Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102108.852ON27827814140.0
KLTH0C03652g8.852ON2762775192e-64
SAKL0D01122g8.852ON3111702134e-19
AFR449W8.852ON2991831599e-12
ZYRO0C14916g8.852ON3282481413e-09
Skud_13.228.852ON3561891342e-08
KLLA0C06292g8.852ON2561981305e-08
YML119W8.852ON3572411315e-08
Suva_13.248.852ON3601911291e-07
Kpol_237.38.852ON3511611281e-07
Smik_13.158.852ON3571881253e-07
KNAG0G034908.852ON317301253e-07
TDEL0B002108.852ON3331181218e-07
NDAI0E002408.852ON519531211e-06
KAFR0A028808.852ON4301271202e-06
CAGL0B02409g8.852ON361311192e-06
TPHA0I003408.852ON395271022e-04
NCAS0B002508.852ON316391013e-04
TBLA0D033108.852ON50226989e-04
NCAS0E008203.490ON20278850.018
ACR047C5.248ON21279770.22
SAKL0G11550g5.248ON21778750.37
TPHA0N010105.248ON21130730.77
TDEL0E037805.248ON21447691.9
KLTH0G07590g5.248ON21878682.7
TBLA0C030705.248ON22127683.3
Kwal_23.28605.248ON21728673.7
YLR247C (IRC20)1.389ON155641685.1
ZYRO0D06490g8.291ON28456665.5
TDEL0E024605.381ON33198658.7
KLLA0F10417g6.152ON507161659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10210
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...   549   0.0  
KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...   204   2e-64
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...    87   4e-19
AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...    66   9e-12
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    59   3e-09
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...    56   2e-08
KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...    55   5e-08
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...    55   5e-08
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...    54   1e-07
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...    54   1e-07
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    53   3e-07
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    53   3e-07
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    51   8e-07
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    51   1e-06
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    51   2e-06
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    50   2e-06
TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...    44   2e-04
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    44   3e-04
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    42   9e-04
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    37   0.018
ACR047C Chr3 complement(443876..444514) [639 bp, 212 aa] {ON} Sy...    34   0.22 
SAKL0G11550g Chr7 (986891..987544) [654 bp, 217 aa] {ON} similar...    33   0.37 
TPHA0N01010 Chr14 complement(216641..217276) [636 bp, 211 aa] {O...    33   0.77 
TDEL0E03780 Chr5 (712981..713625) [645 bp, 214 aa] {ON} Anc_5.24...    31   1.9  
KLTH0G07590g Chr7 (615156..615812) [657 bp, 218 aa] {ON} similar...    31   2.7  
TBLA0C03070 Chr3 (739999..740664) [666 bp, 221 aa] {ON} Anc_5.24...    31   3.3  
Kwal_23.2860 s23 (45013..45666) [654 bp, 217 aa] {ON} YKL142W (M...    30   3.7  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    31   5.1  
ZYRO0D06490g Chr4 (560165..561019) [855 bp, 284 aa] {ON} similar...    30   5.5  
TDEL0E02460 Chr5 complement(476921..477916) [996 bp, 331 aa] {ON...    30   8.7  
KLLA0F10417g Chr6 (961004..962527) [1524 bp, 507 aa] {ON} simila...    30   9.5  

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/278 (96%), Positives = 269/278 (96%)

Query: 1   MHNTRTYDAASQYTSGNGKSFLPASLKMAPTLSAPQGENSRSERRTLRNTSPLRRSQVVD 60
           MHNTRTYDAASQYTSGNGKSFLPASLKMAPTLSAPQGENSRSERRTLRNTSPLRRSQVVD
Sbjct: 1   MHNTRTYDAASQYTSGNGKSFLPASLKMAPTLSAPQGENSRSERRTLRNTSPLRRSQVVD 60

Query: 61  GGKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSS 120
           GGKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSS
Sbjct: 61  GGKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSS 120

Query: 121 SVAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQAL 180
           SVAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQAL
Sbjct: 121 SVAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQAL 180

Query: 181 GELSGAVKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIV 240
           GELSGAVKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIV
Sbjct: 181 GELSGAVKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIV 240

Query: 241 DSFSLLPXXXXXXXXXILHLNNRSILLPEIAGIASMDL 278
           DSFSLLP         ILHLNNRSILLPEIAGIASMDL
Sbjct: 241 DSFSLLPDDEEEDSEDILHLNNRSILLPEIAGIASMDL 278

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score =  204 bits (519), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 163/277 (58%), Gaps = 15/277 (5%)

Query: 12  QYTSGNGKSFL----------PASLKMAPTLSAPQGENSRSERRTLRNTSPLRRSQVVDG 61
           QY+   G+S L          P  + M P    P  +  + E+RTLRNTSPLR+SQ  +G
Sbjct: 5   QYSGVMGQSTLRNNMVRTVPSPNQITMIP---VPHLQAHKGEKRTLRNTSPLRKSQDFEG 61

Query: 62  GKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSS 121
            K + + KS   ++G  NSR RW++ K I D++ P + +   RYL  P K D KRG+S  
Sbjct: 62  SKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEKPRYLTVPGKFDVKRGRSGL 121

Query: 122 VAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALG 181
           +      +V +Y+L E+PF+ K+ + +L++ II A Q  +F+KQPIG ++D KY V  L 
Sbjct: 122 IIG-SSSRVAYYRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLK 180

Query: 182 ELSGAVKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVD 241
           EL  AV ++ +R +   ++ SKANPL RL +Q+  + N++ DLSFDGKAMN+SDIFK+VD
Sbjct: 181 ELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVD 240

Query: 242 SFSLLPXXXXXXXXXILHLNNRSILLPEIAGIASMDL 278
           SFSL P           H +  SIL PEI      DL
Sbjct: 241 SFSLFPDDDTDEDEAP-HFHMGSILPPEITNSTVPDL 276

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 95/170 (55%), Gaps = 12/170 (7%)

Query: 86  EAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSSVAEFVPQK--VVHYKLEELPFKSK 143
           E   IS +++ + +    RY+A+P KIDY+  +++ V     ++  + +YKL E      
Sbjct: 114 EIPNISYIQRQITRTP--RYMAAPVKIDYEACRTNVVVNETQKRKSIAYYKLCEPMLSEA 171

Query: 144 SGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKFT---ERSTRRIIR 200
           S R  +I  II A++  Y ++QPI    + +YQV +L +    V K+    ++  RR + 
Sbjct: 172 SRRKPMIAKIIDAKRNSYNERQPIKLGANTEYQVVSLEQFPDTVSKYINDLKKPNRRTLA 231

Query: 201 ASK---ANPLTRLTMQDPGDA--NDTADLSFDGKAMNRSDIFKIVDSFSL 245
           +S     N + +L  Q+      ND+ DLSFDGKA+++SDI +IVDSFS+
Sbjct: 232 SSTRVANNKIDQLIAQESYSTCQNDSIDLSFDGKALDKSDILRIVDSFSV 281

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 88/183 (48%), Gaps = 18/183 (9%)

Query: 79  NSRPRWIEAKTISDVEKPVA--KAGNQRYLASPCKIDYKRGKSSSVAEFVPQKV--VHYK 134
           + R + IE  T   +  P+   +A   RY+A P + +  +   + V     +K    +YK
Sbjct: 90  HGRTQVIEIPTAESISAPLHENRALKLRYMAGPVRPEGIKVPKNPVINLSKKKAPETYYK 149

Query: 135 LEE----LPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKF 190
           + E    +   S    TQ +  +I  ++  Y + QPI       Y V +L +L   ++++
Sbjct: 150 IAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERY 209

Query: 191 -TERSTRRIIRASKANPLTRLTMQD-------PGDANDTADLSFDGKAMNRSDIFKIVDS 242
             E+    + R S A+       QD       P +AND+ DLSFDGKA+N+SD  +++DS
Sbjct: 210 QVEKPV--VKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDS 267

Query: 243 FSL 245
           FSL
Sbjct: 268 FSL 270

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 103/248 (41%), Gaps = 32/248 (12%)

Query: 49  NTSPLRRSQVVDGGKT-------SPSTKSVTISSGQLNSRPRWIEAKTISDVEK--PVAK 99
           N + LRRS    G K        SP  K    S+ Q    P++ E  +I ++EK  PV +
Sbjct: 86  NENRLRRSPQRMGAKNTKSSLTGSPHRKGPRSSNLQARGPPKYKEISSIYELEKVDPVKQ 145

Query: 100 AGN--QRYLASPCKIDYKRGKSSSVAEFV----------PQKVVHYKLEELPFKSKSGRT 147
             N   RY + P  +D  R     +   +          P   + YKL       +    
Sbjct: 146 ENNFTNRYFSDPVDLDSARSDDGRLKPIINTASKNGKSYPGNKI-YKLSIPLLVCQDTHR 204

Query: 148 QLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKFTERSTRRIIRASKANPL 207
            L   I    +  Y   QP+    D   +   L +L     +F ++         K  P 
Sbjct: 205 ALKNQIERVYRSKYHSYQPLSLFGDMSIRYYRLEDLQSRFIEFLQK-------PRKPQPP 257

Query: 208 TRL--TMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL-LPXXXXXXXXXILHLNNRS 264
            ++  ++   G  ND+ +LSFDGKA++RSDIF++VDSFS+ L           ++ + R+
Sbjct: 258 LQVARSLNGTGALNDSFELSFDGKALDRSDIFRMVDSFSVALSDDDAEDESSFVNSSGRN 317

Query: 265 ILLPEIAG 272
           IL  E+ G
Sbjct: 318 ILPAEMTG 325

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 86/189 (45%), Gaps = 29/189 (15%)

Query: 86  EAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSSV------------AEFVPQK---- 129
           E K+I D+  P      +RY  SP  +   R  SS++            A F  +K    
Sbjct: 133 EVKSIKDISFPSRTCTAKRYFTSPIDLHGIRNNSSNITPTLTNSPMKSKANFNIKKFILP 192

Query: 130 ---VVHYKLEELPFKSKSGRTQLIK--DIILAQQEVYFKKQPIGPAEDAKYQV-QALGEL 183
              ++ YKL     ++    ++ I    I L  ++ Y   QPI  + D K ++ ++L EL
Sbjct: 193 RSVIITYKLASPVHETIDDISKKIIILQISLNFEKSYHSLQPIQLSTDRKTRILKSLDEL 252

Query: 184 SGA-------VKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDI 236
            G         +   + + + +      N   R +      AN++ +LSFDGKAM+RSDI
Sbjct: 253 CGEHLVLLPKQQSQPQNNIKPVKNLPNINTKQRTSTSIGTTANESFELSFDGKAMDRSDI 312

Query: 237 FKIVDSFSL 245
           F++VDSFS+
Sbjct: 313 FRMVDSFSI 321

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 95/198 (47%), Gaps = 24/198 (12%)

Query: 61  GGKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCK-IDYKRGKS 119
           G + SP+ + ++       S P  +E + I+DV+         R    P K ++Y   K 
Sbjct: 39  GTRQSPNKQHIS-------SSPPILEVQNIADVDTSNTFGQFNRISQPPSKNLNYDTPKI 91

Query: 120 SSVAEF--VPQKVVHYKLEELPFKSKSGR--TQLIKDIILAQQEVYFKKQPIGPAEDAKY 175
           +   E+  +    + YK++ +P  SKS    + +I  +I    E +   +      D ++
Sbjct: 92  NVKLEYHTMQSSKIIYKID-VPISSKSDMEISPVITKLI---NETHESAEAFKLCNDNRF 147

Query: 176 QVQALGELSGAVKKFTER--STRRIIRASKA----NPLTRLTMQDPG--DANDTADLSFD 227
               L  L   + K+  +  S +R+ +  K     N + +L  Q+     AND+ +LSFD
Sbjct: 148 GYTTLDALPAVLSKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFD 207

Query: 228 GKAMNRSDIFKIVDSFSL 245
           GKAMN++DIF+IVDSFS+
Sbjct: 208 GKAMNKNDIFRIVDSFSV 225

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 101/241 (41%), Gaps = 56/241 (23%)

Query: 49  NTSPLRRSQVVDGGKTSPSTKSVTISSGQLNSRP-RWIEAKTISDVEK---PVAKAGNQR 104
           N  P R +  +    T+ ++     S   LNS+  ++ + K +S + +   P      +R
Sbjct: 93  NNRPSRYTNTMGAANTNVNSHPHHQSVSHLNSKSLKFNQTKEVSSINEIIFPSRTCTKKR 152

Query: 105 YLASPCKIDYKRGKSSSVAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEV---- 160
           Y   P  + Y    S+SVA          KL   P KSK+     IK  IL +  V    
Sbjct: 153 YFTKPIDL-YGTRSSTSVAP---------KLTNSPTKSKTNFN--IKKCILPRSVVTTYK 200

Query: 161 ----------------------------YFKKQPIGPAEDAKYQV-QALGELSGAVKKFT 191
                                       Y   QPI  + ++K ++ ++L EL G     T
Sbjct: 201 LPSPVHETIDDISKKIIILLISLKFEKNYHFLQPIQLSTNSKTRISKSLDELCGVQLTST 260

Query: 192 ERSTRRIIRASK-------ANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFS 244
            R  +++   SK       +N   R       +AN++ +LSFDGKAM+RSDIF++VDSFS
Sbjct: 261 LRQQKQLQGNSKPVKNLPNSNAKQRAGASVSTNANESFELSFDGKAMDRSDIFRMVDSFS 320

Query: 245 L 245
           +
Sbjct: 321 I 321

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 31/191 (16%)

Query: 86  EAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSSV------------AEFVPQK---- 129
           EA +I D+  P      +RY   P  +   R   S+V            A F  +K    
Sbjct: 134 EADSIQDIPFPSRTCTAKRYFTKPIDLYGTRNNCSTVMPGLMSSPTKSKANFTIKKSILP 193

Query: 130 ---VVHYKLEELPFKSKSGRTQLIK--DIILAQQEVYFKKQPIGPAEDAKYQV-QALGEL 183
              +  YKL    +K+    ++ I    I L  ++ Y   QPI  + + K +V +++ EL
Sbjct: 194 RCVITTYKLPSPVYKTIDDISKKIIILQISLNFEKSYHFLQPIQLSTNKKTRVSKSIEEL 253

Query: 184 SGAV---------KKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRS 234
              +         +   + + + +  A   N   R ++    +AN++ +LSFDGKAM+RS
Sbjct: 254 CRDLLSPPPPSKSQHQLQSNIKPMKNAQNTNTKQRTSINAGTNANESFELSFDGKAMDRS 313

Query: 235 DIFKIVDSFSL 245
           DIF++VDSFS+
Sbjct: 314 DIFRMVDSFSI 324

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 76/161 (47%), Gaps = 23/161 (14%)

Query: 103 QRYLASPCKIDYKRGKSSSVAEFV---PQKVV-----HYKLEELPFKSKSGRTQLIKDII 154
            RY +S   ++  RG+   +   +   P+ V      +YKL +   + K+    +++ I 
Sbjct: 164 NRYFSSITNLNDFRGEDGKLKPLINTLPKNVQLNRKKNYKLNKPVMQEKTSYKVVVELID 223

Query: 155 LAQQEVYFKKQP----------IGPAEDAKYQVQALGELSGAVKKFTERSTRRIIRASKA 204
               + Y K QP          +G  E+A  ++    E S A  K T  +   I + S +
Sbjct: 224 QVYNKYYNKLQPYRSISDDNIDLGSIENAIEKLCERLENSTATNKRTPNNVHDIAKISNS 283

Query: 205 NPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
             L   T+      ND+ +LSFDGKA++RSDI ++VDSFS+
Sbjct: 284 RTLLTSTI-----GNDSFELSFDGKALDRSDILRMVDSFSV 319

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 86/188 (45%), Gaps = 28/188 (14%)

Query: 86  EAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSS-----------SVAEF------VPQ 128
           E  +I D+  P      +RY  SP  +   R  +S           S A F      +P+
Sbjct: 133 EVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTAPALTNSPIKSKANFNIRKYILPR 192

Query: 129 KVVH-YKLEELPFKSKS--GRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQV-QALGELS 184
            V+  YKL    +++     +  +I  I L  ++ Y   QPI  + + K ++ + L EL 
Sbjct: 193 SVITTYKLSSPVYETIDDISKKVIILLISLKFEKNYHFWQPIQLSVNKKTRISKTLDELC 252

Query: 185 GA--VKKFTERSTRRIIRASKANPLTRLTMQDPGD-----ANDTADLSFDGKAMNRSDIF 237
                  F ++S  +    S  NP      Q  G      AN++ +LSFDGKAM+RSDIF
Sbjct: 253 EEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIF 312

Query: 238 KIVDSFSL 245
           ++VDSFS+
Sbjct: 313 RMVDSFSI 320

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%)

Query: 216 GDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
           G  ND+ DLSFDGKAM+RSDIF++VDSFS+
Sbjct: 257 GGHNDSFDLSFDGKAMDRSDIFRMVDSFSI 286

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (50%), Gaps = 26/118 (22%)

Query: 133 YKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPI----GPAEDAKYQVQALGELSGAVK 188
           Y+L  +P  +     Q+++D I   +  Y + QP+     PA+D        GE    ++
Sbjct: 205 YRLT-VPLMTCDESHQVVRDEIENNRHRYRQTQPLHRNQAPADD-------FGETVPNLR 256

Query: 189 KFTERST-RRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
              + +T RR + A  +              ND+ DLSFDGKA++RSDIF++VDSFS+
Sbjct: 257 NTKKTATLRRPLLAGSS-------------LNDSFDLSFDGKALDRSDIFRMVDSFSV 301

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 10/53 (18%)

Query: 193 RSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
           +S R +I    AN           + ND+ DLSFDGKAM+RSDIF++VDSF++
Sbjct: 415 KSNRHLINVITAN----------SNPNDSFDLSFDGKAMDRSDIFRMVDSFTM 457

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 10/127 (7%)

Query: 129 KVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELS---- 184
           K+  YKL      S    + L K I     +     QP+  A +  +++  L E S    
Sbjct: 249 KIQTYKLSTPILSSIKYGSTLSKKIDSHYNDQNISAQPLFIAGNKNFKIDELNEASVELI 308

Query: 185 -GAVKKFTERST-RRIIRASKANP----LTRLTMQDPGDANDTADLSFDGKAMNRSDIFK 238
              + +  + ST R +I+ S  N       R  + +  + ND+ DLSFDGKA++R+DIF+
Sbjct: 309 DKYLSQLDKSSTGRTLIKNSSLNSSKMQRQRRPLINVSNYNDSFDLSFDGKALDRNDIFR 368

Query: 239 IVDSFSL 245
           +VDSFS+
Sbjct: 369 MVDSFSI 375

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/31 (67%), Positives = 27/31 (87%)

Query: 215 PGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
           P   ND+ DLSFDGKA++RSDIF++VDSFS+
Sbjct: 300 PAATNDSFDLSFDGKALDRSDIFRMVDSFSI 330

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 25/27 (92%)

Query: 219 NDTADLSFDGKAMNRSDIFKIVDSFSL 245
           ND+ +LSFDGKA++RSDI ++VDSFS+
Sbjct: 320 NDSFELSFDGKALDRSDILRMVDSFSV 346

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%)

Query: 207 LTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
           L  LT Q P    ++ +LSFDGKA+++SDI +IVDSF++
Sbjct: 250 LMNLTHQ-PATMENSFELSFDGKALDKSDILRIVDSFTM 287

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 24/26 (92%)

Query: 220 DTADLSFDGKAMNRSDIFKIVDSFSL 245
           ++ DLSFDGKA++RSDI ++VDSFS+
Sbjct: 421 NSFDLSFDGKALDRSDILRMVDSFSV 446

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 71  VTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSSVAEFVPQKV 130
           V   +G++N +    E K ++D+ K + K  N+RY+ +  K+D  R K SS   ++ ++ 
Sbjct: 129 VNSKTGKVNIQD---EKKLVNDLAKNLTKTANKRYMVTKKKLD-ARSKDSSAEGYINERN 184

Query: 131 VHYKLEELPFKSKSGRTQ 148
            H+  E+L  +S+ G  Q
Sbjct: 185 KHFN-EKLDRESRYGEEQ 201

>ACR047C Chr3 complement(443876..444514) [639 bp, 212 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL142W
           (MRP8)
          Length = 212

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASKANP---LTRLTMQDPGDANDTADLSF-----DG 228
           VQ +GEL G +    ERS RR++ ++K+     L  L   D G+  D  D  F     D 
Sbjct: 71  VQLVGELQGQLDTMEERSVRRLVNSTKSEEKDFLAPLPNAD-GEIPDVKDGVFPLTLGDF 129

Query: 229 KAMNRSDIFKIVDSFSLLP 247
           ++++   ++K+   + LLP
Sbjct: 130 ESLDNVKLYKLAKFYELLP 148

>SAKL0G11550g Chr7 (986891..987544) [654 bp, 217 aa] {ON} similar to
           uniprot|P35719 Saccharomyces cerevisiae YKL142W
          Length = 217

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASKAN------PLTRLTMQDPGDANDTADLSF-DGK 229
           VQ +GEL G +    ERS RR++ ++K +      PL     + P  ++     S  D +
Sbjct: 76  VQLVGELQGQLDTIEERSVRRLVNSTKVDAKDFLAPLPNADGEIPAISDGVFPRSLQDFE 135

Query: 230 AMNRSDIFKIVDSFSLLP 247
            ++ S +F++   + LLP
Sbjct: 136 KLDNSKLFRLSKFYELLP 153

>TPHA0N01010 Chr14 complement(216641..217276) [636 bp, 211 aa] {ON}
           Anc_5.248 YKL142W
          Length = 211

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASKANP 206
           +Q +GEL G +    +RS RRII ++K  P
Sbjct: 70  IQLVGELQGQLDNMEDRSIRRIINSTKTAP 99

>TDEL0E03780 Chr5 (712981..713625) [645 bp, 214 aa] {ON} Anc_5.248
           YKL142W
          Length = 214

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 164 KQPIGPAEDAKYQ-----VQALGELSGAVKKFTERSTRRIIRASKAN 205
           K  +   E A Y      VQ +GEL G ++   ERS RR++  SK +
Sbjct: 55  KSSVAQLESADYATNEDLVQLVGELQGQLETIEERSIRRLVNYSKTD 101

>KLTH0G07590g Chr7 (615156..615812) [657 bp, 218 aa] {ON} similar to
           uniprot|P35719 Saccharomyces cerevisiae YKL142W
          Length = 218

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASKAN------PLTRLTMQDPGDANDTADLSF-DGK 229
           VQ +GEL G +    ERS RR++ ++K+       PL     + P   +     S  D +
Sbjct: 77  VQLVGELQGQLDSIEERSIRRLVNSTKSEKRDYLAPLPNADGEIPSATDSIFPESLEDFE 136

Query: 230 AMNRSDIFKIVDSFSLLP 247
            +    +FK+   + LLP
Sbjct: 137 NITNVKLFKLAKYYELLP 154

>TBLA0C03070 Chr3 (739999..740664) [666 bp, 221 aa] {ON} Anc_5.248
           YKL142W
          Length = 221

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASK 203
           VQ +GEL G +    ERS RR++ ++K
Sbjct: 80  VQLVGELQGQLDTIEERSIRRVVNSTK 106

>Kwal_23.2860 s23 (45013..45666) [654 bp, 217 aa] {ON} YKL142W
           (MRP8) - mitochondrial ribosomal protein [contig 246]
           FULL
          Length = 217

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 177 VQALGELSGAVKKFTERSTRRIIRASKA 204
           VQ +GEL G +    ERS RR++ ++K 
Sbjct: 76  VQLVGELQGQLDSIEERSVRRLVNSTKV 103

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
           IRC20Putative helicase; localizes to the mitochondrion
           and the nucleus; YLR247C is not an essential gene; null
           mutant displays increased levels of spontaneous Rad52p
           foci
          Length = 1556

 Score = 30.8 bits (68), Expect = 5.1,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 112 IDYKRGKSSSVAEFVPQKVVHYKLEELPFKSKSGRTQLIKD 152
           ++Y + + S +  F+PQ +   K+  LPF+ +S    LIK+
Sbjct: 266 LEYSKDRLSKIKPFLPQSIPDLKVNLLPFQRESVEWMLIKE 306

>ZYRO0D06490g Chr4 (560165..561019) [855 bp, 284 aa] {ON} similar to
           uniprot|Q12107 Saccharomyces cerevisiae YLR102C APC9
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 284

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 127 PQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGE 182
           P  ++ + LE+ P  S  G+ +L  D +L + E+   K+P  PAE+A+Y  +   E
Sbjct: 78  PSTLLIHHLEQAPVSS--GKEELEIDTVLDENEL--SKEPSLPAEEAEYDYKPFSE 129

>TDEL0E02460 Chr5 complement(476921..477916) [996 bp, 331 aa] {ON}
           Anc_5.381 YHR085W
          Length = 331

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 14/98 (14%)

Query: 152 DIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKFT----ERSTRRIIRASKANPL 207
           D     + +  + Q +GP  D   ++Q L   +  VKK T    ++   RII  S   PL
Sbjct: 33  DTSFVSKTISIRNQHLGPETDLTKRIQLLKHHNSTVKKETLQAFQKMVPRIINTSIMTPL 92

Query: 208 TRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVDSFSL 245
                      N    L  D     RS + ++VD   L
Sbjct: 93  ----------LNQCIPLICDDSRQVRSSLIELVDEIGL 120

>KLLA0F10417g Chr6 (961004..962527) [1524 bp, 507 aa] {ON} similar
           to uniprot|P38140 Saccharomyces cerevisiae YBR239C
           Hypothetical ORF
          Length = 507

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 68/161 (42%), Gaps = 26/161 (16%)

Query: 53  LRRSQVVDGGKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAK---AGNQRYLASP 109
           +R+S   + GK +P T+  T+S+GQ+  RP+++ +   +D+E  +      G+  +   P
Sbjct: 97  IRQSAPANNGKNNPETQQ-TLSNGQITHRPKFLSSA--ADLEYSILSDIIHGDSLFNKIP 153

Query: 110 CKIDY-----KRGKSSSVAEFVPQKVVHYKLE--ELPFKSKSGRTQLI---------KDI 153
               Y     K     +      Q+ +H+ L+    P     G T+ I          +I
Sbjct: 154 VNFLYSNPTEKTPSPINQGSLNGQQDLHFSLQLRSKPMNQIRGNTRAIYSNLLGPVSHEI 213

Query: 154 ILAQQEVYFKKQPIGPAED----AKYQVQALGELSGAVKKF 190
           + ++  +Y    P+ P E       ++   +G LS  + KF
Sbjct: 214 LQSEFNLYTNHFPLQPQESLDGTLDFKRMTIGTLSPHLTKF 254

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,554,363
Number of extensions: 1054245
Number of successful extensions: 2746
Number of sequences better than 10.0: 53
Number of HSP's gapped: 2839
Number of HSP's successfully gapped: 53
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)