Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102138.853ON93693649410.0
KLTH0C03674g8.853ON94893330710.0
SAKL0D01078g8.853ON93693525220.0
Suva_13.4778.853ON96993020150.0
Skud_13.4608.853ON96993720070.0
YMR287C (DSS1)8.853ON96993819820.0
Smik_13.5038.853ON96993319700.0
ZYRO0C14938g8.853ON96694119350.0
TDEL0B002208.853ON93590918700.0
KNAG0E011408.853ON92990518110.0
CAGL0M07051g8.853ON92396016890.0
NCAS0C003008.853ON94094016490.0
KAFR0L019708.853ON93291216370.0
AFR448W8.853ON81781815840.0
NDAI0K003208.853ON96292515440.0
TBLA0B029208.853ON102998415130.0
Kpol_237.48.853ON91683714620.0
KLLA0C06314g8.853ON98393614490.0
TPHA0I003508.853ON94392014081e-180
KLTH0H13420g1.367ON9864341513e-09
ZYRO0G01166g1.367ON9933781381e-07
TDEL0D023801.367ON9974321381e-07
SAKL0D10186g1.367ON9883771344e-07
Kpol_1043.421.367ON9884341335e-07
TPHA0A023201.367ON10153741326e-07
CAGL0H04411g1.367ON10073921301e-06
Skud_15.1371.367ON10304321301e-06
KLLA0A10835g1.367ON10083791301e-06
Kwal_34.162451.367ON9863771282e-06
NCAS0D005901.367ON9984361282e-06
NDAI0H035601.367ON10123791254e-06
KNAG0C019501.367ON9964611254e-06
Suva_15.1471.367ON10013911246e-06
Smik_15.1451.367ON10013911237e-06
YOL021C (DIS3)1.367ON10013941237e-06
TBLA0D050701.367ON9974311202e-05
KAFR0C045301.367ON10003751149e-05
Ecym_27151.367ON9883751093e-04
AEL031C1.367ON9973831030.002
SAKL0G10142g5.307ON1249345820.50
TBLA0C032805.307ON1313145791.1
Kwal_26.82062.566ON506127781.3
Kwal_23.57055.307ON1228340762.9
NCAS0F025705.307ON1245384753.3
Kwal_47.182765.601ON19337714.5
YDR293C (SSD1)5.307ON1250191744.9
NDAI0C040505.307ON126052735.1
Kpol_1032.835.247ON677114735.7
Smik_4.5425.307ON1251126736.2
TDEL0E032005.307ON1257109727.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10213
         (936 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...  1907   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...  1187   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   976   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   780   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   777   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   768   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   763   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   749   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   724   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   702   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   655   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   639   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   635   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   614   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   599   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   587   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   567   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   562   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   546   e-180
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    63   3e-09
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    58   1e-07
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    58   1e-07
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    56   4e-07
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    56   5e-07
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    55   6e-07
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    55   1e-06
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    55   1e-06
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    55   1e-06
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    54   2e-06
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    54   2e-06
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    53   4e-06
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    53   4e-06
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    52   6e-06
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    52   7e-06
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    52   7e-06
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    51   2e-05
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    49   9e-05
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    47   3e-04
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    44   0.002
SAKL0G10142g Chr7 (862958..866707) [3750 bp, 1249 aa] {ON} simil...    36   0.50 
TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {...    35   1.1  
Kwal_26.8206 s26 complement(690185..691705) [1521 bp, 506 aa] {O...    35   1.3  
Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa]...    34   2.9  
NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5....    33   3.3  
Kwal_47.18276 s47 complement(762340..762921) [582 bp, 193 aa] {O...    32   4.5  
YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON...    33   4.9  
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    33   5.1  
Kpol_1032.83 s1032 (178927..180960) [2034 bp, 677 aa] {ON} (1789...    33   5.7  
Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {O...    33   6.2  
TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5....    32   7.7  

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score = 1907 bits (4941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/936 (98%), Positives = 918/936 (98%)

Query: 1   MRMYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDR 60
           MRMYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDR
Sbjct: 1   MRMYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDR 60

Query: 61  YYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRL 120
           YYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRL
Sbjct: 61  YYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRL 120

Query: 121 VPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLR 180
           VPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLR
Sbjct: 121 VPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLR 180

Query: 181 IPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSR 240
           IPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSR
Sbjct: 181 IPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSR 240

Query: 241 MAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLN 300
           MAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLN
Sbjct: 241 MAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLN 300

Query: 301 GSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPL 360
           GSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPL
Sbjct: 301 GSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPL 360

Query: 361 ASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNG 420
           ASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNG
Sbjct: 361 ASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNG 420

Query: 421 AMATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALE 480
           AMATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNT                  TALE
Sbjct: 421 AMATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALE 480

Query: 481 EKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540
           EKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP
Sbjct: 481 EKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540

Query: 541 VSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFS 600
           VSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFS
Sbjct: 541 VSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFS 600

Query: 601 VNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISL 660
           VNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISL
Sbjct: 601 VNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISL 660

Query: 661 LLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANT 720
           LLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANT
Sbjct: 661 LLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANT 720

Query: 721 LAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSF 780
           LAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSF
Sbjct: 721 LAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSF 780

Query: 781 YTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQS 840
           YTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQS
Sbjct: 781 YTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQS 840

Query: 841 RDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGIL 900
           RDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGIL
Sbjct: 841 RDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGIL 900

Query: 901 KLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKMV 936
           KLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKMV
Sbjct: 901 KLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKMV 936

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/933 (59%), Positives = 711/933 (76%), Gaps = 2/933 (0%)

Query: 3   MYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYY 62
           M R FH   +AL++ P  ++S+ N+P  AK +Y+R GQLEPGVEIKQLS IQ GL++R+Y
Sbjct: 17  MVRHFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFY 76

Query: 63  EQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVP 122
            Q+ +PSK WCRDN   W  MK+YLNMDL SLS KQ+ADM+ SL+P+V+D  S TFR+ P
Sbjct: 77  NQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHP 136

Query: 123 KELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIP 182
             LL S LKIGDLVLLRS+P+QLC CVEVPT+V NPSYAFATIDG I++  R+MILLRIP
Sbjct: 137 SHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIP 196

Query: 183 SFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMA 242
           SFH+ +A +LI+EE P+L+ RIG VKDSPEKTF+L I+ARQLYTSY PF+ITK AW+RM 
Sbjct: 197 SFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMG 256

Query: 243 ILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGS 302
           + T+KLELLHRFLQRS+GPWQ+SIFKLC++  +LD++K +SS   SYI+ + ++ G+   
Sbjct: 257 VTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGSYIEGILKEAGMFRD 316

Query: 303 PNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLAS 362
            +  +  SG    ++S+DA+D+LAT+W+L QQQE+NLWGQ  +H+AML P+SVTVLPL S
Sbjct: 317 AHPIESFSG--RSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTS 374

Query: 363 RHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAM 422
            HLYY+ VLK+LKKDN+  +  FA L+N+G    A  + PQ  ++L+DYAAGNFHNNG +
Sbjct: 375 HHLYYKEVLKELKKDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPI 434

Query: 423 ATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEK 482
            T+VSKLFR +D ++  DITRDLCHE +++L+  +                     LE+K
Sbjct: 435 ITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQK 494

Query: 483 IYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVS 542
           IY++A P+  +DI  R DF  MNVYCIDSE+AHEIDDGISIE  G NA+TLHIHIADPVS
Sbjct: 495 IYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVS 554

Query: 543 LFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVN 602
           LF+      F+ E+WNIA +RGFT+YLPD V PMLP+S+  AG LG +   SKT+SFSV+
Sbjct: 555 LFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVD 614

Query: 603 IKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLL 662
           I+     + I EE+F V+LG  ++FP+VTY  VDRIL    D +Q+ +ELRTL++I+LLL
Sbjct: 615 IRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLL 674

Query: 663 QSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLA 722
           +SKR+ EQ AIIFGEGFNRGLVKL   ++     + FEDQ +T STVLVSE+MILANT+A
Sbjct: 675 RSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMA 734

Query: 723 GRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYT 782
           G++F+   IPGVFRCYK L LK  AR+ Y SLR M  S   P+ +DIAKLSSLLNSSFY+
Sbjct: 735 GKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYS 794

Query: 783 GTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRD 842
              ++H MIGAPAYL VTSPLRRF DL+NH Q+  +L   PL FS+  + ++ WH+QSRD
Sbjct: 795 ARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRD 854

Query: 843 LVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKL 902
           +V+RKAARDSASFWTL HLKS Q+ +P R++SVMVTS+PR+G VRCVLP+LS ARGILKL
Sbjct: 855 VVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKL 914

Query: 903 KPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935
           KPE S+ VAIGD++HNC IT+LDCLD++MEL+M
Sbjct: 915 KPEASSTVAIGDVVHNCRITRLDCLDSIMELEM 947

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/935 (50%), Positives = 656/935 (70%), Gaps = 10/935 (1%)

Query: 5   RSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQ 64
           R  H+     R+     RS  N+    KI +  A  LEP VEIKQLS+++   ++RYY +
Sbjct: 5   RRIHTTRLLRRKVASGDRSKDNL---EKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHR 61

Query: 65  YLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKE 124
           Y  PSK W   N ++    K++ N+D    S+K    +  +L  ++YDK S TF L P +
Sbjct: 62  YFTPSKIWFTQNVSRTQSFKHFFNLDPQRSSDKY---ILPTLNERLYDKGSHTFYLSPSD 118

Query: 125 LLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSF 184
           L+ +PLKIGDLVLLRSNPTQL  CV++PTD+M+P Y FA++DG +++A R+MI+LRIPS 
Sbjct: 119 LMNTPLKIGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSC 178

Query: 185 HRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAIL 244
           H++    L++ E+ +    IG VK+SP  T++LPILARQL TSY PF+ITK+AW+++ I+
Sbjct: 179 HKQELDGLVQLERKHSYEPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIV 238

Query: 245 TQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAES---YIKELFQKLGLNG 301
           ++KLELLHRFLQRS+GPWQ+SIF LC++   LDL++  S    S   Y+  LFQK+GL+ 
Sbjct: 239 SKKLELLHRFLQRSTGPWQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDS 298

Query: 302 SPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLA 361
           +     +Q+ +++    +DA+ +L+T+W+L +QQE  +WG  QTH+ +L P+SVTVLPL 
Sbjct: 299 NLYCLGEQNLHVNPPNKIDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLN 358

Query: 362 SRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGA 421
           S HLYYE V+  LK+DN+R++ +FA LVN  N+    +  PQ  QILK+YAAGNF+NNGA
Sbjct: 359 SEHLYYENVVSTLKQDNYRMLDEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGA 418

Query: 422 MATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEE 481
           M T+VSK+FR +  +K RD TRD+CHEL+ ++S                      +ALE+
Sbjct: 419 MITLVSKIFRKLHTYKERDTTRDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQ 478

Query: 482 KIYEMAQPS-TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540
            +Y++++P  T++D   R DF  M VYCIDSE+AHEIDDGISIE L    + LHIHIADP
Sbjct: 479 VVYDISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLSEKKYRLHIHIADP 538

Query: 541 VSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFS 600
            S F +    +  D+V +IA++R FTTYLPD+VLPMLP+S+C A  LG +  K+KT+SFS
Sbjct: 539 ASSFAKSTDPEARDDVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFS 598

Query: 601 VNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISL 660
           ++I  H G LR+ +++FK+RLG  ++FP+VTY+ VD +LQ    + +EA +L+ +Y+++ 
Sbjct: 599 IDIYFHQGTLRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYPEKQPKEASDLKLMYEVAK 658

Query: 661 LLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANT 720
            L++KR+  Q AIIFGEGFN+GLVKL+  E+G L KI FEDQ ++ STVLVSEMMILANT
Sbjct: 659 SLRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEMMILANT 718

Query: 721 LAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSF 780
           L G YF+ NKIPGVFRCY EL LK  A + Y  ++ MT+S   P + DI  +SSLLNSSF
Sbjct: 719 LTGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSF 778

Query: 781 YTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQS 840
           YTG P +H MIGA  YLTVTSPLRRFPD+INHLQI +HL   PL FS+ ++D + WH+QS
Sbjct: 779 YTGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQS 838

Query: 841 RDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGIL 900
           RD+V++ AAR SA++WTLK LK+  +   D + +VMVTS+P MG V C  P+L+AARG L
Sbjct: 839 RDVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTL 898

Query: 901 KLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935
            L P+ +   AIGDL+H C +TKLDCLD V+EL++
Sbjct: 899 NLDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELEI 933

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/930 (43%), Positives = 577/930 (62%), Gaps = 40/930 (4%)

Query: 20  PVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTK 79
           PV + + +    +    R   LEP +E+KQL +I+     RY ++Y++PS+ W  ++   
Sbjct: 63  PVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNS--- 119

Query: 80  WGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLR 139
           W  +          +   +  ++D   + K+  ++S+     P +L+K+PL +GDLVLL+
Sbjct: 120 WRSLTK------PKIPSYKLINLDIHFDTKL--ESSKQMEFQPAQLMKNPLNVGDLVLLK 171

Query: 140 SNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPY 199
           S P +L  CV +P+  M+P Y FA+IDG + +A ++ +LLRIP         L++ E  +
Sbjct: 172 SRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHH 231

Query: 200 LDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSS 259
               IGTVK+   +T ILPI+ARQ+ TS +P +I+K AW  + I T+KL+LLHR LQ   
Sbjct: 232 KHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYM 291

Query: 260 GPWQVSIFKLCQMAVMLDLEK-FRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIES 318
           GPWQ+  F L  +   LDL K   + +  +Y+ +L          NS++           
Sbjct: 292 GPWQIPFFTLVGLVQKLDLNKALDNKNGVNYLADLV---------NSYKSADS-----VP 337

Query: 319 VDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDN 378
           +++A +++T+WA+ QQQE+NLWG+   + A+L+P SVT++PL SRHLYY  V++ L+ DN
Sbjct: 338 MNSATFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADN 397

Query: 379 HRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKG 438
           ++ I +F  LVN   +    S  P   Q+LKD+AAGNFHNNG + T++SK+FR I+++KG
Sbjct: 398 YKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKG 457

Query: 439 RDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEKIYEMA-----QPSTKE 493
            DITRD+C +L+ ++                          ++K+YE+      Q     
Sbjct: 458 SDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSN 517

Query: 494 DIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLFTEDGGTK- 551
               R+DF  + V+CIDSE+AHEIDDG+SIE   ++  +TLHIHIADP SLF E    + 
Sbjct: 518 INGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIES 577

Query: 552 --FNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG 609
                +V N+A +R FTTYLPDLV+PMLP+S C    LG    K++T+SFSV++K+    
Sbjct: 578 QGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKS 637

Query: 610 ----LRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKE-LRTLYQISLLLQS 664
               + I   S K+R G  + FPK TY+ VDRIL   + +    KE L +L  IS LL+ 
Sbjct: 638 TGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRE 697

Query: 665 KRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGR 724
            RI +  A+IFGEGFNRGLV LN  + G L ++ F DQ++TPSTVLVSEMMILANTL GR
Sbjct: 698 LRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGR 757

Query: 725 YFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGT 784
           +F  NKI GVFRCYK+L L + A++ Y SL    +    P +EDI KLSSLLNSSFYTG 
Sbjct: 758 FFAENKISGVFRCYKQLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQ 817

Query: 785 PDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLV 844
           P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL FS+  ID +IW +QSR  +
Sbjct: 818 PFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADI 877

Query: 845 IRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKP 904
           ++ A+R+S+++WTL +LK++  S+P++   VM+TS+P+ GF  CV PDLS ARG LKL P
Sbjct: 878 LKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNP 937

Query: 905 EVSADVAIGDLMHNCVITKLDCLDAVMELK 934
                  IGD +  C I K+DCL+ ++EL+
Sbjct: 938 STEHYPMIGDTVKTCKILKIDCLEGILELE 967

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/937 (44%), Positives = 578/937 (61%), Gaps = 52/937 (5%)

Query: 21  VRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKW 80
           ++S +++    K    R   LEP +E+KQLS+I+     RY ++Y+ PS+ W  ++    
Sbjct: 64  IKSAKDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSWRSL 123

Query: 81  GGMK----NYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLV 136
              K    N +N ++          +DA L      K S      P +L++ PL +GDLV
Sbjct: 124 AKPKISSHNLINSNIQ---------LDAQL------KFSNPLEFQPVQLMERPLNVGDLV 168

Query: 137 LLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREE 196
           LLR  P +L  CV +P+  M+P Y F  IDG + +A ++ ILLRIP       + LI+ E
Sbjct: 169 LLRVRPNELAMCVSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPE 228

Query: 197 KPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQ 256
           + Y    IGT+K+   +T ILPI ARQ+ TS  P +I+K AW  +   T+KL+LLHR LQ
Sbjct: 229 ERYGHLPIGTIKNFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQ 288

Query: 257 RSSGPWQVSIFKLCQMAVMLDL-EKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHY 315
              GPWQ+  F L  +   LDL E     +  +Y+  L   LG + + ++          
Sbjct: 289 DYRGPWQIPFFTLVGLVQRLDLNEALDDKYGATYLANL---LGTHQTADNV--------- 336

Query: 316 IESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLK 375
              + +A +++T+WA+ QQQE+N WG+   + A+L+P+SVTV+PL SRHLYYE V+  L+
Sbjct: 337 --PISSATFVSTYWAIMQQQESNFWGEIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLE 394

Query: 376 KDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDV 435
            D++  I +F  LVN   +    +  P   Q+LKD+AAGNFHNNG + T+VSK+FR I+ 
Sbjct: 395 ADDYNEINRFVKLVNERKYRDISTLYPSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIER 454

Query: 436 FKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEKIYEMA-----QPS 490
           +K  DITRD+C +L+ ++   +                      ++K+Y++      Q  
Sbjct: 455 YKDCDITRDICQDLINEILPNSMSNPLLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRK 514

Query: 491 TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLFTEDGG 549
             ++   R+DF  + V+CIDSE+AHEIDDG+SIE  G +  +TLHIHIADP S+F E   
Sbjct: 515 NSDNSSERYDFGDLKVFCIDSETAHEIDDGVSIENHGTDGLYTLHIHIADPTSMFPE--S 572

Query: 550 TKFNDE-----VWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIK 604
           T ++ E     + N+A  R FTTYLPD+V+PMLP+S C    LG    K+KT+SFSV++K
Sbjct: 573 TNYDSEGIITDILNVALERSFTTYLPDVVVPMLPKSICNLSDLGKQGQKTKTISFSVDVK 632

Query: 605 MHDGG----LRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK-ELRTLYQIS 659
           +   G    L I  +SFK+R G  + FPKVTYD VDRIL   ND+    K +L +L  +S
Sbjct: 633 VMSKGDGESLEIMFDSFKIRKGIVSNFPKVTYDDVDRILNTPNDEASPVKKDLESLSMVS 692

Query: 660 LLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILAN 719
            LL+ +RI    A+IFGEGFN+GLV LN  E G L +I F DQ +T STVLVSEMMILAN
Sbjct: 693 NLLRDRRIKNNNAVIFGEGFNKGLVTLNANEEGELTEISFSDQVETLSTVLVSEMMILAN 752

Query: 720 TLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSS 779
           TL G+YF  NKI GVFRCYK+L L   A+E Y+S+   T+    P ++DI KLSSLLNSS
Sbjct: 753 TLTGKYFADNKICGVFRCYKQLPLDIIAQEQYDSMITSTKKGLFPQLKDIVKLSSLLNSS 812

Query: 780 FYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQ 839
           FYTG P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL FS++ ID +IW +Q
Sbjct: 813 FYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQ 872

Query: 840 SRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGI 899
           SR  ++++A R+S+++WTL +LK L+   P++   VM+T++P+ GFV CV PDLS ARG 
Sbjct: 873 SRADILKRAGRNSSTYWTLNYLKKLKKLDPEKTYDVMITAVPQNGFVSCVFPDLSFARGT 932

Query: 900 LKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKMV 936
           LKL P       IGD++ NC I ++DCL+ ++EL+ +
Sbjct: 933 LKLHPSAKHYPMIGDIVKNCKILRIDCLEGMLELETL 969

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/938 (43%), Positives = 578/938 (61%), Gaps = 51/938 (5%)

Query: 16  RGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRD 75
           R  GP + ++++    K   +R   LEP +E+KQL +I+   N RY ++Y+ PS++W  +
Sbjct: 62  RSVGPEKDIESI---NKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVN 118

Query: 76  NGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDL 135
           +   W  +     + L  L      + D  L  K+  K        P +L++SPL +GD 
Sbjct: 119 S---WRSLTKP-KIPLYKL-----INSDFQLITKL--KAPNPMEFQPVQLMESPLNVGDF 167

Query: 136 VLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIRE 195
           VLL+  P +L  CV +P+  M+P Y F TIDG + +A ++ +LLRIP       H LI+ 
Sbjct: 168 VLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQP 227

Query: 196 EKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFL 255
           E  +    IGTVK+   +T ILPI+ARQL TS  P +I+K AW  + I T+KL+LLHR L
Sbjct: 228 ESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSL 287

Query: 256 QRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHY 315
           Q   GPWQ+  F L  +   LDL K            L  K G+N           N H 
Sbjct: 288 QNYMGPWQIPFFTLVGLVQKLDLNK-----------ALDDKNGIN----YLTSLVNNYHT 332

Query: 316 IESV--DAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKD 373
           +  +  ++  +++T+WA+ QQQE+NLWG+   + A+L+P+SVT++PL S+HLYY  V++ 
Sbjct: 333 VNDIPINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEK 392

Query: 374 LKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSI 433
           L+ +++R + KF  LVN   +    +  P   Q+LKD+AAGNFHNNG +  ++SK+FR I
Sbjct: 393 LEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKI 452

Query: 434 DVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEKIYEMA------ 487
           + +K  DITRD+C +L+ +++  +                      ++K+Y++       
Sbjct: 453 ERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQ 512

Query: 488 --QPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLF 544
             +  T +D   R+DF  + V+CIDSE+AHEIDDG+S++  GR+  +TL+IHIADP S+F
Sbjct: 513 WKKSGTDDD---RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMF 569

Query: 545 TEDGGTKF---NDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSV 601
            E         + ++ N+A +R FTTYLPD V+PMLPQS C    LG    ++KT+SFSV
Sbjct: 570 PESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSV 629

Query: 602 NIKMHDG----GLRIDEESFKVRLGYATKFPKVTYDSVDRIL-QQNNDKTQEAKELRTLY 656
           ++K+        + I  +SFK+R G  + FPK TY+ VDRIL   N++ +   K+L +L 
Sbjct: 630 DVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLS 689

Query: 657 QISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMI 716
            IS LL+ +RI    A+IFGEGFN+GLV LN    G L ++ F DQ +T ST+LVSEMMI
Sbjct: 690 MISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMI 749

Query: 717 LANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLL 776
           LANTL GRYF  NKI GVFRCYK+L L   A++ Y+S+   T+    P ++DI KLSSLL
Sbjct: 750 LANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLL 809

Query: 777 NSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIW 836
           NSSFYTG P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL F++  ID +IW
Sbjct: 810 NSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIW 869

Query: 837 HLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAA 896
            +QSR  ++++A+R+S+++WTL +LK L    P+R   VMVTS+P+ GF  CV PDLS A
Sbjct: 870 PIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFA 929

Query: 897 RGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934
           RG LKL P       IGD++ NC I+K+DCL+ ++EL+
Sbjct: 930 RGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/933 (42%), Positives = 578/933 (61%), Gaps = 44/933 (4%)

Query: 19  GPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGT 78
           G V + +++    K   +R   LEP +E+KQLS+I+     RY ++Y+ PS+ W  +   
Sbjct: 62  GSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNT-- 119

Query: 79  KWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLL 138
            W  +          +S  +  + D  L+ K+ D     F+  P +L+++PL +GDLVLL
Sbjct: 120 -WRSLTK------PKISFHKLINSDVQLDTKLKDLDPMEFQ--PAQLMENPLNVGDLVLL 170

Query: 139 RSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKP 198
           +  P +L  CV +P+  M+P Y F  IDG + +A ++ +LLRIP       + LI+ E  
Sbjct: 171 KVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGH 230

Query: 199 YLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRS 258
           +    IGT+K+   +T ILPI+ RQL TS  P +I+K AW  + I T+KL+LLHR LQ  
Sbjct: 231 HKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNY 290

Query: 259 SGPWQVSIFKLCQMAVMLDLEK-FRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIE 317
            GPWQ+  F L  +   LDL K     +   Y+ +L                  N H  +
Sbjct: 291 MGPWQIPFFTLVGLVQKLDLNKALDGKYGIDYLTDLV----------------NNYHTAD 334

Query: 318 SV--DAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLK 375
           +V  ++  +++T+WA+ QQQE+NLWG+   + A+L+P+SVT++PL S+HLYY  V++ L+
Sbjct: 335 NVAINSPTFVSTYWAILQQQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLE 394

Query: 376 KDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDV 435
            ++++ +  F  LVN   +    +  P   Q+LKD+AAGNFHNNG + T++SK+FR I  
Sbjct: 395 ANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVR 454

Query: 436 FKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEKIY-----EMAQPS 490
           +K  DITRD+C +L+ ++   +                      ++K+Y     E  Q  
Sbjct: 455 YKDYDITRDVCQDLINEIVPNSLSNPLLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRE 514

Query: 491 TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLFTEDGG 549
              +   R+DF  + V+CIDS++AHEIDDG+S+E  G++  +TLHIHIADP S+F E   
Sbjct: 515 NSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTA 574

Query: 550 ---TKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMH 606
                 + ++ NIA++R FTTYLPD+V+PMLPQ+ C    LG +  ++KT+SFSV++K+ 
Sbjct: 575 IDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVG 634

Query: 607 DGG----LRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK-ELRTLYQISLL 661
             G    L I  +SF++R G+ + FPK TYD VD+IL   ++++   K +L +L  IS L
Sbjct: 635 YQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKL 694

Query: 662 LQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTL 721
           L+ +RI +  A+IFGEGFN+G+V LN    G L ++ F +Q +TPSTVLVSEMMILANTL
Sbjct: 695 LREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTL 754

Query: 722 AGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFY 781
            GRYF  N I GVFRCYK+L L   A++ Y+S+   T+    P + DI KLSSLLNSSFY
Sbjct: 755 TGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFY 814

Query: 782 TGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSR 841
           TG P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL F++  ID +IW +QSR
Sbjct: 815 TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSR 874

Query: 842 DLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILK 901
             ++++A+RDS+++WTL +LK L  S P R   VM+TS+P+ GF  CV P LS ARG LK
Sbjct: 875 ADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLK 934

Query: 902 LKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934
           L+P+      IGD++ +C I+K+DCL+ ++EL+
Sbjct: 935 LQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/941 (42%), Positives = 588/941 (62%), Gaps = 50/941 (5%)

Query: 12  KALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKE 71
           +A+   P P+ S +++     +   R   LEPGVE+K L+ I+     RY  +YL P   
Sbjct: 59  RAMLDPPTPL-SQEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNS 117

Query: 72  WCRDNGTKWGGM---KNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKS 128
           W + +     G    ++ +N D  +L  K +                   +  PKEL+  
Sbjct: 118 WFQRSEQNILGKSFSRSLINADPEALGIKNK----------------RFLKFDPKELMSR 161

Query: 129 PLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRS 188
           PL+IGDLVLL+    QLC C++VP+   +P Y F T+DG I ++ R+ +L+RIP  H  +
Sbjct: 162 PLQIGDLVLLKHQSPQLCMCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRIPH-HLPN 220

Query: 189 AHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKL 248
              L++E K   +  +G VK++  +TFILPI+ RQ  TS    +I+K+AW  M    +KL
Sbjct: 221 VPLLMKEMKHGFEP-VGCVKNTTTETFILPIVPRQQITSPISHQISKRAWEEMPFTLKKL 279

Query: 249 ELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSH-AESYIKELFQKLGLNGSPNSFQ 307
           ELLHR LQ + GPWQV    L  M   LD++   +S+   +Y+++L +         +F+
Sbjct: 280 ELLHRHLQDARGPWQVPFMNLVSMVEKLDMQLASASNTGAAYVEDLIRTC-------TFE 332

Query: 308 KQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYY 367
            Q+        +D+A +L+ + A+E QQ+++LWG   + +A+L+P+SVTV+PL S+HLY+
Sbjct: 333 PQA-------KLDSAIFLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTVMPLRSQHLYH 385

Query: 368 ETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVS 427
            +VL++LK  N+  ++KFA LV++G +  A  E P+  ++L+DYAAGNF+N+    +VVS
Sbjct: 386 RSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVKLLQDYAAGNFYNDATAISVVS 445

Query: 428 KLFRSIDVFKGRDITRDLCHELMEKL-SHRNTXXXXXXXXXXXXXXXXXXTALEEKIYEM 486
           K+FR I  F+  DITRD+CH+L+++L S + T                  ++ E+ IY +
Sbjct: 446 KIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYNLDLGLPSSSLRSSSEQDIYNL 505

Query: 487 AQPSTKE--DIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLF 544
           A P T E  D   R DF  M VYCIDSE+AHEIDDG+SIE       TLHIHIADP S F
Sbjct: 506 AHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLHIHIADPASFF 565

Query: 545 TE--DGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVN 602
            E  +G      E+  IA  + FTTYLPDL+ PMLP S+  A  LG    K+KT++FSV+
Sbjct: 566 RECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQKAKTITFSVD 625

Query: 603 IK-MHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDK-------TQEAKELRT 654
              + +G  ++  ESF+++LG  + FP+VTY++VD +L Q ++        T + + L+ 
Sbjct: 626 GSWIKNGQFQLQPESFRIKLGLVSNFPQVTYNTVDSMLAQASEVKNGSANLTDDQRNLKE 685

Query: 655 LYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEM 714
           LY IS  L++ RIN Q+A++FG  FN+G V L+  E+G L K+ F+DQ +TPS+VLVSEM
Sbjct: 686 LYAISQNLRANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLETPSSVLVSEM 745

Query: 715 MILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSS 774
           MILANTL+G++F+ N +PGVFRCY+ L L   A+  YE L++  +       +DI  +S+
Sbjct: 746 MILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSLTFKDICMIST 805

Query: 775 LLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEM 834
           +LNSSFY+    RH MIGAP YLTVTSPLRRFPD+INHLQI + L   PL F+K D+D  
Sbjct: 806 ILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPLCFNKDDVDRF 865

Query: 835 IWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLS 894
           +WH+QSRD +++ A+R S ++WTLK+LK L ++  ++K SVM+ S+P++GFVRCVLPD S
Sbjct: 866 VWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVGFVRCVLPDYS 925

Query: 895 AARGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935
           +AR  LKLKP   +   IGD++ NC ITK+D L+ ++E+++
Sbjct: 926 SARATLKLKPNEISHPVIGDIIENCRITKIDALEGLLEMEL 966

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/909 (40%), Positives = 558/909 (61%), Gaps = 46/909 (5%)

Query: 37  RAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSE 96
           R   LEPG+E+KQL +I     DR+  +Y  PSK W   N   W     +    L ++  
Sbjct: 63  RTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKN---WLNRTKFSRKMLNAVPR 119

Query: 97  KQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVM 156
           K+               T E F+     L+  PL +GDLVLL+S+P++L  C++VP+   
Sbjct: 120 KED--------------TKEVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDVPSSTK 165

Query: 157 NPSYAFATIDGQIKYAMRSMILLRIPSFH----RRSAHHLIREEKPYLDARIGTVKDSPE 212
           +P Y F T+DG +K+  RS++L+RIP        + A  L+RE K   +  IGT+K+   
Sbjct: 166 DPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEP-IGTIKNQAN 224

Query: 213 KTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQM 272
           +T +LP++ARQL TS    +I+K AW ++ +  +KLELLHR LQ S+GP  V  F L  M
Sbjct: 225 ETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFDLVMM 284

Query: 273 AVMLDLEKFRSSH-AESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWAL 331
              LD+ K  S+   E YI+++ +             ++G+     ++D++  LAT+WA+
Sbjct: 285 IQSLDITKAISNRDGEPYIRDVIE-----------NSRTGS---TSTIDSSCALATYWAI 330

Query: 332 EQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNS 391
           E QQ+N+L+G  Q   A+L+P+SV +LP AS+HL+Y  + + LK +    I +F+ L N 
Sbjct: 331 EAQQKNHLFGDIQISGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANK 390

Query: 392 GNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELME 451
           G +T   +  P   Q+LK YAAGN HN+  + ++++ +FR ID FK  DITRD C +L+ 
Sbjct: 391 GKYTELTTRFPHIIQVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLS 450

Query: 452 K-LSHRNTXXXXXXXXXXXXXXXXXXTALEEKIYEMAQPSTKEDIPARFDFSSMNVYCID 510
           + L                       +  ++++Y++++P++ +    R DF  + VYCID
Sbjct: 451 RTLPQGTVENPIYANFTLGLPDSSARSRTQQQVYDLSKPASAQSTENRHDFKHLRVYCID 510

Query: 511 SESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTK---FNDEVWNIAYRRGFTT 567
           SE AHEIDDGISIE  G   +TLHIHIADP SLF E   ++    NDEV  +A  R FTT
Sbjct: 511 SEEAHEIDDGISIEDCGNGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTT 570

Query: 568 YLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESFKVRLGYATKF 627
           YLPD+V PMLPQ+F     LG    K+KT++FSV++ + DG ++I  +S+K+RLG  + F
Sbjct: 571 YLPDVVSPMLPQTFTTVCDLGHQGKKTKTITFSVDVLVKDGAIKIFFDSYKIRLGLVSNF 630

Query: 628 PKVTYDSVDRILQQNNDKTQEA-KELRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKL 686
           PKVTY++VDR L +  +  +E   +L+ +++I+ +L+  RI +  AI+FG GFN+GLV +
Sbjct: 631 PKVTYETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAV 690

Query: 687 NEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSG 746
           +  +     +I F DQ ++ ST+LVSE MILAN+LAGR+F   +IPG+FR Y+ L L+  
Sbjct: 691 SPVDQ----EISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQ 746

Query: 747 ARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRF 806
           A + YE ++   +   LP  +DI  LSSLLNSSFY   P  H+MIGA  YLTVTSPLRRF
Sbjct: 747 ADQEYERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRF 806

Query: 807 PDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQD 866
           PD+INHLQI + L   PL F++  + +M+WH+Q RD  ++KA+   AS+WTLK++K+L  
Sbjct: 807 PDIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIR 866

Query: 867 SSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVITKLDC 926
            +P ++  V +TS+P++   RCVL +  +ARG+LKLKP  +    +GD +  C ++K+DC
Sbjct: 867 DTPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDC 926

Query: 927 LDAVMELKM 935
           LD+++EL++
Sbjct: 927 LDSLLELEL 935

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/905 (40%), Positives = 552/905 (60%), Gaps = 42/905 (4%)

Query: 37  RAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSE 96
           R   LEPG+EIK+L +I+   N R+ E+Y  PSK+W +DN         ++     + + 
Sbjct: 62  RTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDN---------WVVEPSTNTAG 112

Query: 97  KQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVM 156
           K  +    + + K Y     TF+L   E + S L++GDLVL    P +L  CV +P    
Sbjct: 113 KSSSQNSMTGKNKHY-----TFKL--SEFISSVLQMGDLVLTTPYPNELAMCVGLPESAE 165

Query: 157 NPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFI 216
           +P Y F T+ G++ +  +S + LRIP        +LI +E P+    +GT+K + + T+I
Sbjct: 166 DPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYI 225

Query: 217 LPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVML 276
           LP LARQL TS  P +I K AW ++  + ++LELL R+L++ +G WQV   +L      L
Sbjct: 226 LPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRL 285

Query: 277 DLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQE 336
           + EK      E YIK LF++  L                  S+ AA YLAT+WA+++QQ 
Sbjct: 286 E-EKGGPGEFE-YIKSLFERPSLGSR--------------RSIHAATYLATYWAIKEQQN 329

Query: 337 NNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTG 396
            N+WG+   ++A LAP+S +V+P AS   +++ ++ D K+ +   + K   L+N+ ++  
Sbjct: 330 FNIWGKIHVNKAFLAPISTSVVPAASLRSFHDELINDPKRKH---VNKITDLINTKDYEL 386

Query: 397 ADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHR 456
                P+F Q+L D+ AGNF NN  + T++S++FR +DV++  ++TRD C +L++++S  
Sbjct: 387 VRERYPEFLQLLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISED 446

Query: 457 N-TXXXXXXXXXXXXXXXXXXTALEEKIYEMAQPSTKEDIPA-RFDFSSMNVYCIDSESA 514
           N                    +AL++ +Y + QP  + D    R DF  M VYCIDSE+A
Sbjct: 447 NFCENPILSNSDLALAQSSERSALQKCVYSVVQPDIQLDTKTKRHDFLDMPVYCIDSETA 506

Query: 515 HEIDDGISIEPLGRNAFTLHIHIADPVSLFTED--GGTKFNDEVWNIAYRRGFTTYLPDL 572
           HEIDDG+SIE  G+ ++TLH+HIADP S F E     TK +D V  IA+ + FTTYLPD+
Sbjct: 507 HEIDDGVSIEKNGKGSYTLHVHIADPASFFPESYTESTKLSD-VLKIAFDKSFTTYLPDV 565

Query: 573 VLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHD-GGLRIDEESFKVRLGYATKFPKVT 631
           V  MLP+SFC A  LG  + K++T++FSV +KM + GGL I  ++F+ RLG  + FPKVT
Sbjct: 566 VEAMLPESFCRAADLGKQDKKTRTITFSVRVKMDEHGGLHIQSDTFRARLGLVSNFPKVT 625

Query: 632 YDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGES 691
           Y+ VD +L  ++  +   ++L TLY+I+  L+  R+    A++FGEGFN G V+L    +
Sbjct: 626 YNIVDSVLNDSSSNSPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSA 685

Query: 692 GRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESY 751
            ++  I FE+ ++TPSTVLVSE+MILANTL+G +F+ NKIPG+FRCY EL L   A   Y
Sbjct: 686 NKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDY 745

Query: 752 ESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLIN 811
            S++   Q    P ++DIAK++SL+NSSFY+G P  H MIGA  YLTVTSPLRR+PDLIN
Sbjct: 746 RSIQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLIN 805

Query: 812 HLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDR 871
           H+Q+ +HL   PL FS+  ID+MIW +QSR  +++  +   +++WTL +LK   +     
Sbjct: 806 HIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSA 865

Query: 872 KISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVM 931
           +  VMVTS P+ G V C+ P+ S ARG LKLK +      IGD++ +C IT +DCLD+ +
Sbjct: 866 RFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVD-RLPPQIGDIVKDCQITSIDCLDSNL 924

Query: 932 ELKMV 936
           +L MV
Sbjct: 925 QLVMV 929

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/960 (38%), Positives = 558/960 (58%), Gaps = 66/960 (6%)

Query: 1   MRMYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDR 60
           +R+ R +   C+ L   P        + +S K    R   LEP  EI+QL +I SG N R
Sbjct: 3   VRVQRRWFHCCRRLDNAP--------LENSVKNYLARTKGLEPDFEIRQLPQIISGFNKR 54

Query: 61  YYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDK------- 113
           Y  +YL PS+ W + +   W              S+  +      L P+V+DK       
Sbjct: 55  YRARYLEPSQRWFKAD---WKA------------SDHGEDKATRLLRPEVFDKFIINSDF 99

Query: 114 ---------TSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFAT 164
                     ++     P ELL++ L +GD+VLL+   ++L  CV +P    +P Y FA 
Sbjct: 100 HRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAK 159

Query: 165 IDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQL 224
            DG + YAM++ ++LRIP       + L++ E  +   +IGT+K+S  +T ILP+L RQL
Sbjct: 160 KDGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQL 219

Query: 225 YTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDL-EKFRS 283
             S+     TK AW+++ I+ +KLEL+HR+LQ S G   V+   L ++   L++ E   +
Sbjct: 220 IVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIKEATDA 279

Query: 284 SHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQF 343
            + ++Y++++     ++ S +   K         S+D    LAT+W + +QQ+NNLWG  
Sbjct: 280 INGDAYVRKV-----IDESMSVVNK---------SIDPTTLLATYWGVREQQQNNLWGSV 325

Query: 344 QTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQ 403
            T+ A+L+P +V VLPL   HL+Y+ V+  L+ ++++ I  FA LVN  ++         
Sbjct: 326 YTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDY 385

Query: 404 FKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELMEKLS-HRNTXXXX 462
            + +L DYAAGN   N  + T++SK+FR ID+++ +D+TR LC +L+ ++S   N+    
Sbjct: 386 IRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFI 445

Query: 463 XXXXXXXXXXXXXXTALEEKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGIS 522
                         +++E+K+Y+ A P+   D   R+DF  M V+CIDSE AHEIDDGIS
Sbjct: 446 LGNWDLNIPKSSGISSVEQKLYDTAMPTIVSDT-DRYDFGDMPVFCIDSEDAHEIDDGIS 504

Query: 523 IEPLGRNAFTLHIHIADPVSLFTED---GGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQ 579
           IE L      +HIHIADP  LF E      +  +D+V  ++ +R FTTYLPDLV+PMLP+
Sbjct: 505 IEELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPK 564

Query: 580 SFCLAGSLGINNGKSKTVSFSVN-IKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRI 638
           SFC    LG ++ K++T+SFS   +   DGGL +D ++F+VRLG  + FPKVTYD VD I
Sbjct: 565 SFCNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSI 624

Query: 639 LQQNNDK--TQEAKELRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDK 696
           L  +++   +++ K+L  L+ ++  L  KRI++  A++FG+GFN+GLV L+  + G L  
Sbjct: 625 LNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCI 684

Query: 697 IGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRA 756
             F DQSQT ST+LVSE MIL N L   +FQ NKIPGV+RCY  L L + A+  +E L+ 
Sbjct: 685 PTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKE 744

Query: 757 MTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIR 816
             +   LP+++DI K+SS L+SSFY+  P  H MIG  AYLTVTSP+RR PDLINHLQ+ 
Sbjct: 745 NIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLH 804

Query: 817 QHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVM 876
           + L + PL F +  +D+ +W  Q+R  +++   R S+++WTLKHL+     + D    V+
Sbjct: 805 RFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHLEQSGTKTHD----VI 860

Query: 877 VTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKMV 936
           VTS+P+ G V C+ P+ S ARG LKL P +     IGD + +C +  +  LD ++ L  V
Sbjct: 861 VTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTLTHV 920

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/940 (39%), Positives = 533/940 (56%), Gaps = 55/940 (5%)

Query: 16  RGPGPVRSVQNVPDSAKII----YKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKE 71
           + P    S +  PD  K I     KR   LEP +++K L +I      R+  +Y+ PSK 
Sbjct: 32  KQPPDTESKRLSPDDIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKF 91

Query: 72  WCR----DNGTKWGGMKNYLNMDLM-SLSEKQQADMDASLEPKVYDKTSETFRLVPKELL 126
           W      +N TK    K +LN  L  S+S+KQ  + D +                  +L 
Sbjct: 92  WYETLWLNNDTKPPFNKLFLNNPLPDSISKKQLLNFDYN------------------DLA 133

Query: 127 KSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHR 186
           K+PLKI DL +LR+ P++L  CV++P  V +P Y FA+  G++ +  RSMI +RIP    
Sbjct: 134 KTPLKIRDLAILRATPSELSMCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIPYQVP 193

Query: 187 RSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQ 246
           +    LI +E  +  + IGT+K + + TFILP LAR L +      I K A  +  I+ +
Sbjct: 194 KGIQGLILKELQHEFSPIGTLKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRPIVMK 253

Query: 247 KLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHA-ESYIKELFQKLGLNGSPNS 305
           KLELLHR+LQ   GP  +    L  +   LDL +     A   YI  L ++   N  P+ 
Sbjct: 254 KLELLHRYLQNDKGPTSIPFTHLINLVNKLDLSQALHLQAGNDYIINLIKEA--NDPPSI 311

Query: 306 FQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHL 365
                        ++A+  +A +W+L +  E  LW     + A L P +VTVLPL S  +
Sbjct: 312 -------------MNASLTIAVYWSLVELSETFLWDGINRNSASLFPTTVTVLPLLSYRV 358

Query: 366 YYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATV 425
           +Y  +++DL+++N++ + KF+ LVN  N+   +    +   +L++Y AGN  NN  + T+
Sbjct: 359 HYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINLLQEYTAGNLQNNPKITTL 418

Query: 426 VSKLFRSIDVFKGRDITRDLCHELMEKL-SHRNTXXXXXXXXXXXXXXXXXXTALEEKIY 484
           +SKLFR I  ++  DITRDLC+EL+ K  S +                       ++ +Y
Sbjct: 419 ISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNSNPLLKNHDLATRADSQHGQRQQILY 478

Query: 485 EMAQPS---TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPV 541
           +  +P+    +E +  RFDF  + VYCIDSE+AHEIDDGISIE      FTLHIHIADP 
Sbjct: 479 DYVKPNDLLIQESLRDRFDFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIHIADPA 538

Query: 542 SLF----TEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTV 597
             F     E G     D+V  IAY   FTTYLPD V+PMLP+S+C    LGIN  K+ ++
Sbjct: 539 IFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGKKTPSI 598

Query: 598 SFSVNIKMHD--GGLRIDEESFKVRLGYATKFPKVTYDSVDRIL--QQNNDKTQEAKELR 653
           SFSV++ ++     L+I  ++F++RLG  + FPK TYD+VD IL  + N+++     +LR
Sbjct: 599 SFSVDVILNKEKSNLKICYDTFQIRLGLVSNFPKATYDNVDDILSSEVNSEQKLLQDDLR 658

Query: 654 TLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSE 713
            L  I+ +L++KR  E  AI FGEGFNRG  K +E      D I F DQ  T S  LV+E
Sbjct: 659 QLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKSNELVTE 718

Query: 714 MMILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLS 773
           +MILANTL GRYF+ NKI GV+RCY +L L+  A+  Y  LR   ++  LP +EDI K+ 
Sbjct: 719 LMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQYNKLREECKNGKLPTLEDIVKVQ 778

Query: 774 SLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDE 833
           SLLNSS+Y+  P RH MIG+  YLTVTSPLRRF DL++H+Q+  HL  +PLPF++  I  
Sbjct: 779 SLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFNQKAIRN 838

Query: 834 MIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDL 893
            + H+QSR   +RK + +S    TL +LK+L  + PD    V +TS+P  G  RC++P+ 
Sbjct: 839 FVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRARCLIPEY 898

Query: 894 SAARGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMEL 933
           S ARG ++L P +     +GD +++C + K+ C+D ++E 
Sbjct: 899 SFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGILEF 938

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/912 (37%), Positives = 530/912 (58%), Gaps = 41/912 (4%)

Query: 32  KIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEW----CRDNGTKWGGMKNYL 87
           K+   R   LEP +EIK+L++I+   N+RY ++ + PSK W     +D  TK  GM    
Sbjct: 52  KLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGM---- 107

Query: 88  NMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCT 147
                   E+   ++    +P  ++K +E      +ELL+SPLK+GD+VLL+SN T+L  
Sbjct: 108 --------ERFSKNLINGAKPN-FNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSM 158

Query: 148 CVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPYLDARIGTV 207
           CV +P    +P Y FATI G + ++ RS I LRIP        +LI  E P+    IG +
Sbjct: 159 CVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVI 218

Query: 208 KDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIF 267
           K S  +TFILP + RQ  TS  PF ++  AW  + +  +KLE+LHRFLQ   G +Q+  F
Sbjct: 219 KSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFF 278

Query: 268 KLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLAT 327
           +L  +   +D+    S +   Y+K L          NS      NL      DA+  L+T
Sbjct: 279 QLVHLVDTIDMS---SCNDRKYMKTLID--------NSKNDSYNNL------DASRCLST 321

Query: 328 FWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAG 387
           +WA+ +QQE N+WG  Q +   ++P+SVTV PL +   + + ++   K+ +   I +   
Sbjct: 322 YWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTR 381

Query: 388 LVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCH 447
           L+N  N+T    + P+F  +LKDYA+GN + N  +A ++S   R ++ +K  D+++ +C+
Sbjct: 382 LMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCY 441

Query: 448 ELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEK-IYEMAQPSTKEDIPARFDFSSMNV 506
           +L++++                            K +Y +  P    D   R DF ++ V
Sbjct: 442 KLLQEIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALCGPQISAD-ADRVDFGNLRV 500

Query: 507 YCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTK--FNDEVWNIAYRRG 564
           YCIDSE+AHEIDDGISI   G   ++L IHIADP  LF+     +   ND+V+ +A  + 
Sbjct: 501 YCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKS 560

Query: 565 FTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIK-MHDGGLRIDEESFKVRLGY 623
           FTTYLPD+V P+LP ++  A  LG N   +  ++F+VN+K + D  L +  ++F ++L  
Sbjct: 561 FTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSK 620

Query: 624 ATKFPKVTYDSVDRILQQNNDKTQEAKE-LRTLYQISLLLQSKRINEQRAIIFGEGFNRG 682
              FPKVTY  V++ILQ ++      K+ L  L++I+  L++ R+    A++FGEGFN+G
Sbjct: 621 IRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKG 680

Query: 683 LVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELL 742
           +++  E     +  + F DQ +TP+T+LVSE+MIL NTL G +F+ N IPG++R Y +LL
Sbjct: 681 MIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLL 740

Query: 743 LKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSP 802
           L S A   Y SL++ T+S   P+++D+ ++SSL+NSS YT  P  H MIGA  YLTVTSP
Sbjct: 741 LGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSP 800

Query: 803 LRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLK 862
           LRRFPDL+NH QI + L + P  F+   +  +IWH+QSR  +++K +R   ++WTL++L+
Sbjct: 801 LRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQ 860

Query: 863 SLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVIT 922
                +P+++  VM+TS+P  G V C+ PD+S ARG LKLK  +   V IGD + NC I 
Sbjct: 861 KAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPV-IGDTVTNCRIV 919

Query: 923 KLDCLDAVMELK 934
           KL+ LD ++ L+
Sbjct: 920 KLESLDGILYLE 931

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/818 (40%), Positives = 497/818 (60%), Gaps = 9/818 (1%)

Query: 122 PKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRI 181
           P +L  + L+IGDL +L + P +L  CVE PTD  +  YAFA  DG + YA +S + LR+
Sbjct: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRLRV 62

Query: 182 PSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRM 241
           P  H+R   +L+  E  +  A +GTVK++  +T++LP+  R+L+ +    +I++QA +++
Sbjct: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122

Query: 242 AILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNG 301
             +  KLELLHR LQ   GPWQ+S+FKL  +   L+L       +E   K L +     G
Sbjct: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182

Query: 302 SPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLA 361
           S  S    +  +   + VD A YLAT+W + QQQ + +WG    H+A+ +PLSVTVLPL 
Sbjct: 183 SYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLR 242

Query: 362 SRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGA 421
            + L+Y+ +L+D+K+D++  + +FA LVN G +  A S      Q+L+DY AGN ++N A
Sbjct: 243 DQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAA 302

Query: 422 MATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEE 481
           +  +V++LFR +D +K  ++TR +  +L+ +L                       TALE+
Sbjct: 303 LIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTALEQ 362

Query: 482 KIYEMAQPSTKEDIPA-RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540
           K+Y++A P   ++ P  R +FS +  YCIDS  AHEIDDG+SIE L  + + LH+HIA P
Sbjct: 363 KVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYP 421

Query: 541 VSLFTED--GGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVS 598
            SLF +    G    D V +IA+RR FTTYLPDLV PM+P+S+  A  LG  +  +KT++
Sbjct: 422 YSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481

Query: 599 FSVNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQI 658
            SV++ +      +DE + ++ LG      +VTYD VD +L+    +  EA +LR LY++
Sbjct: 482 ISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKR-QDAEASDLRLLYKV 540

Query: 659 SLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILA 718
           +  L+ +R   + AI+FG+  N GL+ L   E G+L  +   D   T S  LVSE+MI+A
Sbjct: 541 AESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMA 599

Query: 719 NTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESL-RAMTQSTSLPAVEDIAKLSSLLN 777
           N+LAGRYF  N IPGV+R   ELLLK  A   Y SL RAM Q  S+ +  D+ K+++ L 
Sbjct: 600 NSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSS-SDLVKVAAFLT 658

Query: 778 SSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWH 837
           +S Y+ TP RH+M+G   YLT+TSPLRR PD+INH+Q+ +HL   P  FS+  ID + WH
Sbjct: 659 NSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWH 718

Query: 838 LQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAAR 897
           + +RD+ ++ A++ S+ FWTL +LK    + PD++  ++VTS+P  GFV C +P +  + 
Sbjct: 719 ILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSS 778

Query: 898 GILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935
           G LK+ P  + + A+G  + NC IT+LD LD  +  +M
Sbjct: 779 GKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/925 (37%), Positives = 533/925 (57%), Gaps = 55/925 (5%)

Query: 36  KRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLS 95
           KR   LEP + +K  ++I   L+ R+  +YL PSK W   N  K       LN   ++LS
Sbjct: 63  KRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESNWEK-------LNEKRLTLS 115

Query: 96  EKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDV 155
            ++  + D + E K     +  F +   E +  PLKIGD+VLL++N ++   C+++P  +
Sbjct: 116 IRELINKDPA-EFKFNYYKNLKFNI---EDVTEPLKIGDIVLLKTNTSEFSMCIDLPQSL 171

Query: 156 MNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTF 215
            +P Y F +  G + + MRSMILL+IP     +   LI +E  +    IGT+K S ++T 
Sbjct: 172 KDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPIGTIKSSLDETV 231

Query: 216 ILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVM 275
           ++P++ARQL  ++ P +I+K A  ++ ++ +KLELLHR+LQ  SGP Q+   KL  +   
Sbjct: 232 LVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQIHFHKLINIIEA 291

Query: 276 LDLEKFRS-SHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQ 334
           L+L++         Y+ EL ++       N +   S     + S+DA   L+T+WA+ +Q
Sbjct: 292 LNLDRATDYEKGNEYVNELLKQ----KYYNDYTDLS-----LSSLDATVALSTYWAIIEQ 342

Query: 335 QENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSGNF 394
           Q+  LWG+ + + + L P +VT+LP  S H+YY  ++K L+K+N R   +F+  +N  N 
Sbjct: 343 QDLFLWGEIKRNSSSLFPTTVTILPF-SHHVYYTKLIKSLRKNNFRRTNEFSAFINEHNL 401

Query: 395 TGADSEV----PQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELM 450
             +  E+    P+F  +LK+Y AGN  +N  + T++SK+FR+++ FK RDIT+DL +EL+
Sbjct: 402 NTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLAYELL 461

Query: 451 EKLSHRNTXXXXXXXXXXXXXXXXXXTALEE--KIYEMAQPS---TKEDIPARFDFSSMN 505
            KL   +                      E   K+YE+A P+   + E    R +F+ +N
Sbjct: 462 TKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIESGETTTKRHNFNDLN 521

Query: 506 VYCIDSESAHEIDDGISIEPLGR----NAFTL----HIHIADPVSLFTEDGGTKFNDEVW 557
           VYCIDSE+AHEIDDGISI+   +     +F L     I + D      ++  T  +D++ 
Sbjct: 522 VYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISMKDS----NKEKKTGIDDDIL 577

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG-----LRI 612
            IAY R FTTYLPD V+PMLP  +C    LG +N   +T++FSV+I + DG      L+I
Sbjct: 578 KIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITIFDGSNNEETLKI 637

Query: 613 DEESFKVRLGYATKFPKVTYDSVDRILQQNND--KTQEAKELRTLYQISLLLQSKRINEQ 670
             ++FK++ G  + FPKVTYD+VD+IL  +     T   ++LR L +I+ LL+  RINE 
Sbjct: 638 LYDTFKIQFGLVSNFPKVTYDTVDKILDNSTKIPDTSITEDLRQLSRIAKLLRKYRINEN 697

Query: 671 RAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNK 730
            AI+FGEGFNRG+  L   E    D+I F DQ  + S  LVSEMMILANTL G+Y + +K
Sbjct: 698 NAIVFGEGFNRGIPDLQSTE----DEIIFTDQKNSDSNELVSEMMILANTLTGKYCKDHK 753

Query: 731 IPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSM 790
           IP ++RCY  L +   A++    LR+      LP+  D+AK+SS LNSS+Y+GTP RHSM
Sbjct: 754 IPVIYRCYSPLDIGPEAQQECIILRS-KNIDRLPSNIDMAKMSSFLNSSYYSGTPSRHSM 812

Query: 791 IGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAAR 850
           +G+  Y TVTSPLRRFPDL+NH+Q+  HL    LPF+   +   +  +QSR   ++    
Sbjct: 813 LGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLKNIGN 872

Query: 851 DSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADV 910
              +  TL ++K L +  P +   V+VTS+P  G  RC +     ARG +KLK E++   
Sbjct: 873 AVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEINPVP 932

Query: 911 AIGDLMHNCVITKLDCLDAVMELKM 935
            IGD++  C +TK+  ++  +EL M
Sbjct: 933 IIGDIITKCKVTKIFPIEGALELSM 957

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/984 (36%), Positives = 534/984 (54%), Gaps = 103/984 (10%)

Query: 37   RAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSE 96
            R  +L+P + IK+L EI +    R+ ++++IPS +W   N  +W      +         
Sbjct: 65   RIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWF--NSIEWDSRT--ITPKFSKYML 120

Query: 97   KQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVM 156
                  DA  +  + +  + TF     EL   PL IGDL+LL  + + L  CV++P +  
Sbjct: 121  NSTFSFDAWYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PDSSNLLMCVDIPHNTK 177

Query: 157  NPSYAFATIDGQIKYAMRSMILLRIPSF--HRRSAHHLIREEKPYLDARIGTVKDSPEKT 214
            +P Y FA+ DG++ +  RS I LRIP+   +      L+  E  + +  IGT+K++    
Sbjct: 178  DPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIK 237

Query: 215  FILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAV 274
             +LPI+ARQL        + K A  +++I+ +KLEL+HR +Q  +GP+Q+S FKL ++  
Sbjct: 238  ILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQISFFKLIKLID 297

Query: 275  MLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQ 334
            +L+L  F +S            + LN S      +  +L+    +DA+ +LAT+WA+  Q
Sbjct: 298  ILNLNDFDNSKKFD--------INLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRLQ 349

Query: 335  QENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLK---DLKKDNHRLITKFAG---- 387
            Q++ LWG+ Q ++A+L+P+SVTVLPL   H YY   L+   +  K+   L+  F      
Sbjct: 350  QQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDINN 409

Query: 388  -------------------------LVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGA- 421
                                     L +S N +      P+F  I ++Y AGNF +N   
Sbjct: 410  QSTTNTTNNNNNTTIITTTTTNNNKLDSSKNIS---QNYPEFINIFQNYCAGNFDDNSKI 466

Query: 422  ---MATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTA 478
               ++ ++ +L +  D    +D  ++L      K + + T                    
Sbjct: 467  IALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGT 526

Query: 479  ----------------LEEKIYEMAQPS----TKEDI-------PARF--------DFSS 503
                            L     E+A P+    TK+         P +         DF+ 
Sbjct: 527  SKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFND 586

Query: 504  MNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVWNIAYRR 563
            + VYCIDSE+AHEIDDGISIE L  N FTLHIHIADP S+F           + N+A  +
Sbjct: 587  LKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSK 646

Query: 564  GFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKM--HDGGLRIDEESFKVRL 621
             FTTYLPDLV PMLP+SFC    LG +N K+ T+SFSVN+++  ++  ++I   +FKVRL
Sbjct: 647  SFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRL 706

Query: 622  GYATKFP-KVTYDSVDRILQQNNDKTQEA-------KELRTLYQISLLLQSKRINEQRAI 673
            G  +KFP   TYD+VDRIL  + ++  ++        +LR L QIS LL+  RI    A+
Sbjct: 707  GIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAV 766

Query: 674  IFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPG 733
            IFGEGFN+GLV L+  + G    I F+DQ+ T S  LV+EMMILAN+LA R F+ NKIPG
Sbjct: 767  IFGEGFNKGLVTLSCSKDGG-PVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPG 825

Query: 734  VFRCYKELLLKSGARESYESLRAMTQSTS-LPAVEDIAKLSSLLNSSFYTGTPDRHSMIG 792
            +FRCY EL L   A+  ++ LR   +  S LP +++I+K  SLLNSSFYT  P  H MIG
Sbjct: 826  IFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIG 885

Query: 793  APAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDS 852
            A  YLTVTSPLRRFPDL+NH+QI+  + + P  +S  DI +M+  +QSRD++IR+ +   
Sbjct: 886  AANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKC 945

Query: 853  ASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAI 912
              ++ L +LK     +P +   V++TS+  +GF+ C+LP+ S++ GILKLKP++    +I
Sbjct: 946  NKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSI 1005

Query: 913  GDLMHNCVITKLDCLDAVMELKMV 936
            GD++ NC I K+D LD  ++  MV
Sbjct: 1006 GDVIRNCKIDKIDALDGRLDFSMV 1029

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/837 (37%), Positives = 493/837 (58%), Gaps = 46/837 (5%)

Query: 113 KTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYA 172
           K + TF +     L      GD+VLL  + + L  C+E+P    +P Y+FA  +G I +A
Sbjct: 107 KNNHTFNI---NQLNKKFNRGDIVLLSQDLSNLYMCIELPQSTADPRYSFANSNGDIIFA 163

Query: 173 MRSMILLRIPSFHRRSAHHLIREE--KPYLDARIGTVKDSPEKTFILPILARQLYTSYAP 230
            RS +LLRIP   +   + L+ ++  +P     +GTVK+S +  ++LP+L RQL  S + 
Sbjct: 164 NRSSVLLRIP--LQLPTNLLLSDDFLQPEPTQGVGTVKNSIDNPYVLPVLLRQLVISPSL 221

Query: 231 FKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYI 290
             I+  A + + I+ +KL+LLHR LQ       + + +L  +   LDL K  S+  ESYI
Sbjct: 222 STISSNANNLLPIVLKKLQLLHRNLQAFKI---IPLVQLSSLVQNLDLTKATSNDGESYI 278

Query: 291 KELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAML 350
                        ++F   S   + IES+++++ +ATFWA+ QQQ+++LWG     +A+L
Sbjct: 279 -------------SNFIANSNENYSIESINSSNLIATFWAIRQQQQDHLWGDIHYSKALL 325

Query: 351 APLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFA--GLVNSGNFTGADSEVPQFKQIL 408
            PL+V++LPL S ++YY+ +L  ++ D+   I +F   G+ N+ N      E PQ   +L
Sbjct: 326 FPLAVSILPLQSNYMYYKEILPAIELDHS--IERFTKNGIPNTPN------EFPQLLNLL 377

Query: 409 KDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELMEKL--SHRNTXXXXXXXX 466
           K YA+G    +  + T++SK+FR++D +K  D++RDLC +L  +L    +          
Sbjct: 378 KQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPKEQKIQNSLLYNT 437

Query: 467 XXXXXXXXXXTALEEKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPL 526
                     T  +EK+Y+M  P    +   R DF  + V+CID ++AHEIDDG+SIE  
Sbjct: 438 DLALPLASNRTEEQEKVYQMYNPIQTSNNSNRHDFGDLRVFCIDEKTAHEIDDGVSIEYK 497

Query: 527 GRNAFTLHIHIADPVSLF--TEDGGTKF-NDEVWNIAYRRGFTTYLPDLVLPMLPQSFCL 583
             N +TLH+HIADP S F    D      NDE+  IA +R FTTYLPD VLPMLP+  C 
Sbjct: 498 QNNVYTLHVHIADPSSYFKICNDHNVNIENDEILKIALQRSFTTYLPDQVLPMLPKLLCR 557

Query: 584 AGSLGINNGKSKTVSFSVNIKMH--DGGLRIDEESFKVRLGYATKFPK-VTYDSVDRILQ 640
           A  LG    K+KT++FSV++K++  D  +++ + +F+VRLGY + F K +TY  VD IL 
Sbjct: 558 AADLGKTGEKTKTITFSVDVKLNKKDMTVKVLDNTFQVRLGYVSNFVKDMTYSDVDSILN 617

Query: 641 QNNDKTQEAK---ELRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGE-SGRLDK 696
            + +  ++ K   +L++++ I+  L + RI    A+IF +  N G ++L + E +G + +
Sbjct: 618 DSKESGRDKKVEKDLKSMFLIAKGLNNSRI-MNNAVIFSDEINNGKIELTKDEITGEVTQ 676

Query: 697 IGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRA 756
           I F+    T S +LVSE+MILAN+LAG++F  N IP ++R Y +LLL   A+  Y ++ +
Sbjct: 677 INFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIYRSYSDLLLGKDAQSEYNAMLS 736

Query: 757 MTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIR 816
             +    P ++DI K+SSL N+S +T  P  HSMI    Y TVTSPLRRFPD+INHLQI 
Sbjct: 737 NLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKYYATVTSPLRRFPDMINHLQIH 796

Query: 817 QHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVM 876
           + L++ PL F++ D++ M W++Q++D+++R ++R   ++WTL+H+K      PD+K  VM
Sbjct: 797 RILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTYWTLRHIKDQLSEDPDKKFDVM 856

Query: 877 VTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMEL 933
           +TS+ + G   C+L   S A+G L   P   +   IGD + NC ITK+DCL  V+E 
Sbjct: 857 ITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGDTVSNCKITKIDCLGNVLEF 913

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/936 (33%), Positives = 513/936 (54%), Gaps = 43/936 (4%)

Query: 29  DSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLN 88
           D   I + +   + P VEIK     ++    R+ ++++ PS +W R  G   G      N
Sbjct: 50  DEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGE-----N 104

Query: 89  MDLMSLSEKQQADMDAS--LEPKV-----------------YDKTSETFRLVPKELLKSP 129
            D        + D+ +S   E  +                 YD     F   P  ++ S 
Sbjct: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164

Query: 130 LKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSA 189
           L  GD+ +L+++P +L  CV+ P++ M+  + FA  DG + YA ++ + LR P+    + 
Sbjct: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224

Query: 190 HHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLE 249
             +++ EK +  + +G+VK+  + TF++P L R++  S   F+I   A  ++ I+ +KLE
Sbjct: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284

Query: 250 LLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGS-----PN 304
           L+HR+LQ  S PWQ+ I KL ++   L+L    S++ E  I   F K GL+        N
Sbjct: 285 LIHRYLQSGSSPWQIPILKLVEICSNLEL----SNNIEKSIATAFMKSGLSSDALYSLAN 340

Query: 305 SFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRH 364
           S  + S  +     V+ +  LA +WAL  QQ   +WG+   H+ +  P +VTVLPL  +H
Sbjct: 341 SHFELSSKVP--NKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQH 398

Query: 365 LYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMAT 424
           L+Y  ++  L++     I + A L+N  +    +   P    +L+DYAAGN  +N  + +
Sbjct: 399 LHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITS 458

Query: 425 VVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTXXXXXXXXXXXXXXXXXXTALEEKIY 484
           ++S LFR +D +K  +I+RD+C +L+++++                        LE+KIY
Sbjct: 459 LISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIY 518

Query: 485 EMAQPSTKE-DIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSL 543
           ++A P   E     R ++  +  YCIDS  AHEIDD +SI+ LG   + ++IH+ADP SL
Sbjct: 519 DLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASL 578

Query: 544 FTE--DGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSV 601
           F E  + GT  N  V +IAY+R FTTYLPD V PMLP ++  +  LG     +K V+FSV
Sbjct: 579 FPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSV 638

Query: 602 NIKMHDG-GLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK--ELRTLYQI 658
           +       GL + ++S KV L    K  ++TY++VD +L +   K +  K  +L+TL+ I
Sbjct: 639 DCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYI 698

Query: 659 SLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILA 718
           +  L+ +RI +  A++F E  + G+V L+  ++  L ++ F+DQ +T ST+LVSE+MILA
Sbjct: 699 AKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILA 757

Query: 719 NTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNS 778
           N+L   YF+ N+IPG++R Y+ L +   A    E ++A TQ   + +  DIAK+ S L S
Sbjct: 758 NSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTS 817

Query: 779 SFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHL 838
           SFY+  P  H M+G   YLT+TSPLRRFPDL+NHLQ+ + L   PL + +  +D M+WH+
Sbjct: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHI 877

Query: 839 QSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARG 898
            +RD+ ++ A+ D+  +WTL+ LK   +        + +TS+   G+  CV+ D + A G
Sbjct: 878 LTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVG 937

Query: 899 ILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934
            LK+    +  + +GD + +C I+ + CLD +++ +
Sbjct: 938 QLKINLNKNPPL-VGDQISDCEISNIQCLDGILQFE 972

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  546 bits (1408), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 337/920 (36%), Positives = 511/920 (55%), Gaps = 55/920 (5%)

Query: 36  KRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYL-NMDLMSL 94
           +R   LE   EIK++ EIQ+     +  +Y++PSK W  D  T  G   N L N  L+S 
Sbjct: 46  ERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWF-DTVTSSGSFSNDLINETLISK 104

Query: 95  SEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTD 154
             K+  D+          K +  +     +L    L IGDLVLLR++  +L  CV++P  
Sbjct: 105 KWKKFPDLPI--------KMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMS 156

Query: 155 VMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSA--HHLIREEKPYLDARIGTVKDSPE 212
           + +P + FA  DG + ++ +  + LRI +   ++   H LI+ +  Y    I   +++  
Sbjct: 157 IEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNK--YEAGLINRKENNAI 214

Query: 213 KTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQM 272
           K   LP++ARQ+ TS  P +I++ A   + +  +KLE+LHR++        +S  KL  +
Sbjct: 215 KLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLVHL 274

Query: 273 AVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALE 332
              +DL K   + A+            N   N  +    ++ Y+  +DA   L+T+WA+ 
Sbjct: 275 VQNVDLNKLARNRADH---------DANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVI 325

Query: 333 QQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSG 392
           QQQ++ LWG  Q H A+L P+SV+VLP  +     ET+ +    +N   I KF   +N  
Sbjct: 326 QQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDEN---INKFTEAINKH 382

Query: 393 NFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELMEK 452
           N    + + P F  +LK+Y  G ++ N  + T++SKLFR I+ +K ++++RD C +L  +
Sbjct: 383 NLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNE 442

Query: 453 LSHRNTXXXXXXXXXXXXXXXXXXTA-LEEKIYEMAQPSTKEDIPAR-FDFSSMNVYCID 510
           L+  N                   T   E+ IY + +      I  R  DF  + V+CID
Sbjct: 443 LNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCID 502

Query: 511 SESAHEIDDGISIEPLGRNAFTLHIHIADPVSLF-----TEDGGTKFNDEVWNIAYRRGF 565
            ++AHEIDDG+S+     N   L IHIADP SLF      E+  T  +DE+ NIA+RR F
Sbjct: 503 EKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNST--SDEILNIAFRRAF 560

Query: 566 TTYLPDLVLPMLPQSFCLAGSLGINNGK-SKTVSFSVNIKMHDGGLRIDEESFKVRLGYA 624
           TTYLP+ VLPMLP+SFC    LG N GK + T++FSV+         I E++F+++LG  
Sbjct: 561 TTYLPEFVLPMLPKSFCTKSDLG-NTGKMTNTITFSVD--FDKSSCSILEDTFEIQLGKV 617

Query: 625 TKFPK-VTYDSVDRIL----QQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGEGF 679
             FPK  TY  VD+IL    ++ ND  ++ +E+R    I+  L+  RI +  A+IFGEGF
Sbjct: 618 NNFPKNTTYKEVDKILNSSIKRENDIERDLREMRF---IANHLRKCRI-DNSAVIFGEGF 673

Query: 680 NRGLVKLNE----GESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVF 735
           N+G V L E    GE     K+ F+D   TPS ++VSE MILAN+LAG+YF+ +KIP ++
Sbjct: 674 NKGAVNLIEKKQDGEKSY--KVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIY 731

Query: 736 RCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPA 795
           + YK L +K  A   ++ +  + +   LP++++I+K+ SLL+SS ++  P  H MIG   
Sbjct: 732 KTYKGLNMKPKASSQFKKILNVNKK-RLPSIKEISKIGSLLSSSTFSSKPSIHEMIGTDQ 790

Query: 796 YLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASF 855
           Y TVTSPLRRFPDLINH Q+ ++LT  PL FS+  +DEM+WHL  RD ++R  +R    +
Sbjct: 791 YATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKY 850

Query: 856 WTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDL 915
           WTL++L    + +P  +  VMV S+   G V C+LP LS A G LKLKP  +   AIG++
Sbjct: 851 WTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEI 910

Query: 916 MHNCVITKLDCLDAVMELKM 935
           + NC I  +DCL   +E  +
Sbjct: 911 IKNCKIANIDCLGNSLEFAI 930

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 98/434 (22%), Positives = 174/434 (40%), Gaps = 71/434 (16%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + 
Sbjct: 513 LPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVK-ANTPLDA 570

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDE 614
           E       RG + YL D  + MLP    L  +L          +FSV  ++ +    ++ 
Sbjct: 571 E----GASRGTSVYLVDKRIDMLP--MLLGTNLCSLKPYVDRFAFSVLWELDENANIVNV 624

Query: 615 ESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAII 674
           +  K  +     F   +Y+     +   + K +  + +R L Q+S+ L+ KR++      
Sbjct: 625 DFTKSVIKSREAF---SYEQAQLRIDDESQKDELTQGMRALLQLSIKLKQKRLDA----- 676

Query: 675 FGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN-TLAG 723
                  G + L   E     K+  + ++  P  V          LV E M+LAN ++A 
Sbjct: 677 -------GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVAR 725

Query: 724 RYFQV---------NKIPGV--FRCYKELL-LKSGARESYESLRAMTQSTSL------PA 765
           R ++          +  P    F    E+L L+ G   S ES +A+  S         P 
Sbjct: 726 RIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDRCVDLEDPY 785

Query: 766 VEDIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQ 817
              + ++ S    +    FY G    PD RH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 786 FNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAA 845

Query: 818 HLTQNPLPFSKLD---IDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKIS 874
            +   PL  +  D   +D M  ++  +    + A R S  ++  + +++ +       I 
Sbjct: 846 AIGYEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIR 905

Query: 875 V----MVTSIPRMG 884
           V    +V  +P+ G
Sbjct: 906 VFHNGIVVLVPKFG 919

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 143/378 (37%), Gaps = 66/378 (17%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P R D     +  ID     +IDD +  + L    + + +HIAD V+ F      K N 
Sbjct: 520 LPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFV-----KPNT 573

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDE 614
            +      RG + YL D  + MLP    L   L          +FSV  ++++    ++ 
Sbjct: 574 ALDGEGASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELNENADIVNV 631

Query: 615 ESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAII 674
           +  K  +     F   +Y+     +   N + +    +R L ++S+ L+ KRIN      
Sbjct: 632 DFAKSVIKSREAF---SYEQAQLRIDDPNQQDELTHGMRALLKLSIKLKEKRINA----- 683

Query: 675 FGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGR 724
                  G + L   E     K+  + ++  P+ V          LV E M+LAN    R
Sbjct: 684 -------GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVAR 732

Query: 725 YFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------P 764
               +  P               F    E+L  + G   S ES +A+  S         P
Sbjct: 733 KI-YDSFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDP 791

Query: 765 AVEDIAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIR 816
               + ++ S    +    FY+G       RH  +    Y   TSP+RR+ D++ H Q+ 
Sbjct: 792 YFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 851

Query: 817 QHLTQNPLPFSKLDIDEM 834
             +   PL  S  D + M
Sbjct: 852 GAIGYEPLDLSHRDKNRM 869

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 95/432 (21%), Positives = 165/432 (38%), Gaps = 73/432 (16%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + E  
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIAD-VTHFVK-PNTALDAE-- 582

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L       +  +FSV  ++ D    ++ +  
Sbjct: 583 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVERFAFSVIWELDDNANIVNVDFM 638

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N K +  + +R L Q+S+ L+ KR++         
Sbjct: 639 KSVIKSREAF---SYEQAQLRIDDPNQKDELTEGMRALLQLSIKLKQKRLDA-------- 687

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  P+ V          LV E M+LAN    R   
Sbjct: 688 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI- 738

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------PAVE 767
            +  P               F    E+L  + G   S ES +A+  S         P   
Sbjct: 739 FDAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYFN 798

Query: 768 DIAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
            + ++ S    +    FY+G       RH  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 799 TLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 858

Query: 820 TQNPLPFSKLD---IDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVM 876
              PL     D   +D +  ++  +    + A R S  ++  + +++ +       I V+
Sbjct: 859 GYEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVEAGYVIKVL 918

Query: 877 ----VTSIPRMG 884
               V  +PR G
Sbjct: 919 NNGIVVLVPRFG 930

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 85/377 (22%), Positives = 148/377 (39%), Gaps = 64/377 (16%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + 
Sbjct: 515 LPKRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIAD-VTHFVK-AGTPLDA 572

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDE 614
           E       RG + YL D  + MLP    L   L          +FSV  ++      ++ 
Sbjct: 573 E----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDQKASIVNV 626

Query: 615 ESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAII 674
           +  K  +     F   +Y+     +   N K +  + +R L  +S+ L+ KR++      
Sbjct: 627 DFTKSVIRSREAF---SYEQAQLRIDDPNQKDELTQGMRALLNLSVKLKQKRLDA----- 678

Query: 675 FGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN-TLAG 723
                  G + L   E     K+  + ++  P  V          LV E M+LAN ++A 
Sbjct: 679 -------GALNLASPEV----KVHMDSETSDPGDVEIKKLLATNSLVEEFMLLANISVAK 727

Query: 724 RYFQVNKIPGVFRCY-----------KELL-LKSGARESYESLRAMTQSTSL------PA 765
           + ++      + R +            E+L L+     S ES +A+  S         P 
Sbjct: 728 KIYEAFPQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSLDRCIDPQDPY 787

Query: 766 VEDIAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQ 817
              + ++ S    +    FY+G       RH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 788 FNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 847

Query: 818 HLTQNPLPFSKLDIDEM 834
            +   PL  +  D ++M
Sbjct: 848 AIGYEPLDLTHRDKNKM 864

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 99/434 (22%), Positives = 164/434 (37%), Gaps = 77/434 (17%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    F + +HIAD V+ F +  GT  + E  
Sbjct: 518 RVDLRDKLICSIDPPGCVDIDDALHAKKLPNGHFEVGVHIAD-VTHFVK-AGTPLDAE-- 573

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG--LRIDEE 615
                RG + YL D  + MLP    L   L          +FSV  ++ +    +++D  
Sbjct: 574 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDENADIVKVDFS 629

Query: 616 SFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIF 675
              +R   A      +Y+     +   N   +    +R L  +S+ L+ KR++       
Sbjct: 630 KSVIRSREA-----FSYEQAQLRIDDKNQTDELTLGMRALLDLSIKLKQKRLDA------ 678

Query: 676 GEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRY 725
                 G + L   E     K+  + ++  P  V          LV E M+LAN    R 
Sbjct: 679 ------GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARK 728

Query: 726 FQVNKIPGV-------------FRCYKELLLK-SGARESYESLRAMTQSTSL------PA 765
              +  P               F    E+L K  G   S ES +A+  S         P 
Sbjct: 729 I-YDSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPY 787

Query: 766 VEDIAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQ 817
              + ++ S    +    FY+G       RH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 788 FNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 847

Query: 818 HLTQNPLPFSKLDID--EMIW-HLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKIS 874
            +   PL  S  D +  EMI  ++  R    + A R S  ++  + +++ +       I 
Sbjct: 848 AIGYEPLDLSHRDKNKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIK 907

Query: 875 VM----VTSIPRMG 884
           V+    V  +P+ G
Sbjct: 908 VLNNGIVVIVPKFG 921

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 145/374 (38%), Gaps = 64/374 (17%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + E  
Sbjct: 545 RQDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PGTALDAE-- 600

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ D    ID +  
Sbjct: 601 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDNAEIIDVKFT 656

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N   +  K +R L ++S+ L+ KR++         
Sbjct: 657 KSVIRSREAF---SYEQAQLRIDDKNQTDELTKGMRALLELSVKLKQKRLDA-------- 705

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN-TLAGRYF 726
               G + L   E     K+  + ++  P+ V          LV E M+LAN ++A + F
Sbjct: 706 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIF 757

Query: 727 QVNKIPGVFRCY-----------KELLLK-SGARESYESLRAMTQSTSL------PAVED 768
                  + R +            E+L K      S ES +A+  S         P    
Sbjct: 758 DAFPQTAMLRRHASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCIDPKDPYFNT 817

Query: 769 IAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLT 820
           + ++ S    +    FY+G       RH  +    Y   TSP+RRF D+I H Q+   + 
Sbjct: 818 LIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAHRQLAGAIG 877

Query: 821 QNPLPFSKLDIDEM 834
             PL     D ++M
Sbjct: 878 YEPLALMHRDKNKM 891

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/392 (22%), Positives = 150/392 (38%), Gaps = 66/392 (16%)

Query: 481 EKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540
           EK+ + A  +    +P R D     +  ID  +  +IDD +  + L    + + +HIAD 
Sbjct: 520 EKLSDSAAIAKDPLLPKRRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHIAD- 578

Query: 541 VSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFS 600
           V+ F +  GT  + E       RG + YL D  + MLP    L   L          +FS
Sbjct: 579 VTHFVK-PGTALDAE----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFS 631

Query: 601 VNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISL 660
           V  ++      ++ +  K  +     F   +Y+     +   N   +  + +R L Q+S 
Sbjct: 632 VLWELDQDANIVNVDFTKSVIRSREAF---SYEQAQIRIDDPNQTDELTQGMRALLQLSK 688

Query: 661 LLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------L 710
            L+ KR++             G + L   E     K+  + ++  P+ V          L
Sbjct: 689 KLKQKRLDA------------GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSL 732

Query: 711 VSEMMILANTLAGRYFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRA 756
           V E M+LAN    R    +  P               F    E+L  K G   S ES +A
Sbjct: 733 VEEFMLLANISVARKI-YDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKA 791

Query: 757 MTQS------TSLPAVEDIAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSP 802
           +  S       + P    + ++ S    +    FY+G       RH  +    Y   TSP
Sbjct: 792 LADSLDRCVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSP 851

Query: 803 LRRFPDLINHLQIRQHLTQNPLPFSKLDIDEM 834
           +RR+ D++ H Q+   +   PL  +  D  +M
Sbjct: 852 IRRYCDVVAHRQLAAAIGYEPLSLTHRDKTKM 883

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 95/432 (21%), Positives = 164/432 (37%), Gaps = 73/432 (16%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +    L    + + +HIAD V+ F +   T  + E  
Sbjct: 560 RKDLRDKVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIAD-VTHFVK-PSTALDAE-- 615

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ D    ++ E  
Sbjct: 616 --GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVMWELDDNADIVNVEFM 671

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N   +    +R L ++S+ L+ KR+          
Sbjct: 672 KSVIKSREAF---SYEQAQLRIDDKNQDDELTLGMRALLKLSIKLKQKRLEA-------- 720

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  P+ V          LV E M+LAN    R   
Sbjct: 721 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI- 771

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQS------TSLPAVE 767
            +  P               F    E+L  +     S ES +A+  S      +  P   
Sbjct: 772 YDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSEDPYFN 831

Query: 768 DIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
            + ++ S    +    FY+G    PD RH  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 832 TLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 891

Query: 820 TQNPLPFSKLD---IDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISV- 875
              PL  +  D   +D +  ++  +    + A R S  ++  + ++S + +     I V 
Sbjct: 892 GYEPLSLAHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRSNESTETGYIIKVF 951

Query: 876 ---MVTSIPRMG 884
              +V  +P+ G
Sbjct: 952 NNGIVVLVPKFG 963

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 152/379 (40%), Gaps = 68/379 (17%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P+R DF    +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + 
Sbjct: 536 LPSRKDFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIAD-VTHFVK-PGTALDA 593

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG--LRI 612
           E       RG + YL D  + MLP    L   L          +FSV  ++ +    + +
Sbjct: 594 E----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVVWELDNDANIVGV 647

Query: 613 DEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRA 672
           D     +R   A  + K           QN    + AK+  TL   +LL  SK++ ++R 
Sbjct: 648 DFTKSVIRSREAFSYEKA----------QNRIDDETAKDELTLGMRALLQLSKKLKQKR- 696

Query: 673 IIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN-TL 721
                  + G + L   E     K+  + ++  P+ V          LV E M+LAN ++
Sbjct: 697 ------LDAGALNLASPEV----KVHMDSETSDPNEVEIKKLLDTNSLVEEFMLLANISV 746

Query: 722 AGRYFQVNKIPGVFRCYK-------ELL-----LKSGARESYESLRAMTQSTSLPAVEDI 769
           A + ++      + R +        ELL     ++ G   S ES +A+  S       + 
Sbjct: 747 ARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPND 806

Query: 770 AKLSSLLN----------SSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQI 815
           + L++L+             F+ G       RH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 807 SYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 866

Query: 816 RQHLTQNPLPFSKLDIDEM 834
              +    L  S  D  +M
Sbjct: 867 AGAIGYEALDLSHRDKQKM 885

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 145/377 (38%), Gaps = 64/377 (16%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + 
Sbjct: 513 LPKRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIAD-VTHFVK-PNTPLDA 570

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDE 614
           E       RG + YL D  + MLP    L  +L          +FSV  ++      ++ 
Sbjct: 571 E----GASRGTSVYLVDKRIDMLP--MLLGTNLCSLKPYVDRFAFSVLWELDQDANIVNV 624

Query: 615 ESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAII 674
           +  K  +     F   +Y+     +  +    +  + +R L  +S+ L+ KR+N      
Sbjct: 625 DFTKSVIKSREAF---SYEQAQLRIDDSTQTDELTQGMRALLSLSIKLKEKRLNA----- 676

Query: 675 FGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGR 724
                  G + L   E     K+  + ++  P  V          LV E M+LAN    R
Sbjct: 677 -------GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVAR 725

Query: 725 ----------YFQVNKIPGV--FRCYKELL-LKSGARESYESLRAMTQSTSL------PA 765
                       + +  P    F    E+L L+ G   S ES +A+  S         P 
Sbjct: 726 KIYEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSLDRCVDPKDPY 785

Query: 766 VEDIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQ 817
              + ++ S    +    FY+G    PD RH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 786 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAA 845

Query: 818 HLTQNPLPFSKLDIDEM 834
            +    L  +  D ++M
Sbjct: 846 AIGYEALDLNHRDKNKM 862

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 99/436 (22%), Positives = 170/436 (38%), Gaps = 81/436 (18%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + E  
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PGTALDAE-- 583

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG--LRID-- 613
                RG + YL D  + MLP    L   L          +FSV  ++ +    + +D  
Sbjct: 584 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELDENADIVNVDFT 639

Query: 614 EESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAI 673
           +   K R  ++ +  ++  D       Q +D TQ    +R L Q+S+ L+ KR++     
Sbjct: 640 KSVIKSREAFSYEQAQLRIDDA----SQTDDLTQG---MRALLQLSIKLKQKRLDA---- 688

Query: 674 IFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAG 723
                   G + L   E     K+  + ++  P  V          LV E M+LAN    
Sbjct: 689 --------GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVA 736

Query: 724 RYFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------ 763
           R    +  P               F    E+L  +     S ES +A+  S         
Sbjct: 737 RKI-YDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKD 795

Query: 764 PAVEDIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQI 815
           P    + ++ S    +    FY+G    PD +H  +    Y   TSP+RRF D++ H Q+
Sbjct: 796 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQL 855

Query: 816 RQHLTQNPLPFSKLD---IDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRK 872
              +   PL  S  D   +D +  ++  +    + A R S  ++  + +++ + +     
Sbjct: 856 AGAIGYEPLDLSHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYV 915

Query: 873 ISV----MVTSIPRMG 884
           I V    +V  +P+ G
Sbjct: 916 IKVFNNGIVVLVPKFG 931

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 148/379 (39%), Gaps = 74/379 (19%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F + G T  + E  
Sbjct: 542 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVKQG-TALDAE-- 597

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGG--LRID-- 613
                RG + YL D  + MLP    L   L          +FSV  ++      +++D  
Sbjct: 598 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELDSNADIVKVDFT 653

Query: 614 EESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAI 673
           +   K R  ++ +  ++  D  +    Q +D TQ    +R L Q+S+ L+ KR++     
Sbjct: 654 KSVIKSREAFSYEQAQLRIDDPN----QTDDLTQG---MRALLQLSIKLKQKRLDN---- 702

Query: 674 IFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAG 723
                   G + L   E     K+  + ++  P  V          LV E M+LAN    
Sbjct: 703 --------GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVA 750

Query: 724 RYFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------ 763
           R    +  P               F    E+L  +     S ES +A+  S         
Sbjct: 751 RKI-YDAFPQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKD 809

Query: 764 PAVEDIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQI 815
           P    + ++ S    +    FY+G    PD +H  +    Y   TSP+RR+ D++ H Q+
Sbjct: 810 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQL 869

Query: 816 RQHLTQNPLPFSKLDIDEM 834
              +   PL  S  D ++M
Sbjct: 870 AGAIGYEPLSLSHRDKNKM 888

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 102/461 (22%), Positives = 172/461 (37%), Gaps = 82/461 (17%)

Query: 478 ALEEKIYEMAQPSTKEDIPA---------RFDFSSMNVYCIDSESAHEIDDGISIEPLGR 528
            L E+ ++   P + +DI A         R D     +  ID     +IDD +  + L  
Sbjct: 497 CLPEEGHDWKAPVSVDDIEANKADPLLAKRKDLRDKLICSIDPPGCVDIDDALHAKKLPN 556

Query: 529 NAFTLHIHIADPVSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLG 588
             + + +HIAD V+ F +  GT  + E       RG + YL D  + MLP    L   L 
Sbjct: 557 GHWEVGVHIAD-VTHFVK-PGTALDAE----GASRGTSVYLVDKRIDMLP--MLLGTDLC 608

Query: 589 INNGKSKTVSFSVNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQE 648
                    +FSV  ++ +    I+ E  K  +     F    Y+     +     + + 
Sbjct: 609 SLKPYVDRFAFSVIWELDENADIINVEFHKSVIRSREAF---AYEQAQLRIDDPKQQDEL 665

Query: 649 AKELRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPST 708
              +R L Q+S+ L+ KR+              G + L   E     K+  + ++  P  
Sbjct: 666 TLGMRALLQLSIKLKQKRLEA------------GALNLASPEV----KVHMDSETSDPGE 709

Query: 709 V----------LVSEMMILANTLAGRYFQVNKIPGV-------------FRCYKELL-LK 744
           V          LV E M+LAN    R    +  P               F    E+L  +
Sbjct: 710 VEIKKLLATNSLVEEFMLLANISVARKI-YDSFPQTAMLRRHAPPPATNFEILNEMLQRR 768

Query: 745 SGARESYESLRAMTQSTSL------PAVEDIAKLSS----LLNSSFYTGT---PD-RHSM 790
                S ES +A+  S         P    + ++ S    +    FY+G    PD RH  
Sbjct: 769 KNMSISVESSKALADSLDRCEDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYG 828

Query: 791 IGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLD---IDEMIWHLQSRDLVIRK 847
           +    Y   TSP+RR+ D++ H Q+   +   PL     D   +D +  ++  +    + 
Sbjct: 829 LAVDIYTHFTSPIRRYCDIVAHRQLAGAIDYEPLSLDHRDKHKMDMICRNINRKHRNAQF 888

Query: 848 AARDSASFWTLKHLKSLQDSSPDRKISV----MVTSIPRMG 884
           A R S  ++  + +K+ +       I V    +V  +P+ G
Sbjct: 889 AGRASIEYYVGQVMKNNESLESGYVIKVFNNGIVVLVPKFG 929

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 88/391 (22%), Positives = 146/391 (37%), Gaps = 73/391 (18%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + E  
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PNTALDAE-- 586

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ D    ++ +  
Sbjct: 587 --GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDDANIVNVDFM 642

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N   +    +R L ++S+ L+ KR+          
Sbjct: 643 KSVIKSREAF---SYEQAQFRIDDKNQNDELTSGMRALLELSIKLKQKRLEA-------- 691

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  P+ V          LV E M+LAN    R   
Sbjct: 692 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI- 742

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------PAVE 767
            +  P               F    E+L  +     S ES +A+  S         P   
Sbjct: 743 YDAFPQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFN 802

Query: 768 DIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
            + ++ S    +    FY+G    PD RH  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 803 TLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 862

Query: 820 TQNPLPFSKLDIDEMIWHLQSRDLVIRKAAR 850
              PL  +  D ++M       D++ R   R
Sbjct: 863 GYEPLSLTHRDKNKM-------DMICRNINR 886

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 147/391 (37%), Gaps = 73/391 (18%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + E  
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PGTALDAE-- 586

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ +    ++ +  
Sbjct: 587 --GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDENANIVNVDFM 642

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N   +    +R L Q+S+ L+ KR+          
Sbjct: 643 KSVIRSREAF---SYEQAQLRIDDINQNDELTLGMRALLQLSVKLKQKRLEA-------- 691

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  P+ V          LV E M+LAN    R   
Sbjct: 692 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI- 742

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------PAVE 767
            +  P               F    E+L  +     S ES +A+  S         P   
Sbjct: 743 YDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFN 802

Query: 768 DIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
            + ++ S    +    FY+G    PD RH  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 803 TLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 862

Query: 820 TQNPLPFSKLDIDEMIWHLQSRDLVIRKAAR 850
              PL  +  D ++M       D++ R   R
Sbjct: 863 GYEPLSLTHRDKNKM-------DMICRNINR 886

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 92/394 (23%), Positives = 150/394 (38%), Gaps = 79/394 (20%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + E  
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVK-PGTALDAE-- 586

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ D    ++    
Sbjct: 587 --GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFM 642

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK---ELRTLYQISLLLQSKRINEQRAII 674
           K  +     F      S ++   + +DKTQ  +    +R L ++S+ L+ KR+       
Sbjct: 643 KSVIRSREAF------SYEQAQLRIDDKTQNDELTMGMRALLKLSVKLKQKRLEA----- 691

Query: 675 FGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGR 724
                  G + L   E     K+  + ++  P+ V          LV E M+LAN    R
Sbjct: 692 -------GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVAR 740

Query: 725 YFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL------P 764
               +  P               F    E+L  +     S ES +A+  S         P
Sbjct: 741 KI-YDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDP 799

Query: 765 AVEDIAKLSS----LLNSSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIR 816
               + ++ S    +    FY+G    PD RH  +    Y   TSP+RR+ D++ H Q+ 
Sbjct: 800 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 859

Query: 817 QHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAAR 850
             +   PL  +  D ++M       D++ R   R
Sbjct: 860 GAIGYEPLSLTHRDKNKM-------DMICRNINR 886

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/431 (22%), Positives = 169/431 (39%), Gaps = 71/431 (16%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + E  
Sbjct: 527 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVK-PNTPLDAE-- 582

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++ D    +D    
Sbjct: 583 --GASRGTSVYLVDKRIDMLP--LLLGTDLCSLKPYVDRYAFSVLWELDDNANIVDVNFT 638

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   +   +  + +R L ++S+ L+ KR++         
Sbjct: 639 KSVIRSREAF---SYEQAQIRIDDKSQTDELTQGMRALLKLSIKLKQKRLDA-------- 687

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN-TLAGRYF 726
               G + L   E     K+  + ++  P+ V          LV E M+LAN ++A + F
Sbjct: 688 ----GALNLASPEV----KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIF 739

Query: 727 Q------VNKIPGV-----FRCYKELLLKSGARE-SYESLRAMTQSTSL------PAVED 768
           +      + +  GV     F    E+L +      S ES +A+  S         P    
Sbjct: 740 ESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCVDPKDPYFNT 799

Query: 769 IAKLSS----LLNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLT 820
           + ++ S    +    FY+G       RH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 800 LIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 859

Query: 821 QNPLPFSKLD---IDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVM- 876
             PL  S  D   +D +  ++  R    + A R S  ++  + +++ +       I V+ 
Sbjct: 860 YEPLDLSHRDKNKMDMICRNINKRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVLN 919

Query: 877 ---VTSIPRMG 884
              V  +PR G
Sbjct: 920 NGIVVLVPRFG 930

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 141/375 (37%), Gaps = 66/375 (17%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + E  
Sbjct: 530 RTDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PGTALDAE-- 585

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                RG + YL D  + MLP    L   L          +FSV  ++++    ++ +  
Sbjct: 586 --GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELNEDADIVNVDFT 641

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +  +N K +    +R L  +S  L+ KR++         
Sbjct: 642 KSVIRSREAF---SYEQAQVRIDDSNQKDELTLGMRALLHLSKKLKQKRLDA-------- 690

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  P  V          LV E M+LAN    R   
Sbjct: 691 ----GALNLASPEV----KVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKI- 741

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSLPAVEDIAKLS 773
            +  P               F    E+L  +     S ES +A+  S         A  +
Sbjct: 742 YDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCIDPQDAYFN 801

Query: 774 SLLN----------SSFYTGT---PD-RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
           +L+             FY+G    PD +H  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 802 TLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAI 861

Query: 820 TQNPLPFSKLDIDEM 834
              PL     D ++M
Sbjct: 862 DYEPLSLMHRDKNKM 876

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 135/375 (36%), Gaps = 66/375 (17%)

Query: 498 RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVW 557
           R D     +  ID     +IDD +  + L    + + +HIAD V+ F +   T  + E  
Sbjct: 519 RRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIAD-VTHFVK-PNTALDAE-- 574

Query: 558 NIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESF 617
                R  + YL D  + MLP    L   L          +FSV  ++ +    +  E  
Sbjct: 575 --GASRATSVYLVDKRIDMLP--MLLGTDLCSLKASVDRFAFSVIWELDNDANIVSVEFT 630

Query: 618 KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGE 677
           K  +     F   +Y+     +   N   +    +R L Q+S  L+ KR++         
Sbjct: 631 KSVIRSREAF---SYEQAQLRIDDPNQNDELTLGMRALLQLSKKLKQKRLDA-------- 679

Query: 678 GFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILANTLAGRYFQ 727
               G + L   E     K+  + ++  PS V          LV E M+LAN    R   
Sbjct: 680 ----GALNLASPEV----KVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVARKI- 730

Query: 728 VNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSLPAVEDIAKLS 773
            +  P               F    E+L ++     S ES +A+  S       D    +
Sbjct: 731 YDSFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFN 790

Query: 774 SLLN----------SSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHL 819
           +L+             FY+G       RH  +    Y   TSP+RR+ D+I H Q+   +
Sbjct: 791 TLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAAAI 850

Query: 820 TQNPLPFSKLDIDEM 834
               L  S  D  +M
Sbjct: 851 GYESLDLSHRDKQKM 865

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 86/383 (22%), Positives = 147/383 (38%), Gaps = 76/383 (19%)

Query: 495 IPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFND 554
           +P R D     +  ID     +IDD +  + L    + + +HIAD V+ F +  GT  + 
Sbjct: 525 LPKRRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVK-PGTALDT 582

Query: 555 EVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDE 614
           E       R  + YL +  + MLP    L   L          +FSV  ++ D    I  
Sbjct: 583 E----GASRATSVYLVNKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWEL-DADANIVN 635

Query: 615 ESF-----KVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQSKRINE 669
             F     + R  ++ +  ++  D V+    QN++ T     +R L ++S  L+ KR++ 
Sbjct: 636 VDFTKSVIRSREAFSYEAAQLRIDDVN----QNDELTNG---MRALLELSKKLKQKRLDA 688

Query: 670 QRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTV----------LVSEMMILAN 719
                       G + L   E     K+  ++++  P+ V          LV E M+LAN
Sbjct: 689 ------------GALNLASPEV----KVHMDNETSDPNEVEIKKLLATNSLVEEFMLLAN 732

Query: 720 TLAGRYFQVNKIPGV-------------FRCYKELL-LKSGARESYESLRAMTQSTSL-- 763
               R    +  P               F    E+L ++     S ES +A+  S     
Sbjct: 733 ISVARKIN-DAFPQTAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADSLDRCI 791

Query: 764 ----PAVEDIAKLSS----LLNSSFYTG----TPDRHSMIGAPAYLTVTSPLRRFPDLIN 811
               P    + ++ S    +    FY+G    +   H  +    Y   TSP+RR+ D++ 
Sbjct: 792 DPEDPYFNTLVRIMSTRCMMAAQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRYCDVVV 851

Query: 812 HLQIRQHLTQNPLPFSKLDIDEM 834
           H Q+   +   PL  +  D  +M
Sbjct: 852 HRQLAGAIGYEPLDLTHRDKQKM 874

>SAKL0G10142g Chr7 (862958..866707) [3750 bp, 1249 aa] {ON} similar to
            uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
            Protein with a role in maintenance of cellular integrity
            interacts with components of the TOR pathway ssd1 mutant
            of a clinical S. cerevisiae strain displays elevated
            virulence
          Length = 1249

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 138/345 (40%), Gaps = 37/345 (10%)

Query: 491  TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGT 550
            +K+ I +R  F   +V+ I +E+A   D  I I+ L   +  L  H+ D V+   E+G +
Sbjct: 686  SKDQIESRRSFEDEDVFAI-TENASVSDFAIHIKTLKDGSIELGCHVID-VTAHIEEGSS 743

Query: 551  KFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGL 610
                 +   A +R    ++P   + +LP+   L  SL +   K  + + SV  K+    L
Sbjct: 744  -----LDRRARKRSSAVFMPQKTVHLLPKQ--LNSSLALTKDK-LSATISVVYKIDASSL 795

Query: 611  RIDEESFKVRLGYATKFPK--VTYDSVDRILQQNNDK---TQEAKELRTLYQISLLLQSK 665
             I        +G +T  P   +T+D V++ +   N     +   K     Y   L L   
Sbjct: 796  DI----VSTWIGESTIVPADLLTFDQVNKEITSGNASKFISDVHKVANQFYCQRLNLSGA 851

Query: 666  RINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRY 725
            R     A++      +  V LN  E+   D I  E Q +  STV       + N L    
Sbjct: 852  RQKPNLALLETLDDEKVNVDLNILENSIADTIFGEIQRKVNSTVAEK----IYNKLGSLS 907

Query: 726  F---QVNKIPGVFRCYKELLLKSG-------ARESYESLRAMTQSTSLPAVEDIAKLSSL 775
            F   Q   I    + +K+ +   G       A  +  S+ ++  + +   VE +   +  
Sbjct: 908  FLRRQAEPITTKLKLFKKKVQNFGYDVDITSASAAISSILSIEDTKARACVEILLFKTFT 967

Query: 776  LNSSFYTGTPD----RHSMIGAPAYLTVTSPLRRFPDLINHLQIR 816
                F  G  D    R+  +  P Y   T+PLRR+ D + H Q++
Sbjct: 968  RAKYFIAGKVDSDQYRNYSLNLPLYTHFTAPLRRYADHVVHRQLK 1012

>TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {ON}
           Anc_5.307 YDR293C
          Length = 1313

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 18/145 (12%)

Query: 477 TALEEKIYEMAQPSTKEDIPARFDFSSMNVYCI--DSESAHEIDDGISIEPLGRNAFTLH 534
             ++EK   +A+  +KE +  R DF+ +N Y +   S S +  +  + ++        L 
Sbjct: 697 NTVKEKPILLAKSISKELLKDRVDFTDLNTYNVLAISTSDNLSEFAVHVKDNSDGTLELA 756

Query: 535 IHIADPVSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKS 594
            H+ D ++   E+GG+     V   A RR     +P   + +LP++   A SL   + KS
Sbjct: 757 CHVID-ITAHIEEGGS-----VDRRARRRSTGVIMPQEKMALLPKAVNDAVSL-FKDKKS 809

Query: 595 KTVSFSVNIKMHDGGLRIDEESFKV 619
            T+S            ++D +SFKV
Sbjct: 810 ATISII---------FKLDSKSFKV 825

>Kwal_26.8206 s26 complement(690185..691705) [1521 bp, 506 aa] {ON}
           YKL045W (PRI2) - p58 polypeptide of DNA primase [contig
           58] FULL
          Length = 506

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 768 DIAKLSSLLNSSFYTGTPDRH-SMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPF 826
           D AK    LN  F     D     +    Y T++S L+   +L +  Q RQ+  Q    F
Sbjct: 156 DQAKFVQTLNLPFLQFITDEEKEQLSTQLYQTISSALQFQLNLTDETQRRQYFNQEK--F 213

Query: 827 SKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFV 886
            KL  + +I  + SR + I+K       F  L H+ +   +     +S    SIPR+   
Sbjct: 214 IKLPFESVIDLVGSRQVFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNED 273

Query: 887 RCVLPDL 893
             +LP L
Sbjct: 274 DRLLPIL 280

>Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa]
           {ON} YDR293C (SSD1) - Product of gene unknown [contig
           11] FULL
          Length = 1228

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 145/340 (42%), Gaps = 48/340 (14%)

Query: 512 ESAHEIDDGISI-EPLGRNAFTLHI------------HIADPVSLFTEDGGTKFNDEVWN 558
           E+    DD +++ E  G +   LHI            HI D V+   E+G +     +  
Sbjct: 671 EARKVFDDTVAVFETDGLSDLALHIKNFANGDLEMGCHILD-VTAHIEEGSS-----LDR 724

Query: 559 IAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMHDGGLRIDEESFK 618
            A +R    ++P  V+ +LPQ+  L  +L + NG++ + + SV +   D  L++      
Sbjct: 725 RARKRSSGVFIPQKVVNLLPQT--LNDALTMKNGRT-SATLSV-VYRFDSNLKV----VS 776

Query: 619 VRLGYATKFPK--VTYDSVDRILQQNNDK---TQEAKELRTLYQISLLLQSKRINEQRAI 673
             +G     P+  +T+  +++ L  ++     +   +     Y++ L   S ++N + ++
Sbjct: 777 TWIGETLITPESSITFKEMNKQLGSDSASPFVSAIQRVATAFYRLRLNCPSLKLNSELSL 836

Query: 674 IFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPG 733
           +      +  V +N  ++     I  E + Q  STV  +    L + LA    Q   I  
Sbjct: 837 LESLDDEKVKVDMNVFQASAATSIITEIERQVNSTVAQTVYAKLGD-LAFLRRQSRPIST 895

Query: 734 VFRCYKELLLKSGARESYESLRAMTQSTSLPAVED--------IAKLSSLLNSSFYTG-- 783
               +++ + K G   S +   + T  +S+ A+ED        I    +L  + ++    
Sbjct: 896 KLVSFEKKVAKLGF--SVDITDSQTLLSSILAIEDDSTRTGIEILLFKTLGRAKYFVAGK 953

Query: 784 -TPDR--HSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLT 820
             PD+  H  +  P Y   T+PLRR+ D + H Q+R  L+
Sbjct: 954 VEPDQYEHFALNLPLYTHFTAPLRRYADHVVHRQLRAVLS 993

>NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5.307
            YDR293C
          Length = 1245

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 161/384 (41%), Gaps = 57/384 (14%)

Query: 480  EEKIYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHI--HI 537
            +EK    A   ++ED+ AR  F++   Y I + S  +     +I    ++  T+ +  H+
Sbjct: 668  KEKAIFQALTISEEDLAARKSFTNREQYNIMAISEKQSLSEFAIHVRNKDESTIELGCHV 727

Query: 538  ADPVSLFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTV 597
             D  S   E      N  +   A +R    ++P   + +LP++   + +L  N  +S T+
Sbjct: 728  VDVTSYIEE------NSSLDRRARKRSSGVFMPQKSVELLPRAVNNSITLEANK-ESATI 780

Query: 598  SFSVNIKMHDGGLRIDEESFKVR---LGYATKFPK--VTYDSVDRILQQNNDKTQEAKEL 652
            S      ++D    ID  SF+++   +G +   P   ++ D +DR L+      +    +
Sbjct: 781  SV-----VYD----IDINSFQIKSTWIGESVIKPSTLLSIDEIDRRLKS----AKIDPYI 827

Query: 653  RTLYQISLLLQSKRIN-----EQRAIIFGEGFNRGLVKLNEGESGRLDKIGF----EDQS 703
              +  I+  L + RIN      + A+   E  +   VK++     R   +GF    E Q 
Sbjct: 828  SLVKNIATSLYATRINFPEASLEPALSLFESLDDEKVKVDLNIFDR--SLGFSVINELQR 885

Query: 704  QTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSL 763
            +  STV       L ++   R  QV  I      +K  +LK G      S   + +S  +
Sbjct: 886  KVNSTVAEKIYEKLGDSSFLRR-QVQPISTKIASFKNKVLKFGINIDITSTDTVIRS--I 942

Query: 764  PAVED--------IAKLSSLLNSSFYTG---TPDR--HSMIGAPAYLTVTSPLRRFPDLI 810
              +ED        I    ++  + ++      PD+  H  +  P Y   T PLRR+ D +
Sbjct: 943  LDIEDPDIRVGVEILLFKTMSRAKYFVAGKVDPDQYGHYALNLPIYTHFTCPLRRYADHV 1002

Query: 811  NHLQIRQHLTQNPLPFSKLDIDEM 834
             H Q++  +    +P+S+ DID +
Sbjct: 1003 VHKQLKSIIRG--VPYSE-DIDSL 1023

>Kwal_47.18276 s47 complement(762340..762921) [582 bp, 193 aa] {ON}
           YDR472W (TRS31) - Component of targeting complex (TRAPP)
           involved in ER to Golgi membrane traffic [contig 197]
           PARTIAL
          Length = 193

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 275 MLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSG 311
           +L+L KFRSS A    +  FQK G +GS N     +G
Sbjct: 30  LLELLKFRSSVAPGSTRNFFQKAGTSGSQNGAANATG 66

>YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON}
           SSD1Translational repressor with a role in polar growth
           and wall integrity; regulated by Cbk1p phosphorylation
           to effect bud-specific translational control and
           localization of specific mRNAs; interacts with TOR
           pathway components; contains a functional N-terminal
           nuclear localization sequence and nucleocytoplasmic
           shuttling appears to be critical to Ssd1p function
          Length = 1250

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 82/191 (42%), Gaps = 21/191 (10%)

Query: 489 PSTKEDIPARFDFSSMNVYCI--DSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTE 546
           P T E +  R +F+  N Y I   SE     +  + +   G     L  H+ D V+   E
Sbjct: 680 PLTAESLEYRRNFTDTNEYNIFAISELGWVSEFALHVRNNGNGTLELGCHVVD-VTSHIE 738

Query: 547 DGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMH 606
           +G +     V   A +R    ++P  ++ +LPQSF     L +  GK ++ + SV   + 
Sbjct: 739 EGSS-----VDRRARKRSSAVFMPQKLVNLLPQSFN--DELSLAPGK-ESATLSVVYTLD 790

Query: 607 DGGLRIDEESFKVRLGYATKFPK--VTYDSVDRILQQNNDKTQEAKELRTLYQISLLLQS 664
              LRI        +G +T  P   ++ + +D  L   +  +     L T+ +I+    +
Sbjct: 791 SSTLRIK----STWVGESTISPSNILSLEQLDEKLSTGSPTSY----LSTVQEIARSFYA 842

Query: 665 KRINEQRAIIF 675
           +RIN+  A + 
Sbjct: 843 RRINDPEATLL 853

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1260

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 785  PDR--HSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEM 834
            PD+  H  +  P Y   TSPLRR+ D + H Q+R  +    +P+++ DID +
Sbjct: 991  PDQYSHYSLNLPIYTHFTSPLRRYADHVVHRQLRSAIRG--VPYTE-DIDAL 1039

>Kpol_1032.83 s1032 (178927..180960) [2034 bp, 677 aa] {ON}
           (178927..180960) [2034 nt, 678 aa]
          Length = 677

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 22/114 (19%)

Query: 818 HLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWT----LKHLKS------LQDS 867
           H  +N +  ++L   E ++HL  +D +++ A RD+   +     LKH+K       L D 
Sbjct: 355 HFLENVIASARLKYVERLYHLYMKDRIVKLAKRDTTGAFVVQAFLKHMKEKDVKQILDDI 414

Query: 868 SPDRKI---------SVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAI 912
            P+  I         + ++ +  R+G   C L D    + I K  PE S +  I
Sbjct: 415 IPELSILLNSNMDFGTSIINASNRLG---CYLKDEVVNQLIKKYYPEESENKNI 465

>Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {ON}
           YDR293C (REAL)
          Length = 1251

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 489 PSTKEDIPARFDFSSMNVYCI--DSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTE 546
           P T E +  R +F+ +N Y I   SE     +  + +   G     L  H+ D V+   E
Sbjct: 681 PITAESLECRRNFTDVNEYNIFAISELGWISEFALHVRDNGNGTLELGCHVVD-VTGHIE 739

Query: 547 DGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMH 606
           +G +     V   A +R    ++P  ++ +LPQSF     L +  GK ++ + SV   + 
Sbjct: 740 EGSS-----VDKRARKRSSAVFMPQKLVNLLPQSFN--DELSLAPGK-ESATISVVYTLD 791

Query: 607 DGGLRI 612
              LRI
Sbjct: 792 SSTLRI 797

>TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5.307
           YDR293C
          Length = 1257

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 12/109 (11%)

Query: 489 PSTKEDIPARFDFSSMNVYCI--DSESAHEIDDGISIEPLGRNAFTLHI--HIADPVSLF 544
           P  +ED+ +R  F+  N Y I   +ESA+  D  + I+    +A ++ +  H+ D  +  
Sbjct: 686 PIAQEDLESRRQFTDQNTYDILAITESANYCDFAVHIKNNTDDAGSIELGCHVVDATAYI 745

Query: 545 TEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGK 593
            ED        +   A +R    ++P   + +LPQ   L  SL +  GK
Sbjct: 746 EEDSS------LDRRARKRSTAVFMPQKFVDLLPQ--ALNKSLTLAPGK 786

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,500,913
Number of extensions: 4168994
Number of successful extensions: 10554
Number of sequences better than 10.0: 56
Number of HSP's gapped: 10612
Number of HSP's successfully gapped: 59
Length of query: 936
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 817
Effective length of database: 39,836,145
Effective search space: 32546130465
Effective search space used: 32546130465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)