

Query: 384 XYEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL----PVLICCNNGKDMS 439
             +  + I+ + LQSGSK+SS+ LRAAL +I  ++ A+L   +    P+++CCN+G D+S
Sbjct: 353 LSKPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDIS 412

Query: 440 VCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYL 499
           V V+L +LC+ ++ + W L +  SV+K +I++HL ++I K+  RN+NP R +LNS+N +L
Sbjct: 413 VGVILMILCKYYS-QDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471

Query: 500 M 500
           M
Sbjct: 472 M 472

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  491 bits (1265), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 242/495 (48%), Positives = 342/495 (69%), Gaps = 22/495 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD     +L+ +NK++++ENK++RNRLQSIL D++FL+E+V+++FP++P++PNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           C+P  + +TSYFKSTDGH NQWDFS RRLN HLL TI  K GI+I+DSTRRGK++PD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 147 KTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203
           KTVPIWCAVLN+IML+  + +   ++VL+ PP TV  SE++ IK +IP LVA+ K+L + 
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIV-TPTWEA-QNENFMPVVLCTVS 261
            S++L  +  GKILRPIWV+PG+SLLN   D FTG++    TWEA +++N +P++LCTVS
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 262 YQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLV 321
           YQ QDG+DKR+GFTYVQGAADDHELW+ GL +E+FW H++   DT  SD +L  Y+ +LV
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 322 TSGDANN-KLTKSLRLDDML-NANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXX 379
                N   +     LD++  N + +T E+ LG+V + + +   L  +            
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 380 XXXXXYEEAEN---------IRIFKLQSGSKKSSRALRAALTQICPLIEANLQN----SL 426
                 E+ ++         I +FKLQSG KKSS+ LR    +I   +++   N    + 
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQLE-QRPSVHKSIIKKHLAKMITKLDGRNL 485
           P+LICCN G DMS+ V+LS+LC  +  E W+L  + P V+K II++HL K+I+ L GRN+
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKY-TEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNV 479

Query: 486 NPPRVSLNSVNDYLM 500
           NP R +LNSVN +LM
Sbjct: 480 NPSRATLNSVNSFLM 494

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 344/491 (70%), Gaps = 20/491 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD     +L  ++KE+K+++++LRNR+QSIL D+ FLE +V   FP++PLIPNERCGLWY
Sbjct: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           C+P  ++QTSYFKSTDGH+NQWDFS RRLN HLLPT+ + GG+VIVDSTRRGK++PDALS
Sbjct: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131

Query: 147 KTVPIWCAVLNSIMLE--GRQ-SEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203
           KTVP+WCAVLNS+MLE  G++ +  +VLF PP TV  SE +++  ++P LV + K L +F
Sbjct: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191

Query: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSY 262
              +  ++LDGK+LRP WV+PG+SLL S  D FTG+ +   WE +++EN +P++LCTVSY
Sbjct: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251

Query: 263 QCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVT 322
           Q QDG+DKR+GFTYVQGAADDHELW+ GL A +FW +I+ FK+ +  D EL   V+ +VT
Sbjct: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311

Query: 323 SGDANNKLTKSLR---LDDMLNA-NELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXX 378
               NN + +S +   LD ++   +++T  L LG++ +N+ L    +             
Sbjct: 312 Q--QNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVL 369

Query: 379 XXXXXXYEEA----ENIRIFKLQSGSKKSSRALRAALTQICPLIEAN--LQNSLPVLICC 432
                  ++A    E ++IF+L SGSKKSS+ LRA L  I   I     LQ   P+LICC
Sbjct: 370 SETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLICC 429

Query: 433 NNGKDMSVCVVLSVLCRNFNVESWQL---EQRPSVHKSIIKKHLAKMITKLDGRNLNPPR 489
           N GKDMS+ V+L+VLC+N++ E W L   + +PSV K +I++HL K+I  L+GRN+NP R
Sbjct: 430 NTGKDMSIGVLLAVLCQNYD-EVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSR 488

Query: 490 VSLNSVNDYLM 500
            +LNS+N +LM
Sbjct: 489 ATLNSINSFLM 499

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  490 bits (1262), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 242/490 (49%), Positives = 340/490 (69%), Gaps = 20/490 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD    ++L  +NK+I+KENK++RNRLQSIL D++FL ++VL  FP++P+IPNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
             PE + QTSYFKSTDGH+NQWDFS RRLN HL PT+   GGI+IVDSTRRGK++PDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 147 KTVPIWCAVLNSIMLEGRQSEE-----EVLFCPPNTVSGSEFERIKSRIPSLVARFKELG 201
           KT+PIWCAVLN IML  ++  +     +VLF PP T+S +E++ I  RIP LV +  +L 
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 202 LFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEA-QNENFMPVVLCTV 260
           +   +ELF +L GK+LRP WVYPG+SLL S RD FTG+I   +W   Q+ N +P++LCT+
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240

Query: 261 SYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNL 320
           SY+ QDG DKRHGFTYVQGAADDHELW+EGLT  LFW HI  F++   ++++++ +V  L
Sbjct: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300

Query: 321 VTSGDANNKLTKSLRLDDMLN-ANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXX 379
           V   D   + +    ++D  +  + +T +L LG++ +N+ + K L ++            
Sbjct: 301 VQEQDDAGEQSD---INDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILS 357

Query: 380 XXXXXYE-EAENI----RIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL--PVLICC 432
                   + EN+     IFKLQSGSKKSS+ LR  + +I  L+E+ + N+L  P+LICC
Sbjct: 358 ENVELDPVDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILICC 417

Query: 433 NNGKDMSVCVVLSVLCRNFNVESWQLEQRPS--VHKSIIKKHLAKMITKLDGRNLNPPRV 490
           N G DMS+ ++L++LCRN++ E W L +  +  + K +I+K L ++I+ L+GR +N  R 
Sbjct: 418 NTGTDMSIGILLALLCRNYS-ERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRA 476

Query: 491 SLNSVNDYLM 500
           +LNSVN+YLM
Sbjct: 477 TLNSVNNYLM 486

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/495 (49%), Positives = 339/495 (68%), Gaps = 22/495 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD     +L+ +NK+I+KENK++RNRLQSIL D++FL+++V+ +FP+YPLIPNERCGLWY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           C+P  + QTSYFKSTDGH NQWDFS RRLN HLL TI    GI+IVDSTRRGK++PDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 147 KTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203
           KTVPIWCAVLN++ML+  +     ++VL+ PP TV  SE++ IK +IP LVA+ ++L + 
Sbjct: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199

Query: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT-PTWEA-QNENFMPVVLCTVS 261
            S +L ++  GK+LRPIWV+PG+SLL+   D FTG++     WE  +++N +P++LCTVS
Sbjct: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259

Query: 262 YQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLV 321
           YQ QDG+DKR+GFTYVQGAADDHELW+ GL + +FW HIE   D + SD +L  Y+ +L 
Sbjct: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319

Query: 322 TSGDANN-KLTKSLRLDDML-NANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXX 379
            +   N   +     LD++  N +++T E+ LG+V+  + ++KNL  +            
Sbjct: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379

Query: 380 XXXXXYEEAEN---------IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS----L 426
                 E+ ++         I I+KLQSG KKSS+ALR+   +I   I++   N      
Sbjct: 380 NSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439

Query: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQL-EQRPSVHKSIIKKHLAKMITKLDGRNL 485
           P+LICCN G DMS+ V+LS+LC  +  E W L  + P + K I++KHL K+I+ L GRN+
Sbjct: 440 PMLICCNTGTDMSIGVILSILCTKY-TEEWMLTSELPDISKLIVRKHLTKLISHLKGRNV 498

Query: 486 NPPRVSLNSVNDYLM 500
           NP R +LNSVN +LM
Sbjct: 499 NPSRATLNSVNSFLM 513

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  489 bits (1259), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/485 (50%), Positives = 333/485 (68%), Gaps = 19/485 (3%)

Query: 32  DQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPER 91
           D ++N ++K+IKKE K+L+NR+QSIL D RFLE+ V+  FP +P+IPNERCGLWYC+P+ 
Sbjct: 8   DYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKL 67

Query: 92  YSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPI 151
           + QTSYFKSTDGH NQWDFS RRLN HLLPT+ Q GGIVIVDSTRRGK++PDALSKTVPI
Sbjct: 68  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPI 127

Query: 152 WCAVLNSIMLEG----RQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDE 207
           WCAVLNS+MLE          +VLF PP+TV  SE++RI  ++P L+ R  +L +    +
Sbjct: 128 WCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187

Query: 208 LFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEA-QNENFMPVVLCTVSYQCQD 266
           L+K  +GK+LRPIW++PG+SLL S  D FTG+     WE  ++E  +P++LCTVSY+ QD
Sbjct: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQD 247

Query: 267 GVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGDA 326
           GVDKRHGFTYVQGAADDHELW+ GL  ++FW +IE F D   S+  L + V +L+ +   
Sbjct: 248 GVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQK 307

Query: 327 NNKLTKSLRLDDMLNANELTRELHLGQVAENI----ELDKNLVDQXXXXXXXXXXXXXXX 382
               T++L   + L+   +T ++ LG++A+ +     L   L+ +               
Sbjct: 308 EVSETETLEAFNPLDM--ITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365

Query: 383 XXYEE--AENIRIFKLQSGSKKSSRALRAALTQICPLIEA-----NLQNSLPVLICCNNG 435
              EE   + I I +LQSGSKKSS+ALR  L ++   IE        ++ LP+LICCN+G
Sbjct: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425

Query: 436 KDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSV 495
            DMS+ +VL +LC++++++ W   +   V+K II+KHL K+I+ L GRN+NP R +LNSV
Sbjct: 426 TDMSIALVLMLLCKHYDLD-WNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484

Query: 496 NDYLM 500
           N+YLM
Sbjct: 485 NEYLM 489

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  486 bits (1252), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 240/494 (48%), Positives = 343/494 (69%), Gaps = 29/494 (5%)

Query: 32  DQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPER 91
           D ++N + K+I+KENK+L+NR+ SIL D +FL+E+V+  FP YPL+PNERCGLWYC    
Sbjct: 4   DASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRAN 62

Query: 92  YSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPI 151
           ++ TSYFKSTDGH NQWDFS RRLN HL+P I ++ GI+I+DSTRRGK++PDALSKTVPI
Sbjct: 63  FTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPI 122

Query: 152 WCAVLNSIMLEGRQSEE----EVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDE 207
           WCAVLN+++L+  ++EE    EVLF PP TVS SE+ERIK++IP LV +  +L +    +
Sbjct: 123 WCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKK 182

Query: 208 LFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT-PTWE--AQNENFMPVVLCTVSYQC 264
           L++  +G +LRPIW++PG+S+L S  DPFTG+IV+  +WE  ++ E  +P+VLCTVSYQ 
Sbjct: 183 LYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQV 242

Query: 265 QDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSG 324
           QDGVD R GFTYVQGAADDHELW+ GL+ +LFW +IE+  +  LS++ L  YV  ++ S 
Sbjct: 243 QDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLS- 301

Query: 325 DANNKLTKSLRLDDMLNA-NELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXXXXXX 383
             + K+T +L +D +  + +++T EL+LG + + +E+ +NL++                 
Sbjct: 302 -ESMKIT-NLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359

Query: 384 XYEEAEN-------------IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS----L 426
              + +N             I++F+LQSGSKKSS+ LR+ L +IC L+   L +S     
Sbjct: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419

Query: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLN 486
           P+L+CCNNG DMS+ V+L  L + +  E  +  +   ++K  I+KHL K+I+ L GRN+N
Sbjct: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479

Query: 487 PPRVSLNSVNDYLM 500
           P R +LNSVND+LM
Sbjct: 480 PSRATLNSVNDFLM 493

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  484 bits (1247), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 238/496 (47%), Positives = 335/496 (67%), Gaps = 20/496 (4%)

Query: 25  LNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGL 84
           ++ ++    +L+ +NK+++KENK++RNRLQSIL D+RFL ++VL +FP +P++PNERCGL
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 85  WYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDA 144
           WYC+P  + QTSYFKSTDGH NQWDFS RRLN HLL  I +  GI+IVDSTRRGK++PDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 145 LSKTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELG 201
           LSKTVPIWCAVLN+IML+  +     ++VL+ PP TV  SE++ IK +IP LV + ++L 
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLN 194

Query: 202 LFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDI-VTPTWEA-QNENFMPVVLCT 259
              S  L K+  GKILRPIWV+PG+SLLN   D FTG+I     WE+ +++N +P++LCT
Sbjct: 195 AIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCT 254

Query: 260 VSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNN 319
           VSYQ QDG+DKR+GFTYVQGAADDHELW+ GL +++FW HI+   DT  SD +L  Y+ +
Sbjct: 255 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITD 314

Query: 320 LVTSG-DANNKLTKSLRLDDML-NANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXX 377
           L+    +    +     LDD+  N +++T E+ LG+V + + +++ L  +          
Sbjct: 315 LIGKKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVII 374

Query: 378 XXXXXXXYEEAEN---------IRIFKLQSGSKKSSRALRAAL----TQICPLIEANLQN 424
                     A++         I ++KLQSG KKSS+ALR+       ++ P+     + 
Sbjct: 375 FSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKG 434

Query: 425 SLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRN 484
             P+L+CCN G DMS+ V+LS+LC  +N E     + P V+K II+KHL K+I+ L GRN
Sbjct: 435 MKPILVCCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRN 494

Query: 485 LNPPRVSLNSVNDYLM 500
           +NP R +LNSVN +LM
Sbjct: 495 VNPSRATLNSVNSFLM 510

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  484 bits (1246), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 244/501 (48%), Positives = 339/501 (67%), Gaps = 33/501 (6%)

Query: 31  FDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPE 90
           F  +L+ +NK+IKKE K+LRNRLQSIL D+ FL ++++A FPNYP+IPNERCGLWY  P 
Sbjct: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65

Query: 91  RYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVP 150
           +Y+QTSYFKSTDGH+NQWDFS RRLN HLL TI +  GI I+DSTRRGK++PDALSKT+P
Sbjct: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125

Query: 151 IWCAVLNSIMLEGRQSE------EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204
           IWCAVLN IML   +        E+ LF PP TV  SE++ I  +IP+LV +  +L +  
Sbjct: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185

Query: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTP-TWEAQNENFMPVVLCTVSYQ 263
           ++EL     GK+LRP+W+YPG+S+L+S RD FTG+      WEA  EN +P+VLCT+SYQ
Sbjct: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP-ENIIPIVLCTISYQ 244

Query: 264 CQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTS 323
            QDGVDKR+GFTYVQGAADDHELW+ GLT ELFW HI    +   SD EL  YV +++  
Sbjct: 245 AQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM 304

Query: 324 --GDANNKLTKSLRLDDML--NANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXX 379
              D+  K T  L +D +     + +T E+ LG++  NI++ K+++ +            
Sbjct: 305 KIKDSAAK-TVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILS 363

Query: 380 XXXXX------YEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCN 433
                       +++++++I+KL SGSKKSS+ LR  + +I  ++  NL N  P+LICCN
Sbjct: 364 ETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCN 423

Query: 434 NGKDMSVCVVLSVLCRNF-----NVESW-QLEQRPS--------VHKSIIKKHLAKMITK 479
            G D+S+ ++L++LC+N+     N ++W +LE+           + K+II+K+L  +I+ 
Sbjct: 424 TGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISH 483

Query: 480 LDGRNLNPPRVSLNSVNDYLM 500
           L+GRN+NP R +LNSVNDYLM
Sbjct: 484 LEGRNVNPSRATLNSVNDYLM 504

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  482 bits (1241), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 242/495 (48%), Positives = 334/495 (67%), Gaps = 22/495 (4%)

Query: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86
           MD     +L  +N++++KENK++RNRLQSIL D++FL+++V+ +FP +PL+PNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146
           C P  Y QTSYFKSTDGH NQWDFS RRLN HLL TI    GI+IVDSTRRGK++PDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 147 KTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203
           KTVPIWCAVLN+IML+  +     ++ L+ PP TV  SE++ IK +IP LV + ++L + 
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT-PTWEA-QNENFMPVVLCTVS 261
            S +L ++  GKILRPIWV+PG+SLLN   D FTG+I    TWE  +++N +P++LCTVS
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 262 YQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLV 321
           YQ QDG+DKR+GFTYVQGAADDHELW+ GL +++FW H+E   D   SD +L  Y+ +LV
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 322 TSG-DANNKLTKSLRLDDMLN-ANELTRELHLGQVAENIELDKNLVDQXXXXXXXXXXXX 379
                +   +     LD++    +++T E+ LG+V + + +++ L ++            
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 380 XXXXXYEEA---------ENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL---- 426
                 E+A           I ++KLQSG KKSS+ALR+ L +I   +E    N      
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQR-PSVHKSIIKKHLAKMITKLDGRNL 485
           P+L+CCN G DMS+ V+LS+LC  +  E W L Q  P V+K II+KHL K+I+ L GRN+
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKY-TEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNV 479

Query: 486 NPPRVSLNSVNDYLM 500
           NP R +LNSVN +LM
Sbjct: 480 NPSRATLNSVNSFLM 494

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  468 bits (1204), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 327/483 (67%), Gaps = 18/483 (3%)

Query: 34  TLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYS 93
           +L+ + K+IK E ++L+NRLQSI+ D+ FLE +V+  FPNYP+IPNERCGLWYCDP+ + 
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 94  QTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWC 153
           QTSYFKSTDGH NQWDFS RRLN HLLP + +  GI+IVDSTRRGK++PDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 154 AVLNSIMLEGRQSE----EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDELF 209
           AVLN ++LE   +E    E+VLF PP TVS SE+ RI  +I  LV + K L +    EL+
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 210 KILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEA-QNENFMPVVLCTVSYQCQDGV 268
            + +GK++RP WVYPG+SLL++  DPFTG+     W   +NEN +P++LCTVSYQ QDGV
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242

Query: 269 DKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGDANN 328
           DKR GF YVQGAADDHELW+ GL  + FW++I+   D   +D  L  +V+ L    +   
Sbjct: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302

Query: 329 KLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQXXXXXXXXX--XXXXXXXXYE 386
           K + S+ +D   + N +T E+ LG++ +N  +D  L  +                    E
Sbjct: 303 KASSSI-IDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLE 361

Query: 387 EAEN--IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS-----LPVLICCNNGKDMS 439
           EA    I++FKLQSGSKKSS++LR  L +I   I    Q++      P+LICCN+G DMS
Sbjct: 362 EATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGNDMS 421

Query: 440 VCVVLSVLCRNFNVESWQLEQRPS--VHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVND 497
           V V+L++L + ++ E WQLE      + K++I+KHLAK+I+ L GRN+NP R +LNS+N 
Sbjct: 422 VAVILTILSKKYS-EGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480

Query: 498 YLM 500
           YLM
Sbjct: 481 YLM 483

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  391 bits (1004), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 269/411 (65%), Gaps = 12/411 (2%)

Query: 95  TSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCA 154
           T YFKSTDGH N WDFS+RRLN HLLP + ++ G +IVDSTRRGK++PDALSKT+PIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 155 VLNSIMLEGRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDELFKILDG 214
           VLN+++LE  +   EVLFCPP TVS  E+ RI++++P LV + K +   +  EL  +L G
Sbjct: 65  VLNTLILEHTEGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSLLGG 124

Query: 215 KILRPIWVYPGASLLNSHRDPFTGDIVTPTWEAQNENFMPVVLCTVSYQCQDGVDKRHGF 274
           ++LRP WVYPGA++L + RD FTG+ +   W+      +P++LCT S QCQDGVDK  G+
Sbjct: 125 RLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPP-PGVIPLILCTASRQCQDGVDKSQGY 183

Query: 275 TYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGDANNKLTKSL 334
            YVQGAADDHELWA GLT  LFW ++++  D ++ +Q L  +V  +V      +K T + 
Sbjct: 184 AYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVEL----HKSTHTE 239

Query: 335 RLDDMLNANE---LTRELHLGQVAENIELDKN--LVDQXXXXXXXXXXXXXXXXXYEEAE 389
            +   L   E   +T  L LG VA     DK   L++Q                      
Sbjct: 240 AVAHELPCRETDVVTEHLRLGSVAPCQISDKQAELLEQQYSLVVLCGSSIELSAAAPHP- 298

Query: 390 NIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCNNGKDMSVCVVLSVLCR 449
            IRI+ L SG KKSSRALR AL +I PLI   L  +LPVLICC++G D+SV +VL+ LC+
Sbjct: 299 RIRIYPLNSGCKKSSRALRPALIEIIPLISTALCEALPVLICCSSGSDISVGIVLAALCK 358

Query: 450 NFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYLM 500
           N+++E W+ E +  + K+IIKKHL K+ +K+ GR +NP R +LNSVN +LM
Sbjct: 359 NYDLE-WRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>NDAI0A02220 Chr1 (500381..501811) [1431 bp, 476 aa] {ON} Anc_7.297
           YDL133W
          Length = 476

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 48/127 (37%), Gaps = 12/127 (9%)

Query: 20  SCLPNLNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNY--PLI 77
           + +P   +D  F +     + E  +E       L  I  DH    +Q L    N     I
Sbjct: 68  TTVPPFELDAQFQKAKLKTSMESSREEHIAS--LNGIKRDHHQFRDQFLVTHDNKWDSFI 125

Query: 78  PNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRR 137
            N    + Y + +RY   S    T+  ++ +D S R  N H L +          D TRR
Sbjct: 126 ANIGSNVAYSNKQRYVVDSESTDTESSAHSFDGSFREKNAHFLSSYD--------DETRR 177

Query: 138 GKRMPDA 144
             ++ +A
Sbjct: 178 KNQVDEA 184

>TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4909

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 400  SKKSSRALRAALTQICPLIEANLQNSLPVLICCNNG-KDMSVCVVLS--------VLCRN 450
            +K+SS     AL ++  L+   LQN+ PVL+    G    ++C +L+         L  +
Sbjct: 1335 AKESSVVWTKALRRLSVLVSTCLQNNEPVLLVGETGCGKTTICQLLAWFKTKQLITLNAH 1394

Query: 451  FNVESWQL--EQRPSVHKSIIKKHLAKMITKLDGRNLN 486
             N E+  L   QRP  ++S I+  LA+ + ++ G +L+
Sbjct: 1395 QNTETGDLLGAQRPVRNRSAIQAKLAEELREVLGSSLS 1432

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,602,652
Number of extensions: 2333359
Number of successful extensions: 6506
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6586
Number of HSP's successfully gapped: 24
Length of query: 500
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 386
Effective length of database: 40,409,475
Effective search space: 15598057350
Effective search space used: 15598057350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)