Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102098.851ON84844171e-54
SAKL0D01144g8.851ON84843433e-43
KLTH0C03630g8.851ON84843276e-41
AFR450C8.851ON84843215e-40
TDEL0B002008.851ON86833191e-39
ZYRO0C14894g8.851ON84843163e-39
YMR286W (MRPL33)8.851ON86833085e-38
Suva_13.4768.851ON83833051e-37
NCAS0B002608.851ON88833042e-37
Ecym_46248.851ON84843042e-37
TPHA0I003308.851ON88833034e-37
NDAI0E002508.851ON93833001e-36
Skud_13.4598.851ON83832991e-36
CAGL0I02706g8.851ON89832931e-35
KLLA0C06270g8.851ON84842894e-35
Kpol_237.28.851ON86842852e-34
Smik_13.5028.851ON84832703e-32
KAFR0A028708.851ON85842592e-30
KNAG0G034808.851ON84812531e-29
TBLA0B029108.851ON85832513e-29
Skud_13.4755.20ON69145612.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10209
         (84 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   165   1e-54
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   136   3e-43
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   130   6e-41
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   128   5e-40
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   127   1e-39
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   126   3e-39
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   123   5e-38
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   122   1e-37
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   121   2e-37
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   121   2e-37
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   121   4e-37
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   120   1e-36
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   119   1e-36
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   117   1e-35
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   115   4e-35
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   114   2e-34
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   108   3e-32
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...   104   2e-30
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   102   1e-29
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...   101   3e-29
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...    28   2.7  

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  165 bits (417), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          QALSKEQQRELRKSNPGFIVEKRL
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKRL 84

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  136 bits (343), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/84 (78%), Positives = 75/84 (89%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL RSTIGLPKA K +V SLGLGK GS VYR+V+PSIAGSI KIKE+V ++V E
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          +ALSKE+QRELRKSNPGF+VEKRL
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKRL 84

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  130 bits (327), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/84 (85%), Positives = 79/84 (94%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL+RSTIGLPKA K VVSSLGLGKTGSVVYRQV+PSIAGSIAK+KEVV+V+V E
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
           AL+KEQQRELRKSNPGF VEKR+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  128 bits (321), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (84%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL RSTIGLP  VK VV SLGLGK G+ VYR+VSP  AGSIAKIKE+VKV+V E
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
           AL+KE+QR LRKSNPGF VEKR+
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKRV 84

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  127 bits (319), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          M FYKITL RS IG P   K +V SLGLGKTGS+VY+QV+P+ AG++AK+KE+VKV+V E
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            LSKE+QRELRKSNPGFIVEKR
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKR 83

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  126 bits (316), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (85%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYK+TL+RS IG+P  V++VV SLGLGK GS VYR+V+P  AGS+AK+KE+V V+V +
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
           AL+KEQQRELRKSNPGF VEKR+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  123 bits (308), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 71/83 (85%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYK+TL+RS IG+P   K +V SLGLGK GS+VY++V+P+IAGS+AK+KE+VKV+V E
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            L+  QQRELRKSNPGFIVEKR
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  122 bits (305), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 70/83 (84%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL+RS IG+P   K VV SLGLGK GS+VY++V+P+IAGS+AK+KE+V V+V E
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            L+  QQRELRKSNPGF+VEKR
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  121 bits (304), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 73/83 (87%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MV+YKITL RS IGLP+A +D+V +LGLGK GSV+YRQV+P+IAGS+ K+KE++ V+V +
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
           +L+K +QR+LRKSNPGF+VEKR
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKR 83

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  121 bits (304), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 71/84 (84%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKI L+RSTIG+P   + VV SLGLGK GSVVY  VSP++AG+IAK+KE+V V+V +
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          +ALSKE+QR+LR SNPG+ VEKRL
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKRL 84

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  121 bits (303), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL RS IG P  +K+VV ++GLGK GSVVYR+ +P++AG++A +KE+VKV+V E
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            LSKEQQRELRKSNPGF V+KR
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKR 83

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 72/83 (86%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL RS IGLPK  + +V ++GLGK GS+VYR+V+P++AGS+AK+KE++ V++ E
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
          +AL+K +QRELRKSNPGF +EKR
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKR 83

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  119 bits (299), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 68/83 (81%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYKITL RS IG+P   K +V SLGLGK GS+ Y++V+P+IAGS+AK+KE++ ++V E
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            L+  QQRELRKSNPGF+VEKR
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 71/83 (85%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          M +YK+TL RS IG P+A +++V ++GLGK GSVVYR+VSPS+AGS+AKIKE++ VDV +
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            L+K+QQRELRK+NPGF VEK+
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQ 83

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFY+ITL RS IG P+  + VV SLGLGK GSV Y+  +PSIAG++A+IKE+V V++A+
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          +ALSK +QRELRKSNPGF VEKR+
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKRV 84

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 72/84 (85%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          M FYKITLTRS IGLP+A +++V ++GLGK GS+VYR+V+PSIAGS+AK+KE+V V++++
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          + L++E+    RKSNPGF VEKR+
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKRV 84

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  108 bits (270), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          M FYKI L RS IG+P   K +V SLGLGK GS+VY++V+P+IAGS+AK+KE+V V V +
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 QALSKEQQRELRKSNPGFIVEKR 83
            L+  QQR LR SNPGF+VEKR
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKR 83

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 67/84 (79%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MV+Y+ TL RS IGLPK  + +V +LG  K GS +YR+V+P+I GS+ K+KE++ + + E
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 QALSKEQQRELRKSNPGFIVEKRL 84
          ++++K +QRE+RKSNPG+IVEKR+
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKRI 84

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  102 bits (253), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 45/81 (55%), Positives = 65/81 (80%)

Query: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60
          MVFYK+TL RS IG+P+A + +V +LGLGK GS VY++ +P+IAGS+ K+KE++ V+V+ 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 QALSKEQQRELRKSNPGFIVE 81
          Q +SK + R  RKSNPG++VE
Sbjct: 61 QKVSKGEMRLARKSNPGYVVE 81

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 67/83 (80%)

Query: 2  VFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAEQ 61
          +FYKITL RS IGLP+  + +V SLGLGK GS+ Y+++SPS AG+I ++KE+V V++ ++
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 62 ALSKEQQRELRKSNPGFIVEKRL 84
          AL+K +  + R+SNPGFI+EKR+
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKRV 83

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 25/45 (55%)

Query: 5   KITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAK 49
            IT    T+ LP A+   + S G+ + GSV++ ++  ++   +A+
Sbjct: 141 NITWDDPTVALPAAIGLTIISYGVARFGSVLFGELRNAVFAKVAQ 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,399,949
Number of extensions: 229389
Number of successful extensions: 704
Number of sequences better than 10.0: 22
Number of HSP's gapped: 704
Number of HSP's successfully gapped: 22
Length of query: 84
Length of database: 53,481,399
Length adjustment: 56
Effective length of query: 28
Effective length of database: 47,060,103
Effective search space: 1317682884
Effective search space used: 1317682884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)