Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102048.850ON49449423770.0
KLTH0C03608g8.850ON49549519890.0
SAKL0D01166g8.850ON50545517300.0
ZYRO0C14872g8.850ON49645516160.0
TBLA0B029008.850ON52045615850.0
KAFR0L019608.850ON51145815600.0
Suva_13.4758.850ON51545915580.0
TDEL0B001908.850ON49245415420.0
NCAS0C003108.850ON55643215470.0
Smik_13.5018.850ON51545915410.0
YMR285C (NGL2)8.850ON51545915370.0
Skud_13.4588.850ON51445915350.0
Kpol_237.18.850ON50345715210.0
CAGL0I02684g8.850ON49343115040.0
TPHA0I003208.850ON52943414870.0
KLLA0C06248g8.850ON51645714830.0
NDAI0K003708.850ON56842614840.0
ABL118W8.850ON50442014760.0
KNAG0K006508.850ON48244114100.0
Ecym_46198.850ON48742313970.0
NDAI0E002608.850ON49844611421e-152
NCAS0B002708.850ON47643511011e-146
TBLA0D033008.850ON48043910501e-138
YML118W (NGL3)8.850ON5054449821e-128
Skud_13.238.850ON4984449431e-122
Smik_13.168.850ON5024489361e-121
CAGL0B02387g8.850ON4714429141e-118
Suva_13.258.850ON5024399161e-118
KAFR0A028608.850ON4784458891e-114
KNAG0G034708.850ON4664358871e-114
KNAG0D048407.78ON7792331964e-15
ACR288W7.78ON7362241893e-14
SAKL0B10032g7.78ON7312381874e-14
Ecym_73547.78ON7852241867e-14
Suva_1.457.78ON8312221841e-13
KAFR0K006707.78ON7952171832e-13
KLTH0D02310g7.78ON7392291794e-13
NDAI0H025207.78ON8982171787e-13
Skud_1.407.78ON8692231778e-13
Kwal_26.71127.78ON7422371742e-12
ZYRO0D05302g7.78ON8572371752e-12
KLLA0F15884g7.78ON7902261723e-12
Kpol_1040.147.78ON7842441724e-12
YAL021C (CCR4)7.78ON8372261698e-12
TDEL0H037307.78ON7972451698e-12
CAGL0H06149g7.78ON8732221699e-12
Smik_1.457.78ON8392231662e-11
TPHA0H026807.78ON8722561582e-10
NCAS0F016407.78ON8552621582e-10
TBLA0A046607.78ON8962251572e-10
ACR277C7.90ON3782581213e-06
Kpol_1044.67.90ON372801161e-05
NDAI0A085307.90ON3652511133e-05
Kwal_26.71707.90ON3722411124e-05
KAFR0D012507.90ON3562341115e-05
TPHA0L005307.90ON3912471098e-05
KLLA0F07733g7.90ON3712351098e-05
KLTH0D02574g7.90ON3682591098e-05
KNAG0L005507.90ON3812341071e-04
CAGL0F01001g7.90ON3592781043e-04
Ecym_26367.90ON3672181043e-04
TDEL0H036007.90ON3662421043e-04
TBLA0E022607.90ON3882381043e-04
SAKL0B09768g7.90ON3682381044e-04
NCAS0I005007.90ON3892341026e-04
Smik_15.1257.90ON3632341000.001
Suva_15.1277.90ON363234990.001
YOL042W (NGL1)7.90ON36377990.002
Skud_15.1157.90ON363234960.003
ZYRO0D05588g7.90ON356245910.015
SAKL0H09130g8.580ON40298751.2
Suva_9.189na 1ON10763701.4
SAKL0E09768g2.201ON144865714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10204
         (494 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   920   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   770   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   671   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   627   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   615   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   605   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   604   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   598   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      600   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   598   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   596   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   595   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   590   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   583   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   577   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   575   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   576   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   573   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   547   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   542   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   444   e-152
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      428   e-146
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   409   e-138
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   382   e-128
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   367   e-122
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   365   e-121
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   356   e-118
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   357   e-118
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   347   e-114
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   346   e-114
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    80   4e-15
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    77   3e-14
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    77   4e-14
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    76   7e-14
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    75   1e-13
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    75   2e-13
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    74   4e-13
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      73   7e-13
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    73   8e-13
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    72   2e-12
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    72   2e-12
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    71   3e-12
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    71   4e-12
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    70   8e-12
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    70   8e-12
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    70   9e-12
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    69   2e-11
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    65   2e-10
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      65   2e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    65   2e-10
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    51   3e-06
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    49   1e-05
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    48   3e-05
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    48   4e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    47   5e-05
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    47   8e-05
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    47   8e-05
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    47   8e-05
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    46   1e-04
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    45   3e-04
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    45   3e-04
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    45   3e-04
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    45   3e-04
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    45   4e-04
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    44   6e-04
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    43   0.001
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    43   0.001
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    43   0.002
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    42   0.003
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    40   0.015
SAKL0H09130g Chr8 (778200..779408) [1209 bp, 402 aa] {ON} simila...    33   1.2  
Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}...    32   1.4  
SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] ...    32   4.7  

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/494 (90%), Positives = 446/494 (90%)

Query: 1   MEEEKLAQVINEQIENDKQRHAGEXXXXXXXXXXXXXXXXPEHIXXXXXXXXXXXXXXXX 60
           MEEEKLAQVINEQIENDKQRHAGE                PEHI                
Sbjct: 1   MEEEKLAQVINEQIENDKQRHAGESSTKSKKKGKKPSKVSPEHIAEVRAKREAAKKAKRE 60

Query: 61  XXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120
                GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA
Sbjct: 61  EMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120

Query: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180
           LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA
Sbjct: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180

Query: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240
           IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL
Sbjct: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240

Query: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPF 300
           VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPF
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPF 300

Query: 301 DTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVP 360
           DTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR           NIEKFGDGQPEHPVP
Sbjct: 301 DTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPVP 360

Query: 361 DTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAET 420
           DTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAET
Sbjct: 361 DTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAET 420

Query: 421 WRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYG 480
           WRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYG
Sbjct: 421 WRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYG 480

Query: 481 SDHLSLMCEIELNL 494
           SDHLSLMCEIELNL
Sbjct: 481 SDHLSLMCEIELNL 494

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/495 (72%), Positives = 404/495 (81%), Gaps = 1/495 (0%)

Query: 1   MEEEKLAQVINEQIENDKQRHAGEXXXXXXXXXXXXXXXXPEHIXXXXXXXXXXXXXXXX 60
           MEEE+LA  +N QI+ DK+RH+GE                PEHI                
Sbjct: 1   MEEERLADKVNTQIKQDKERHSGEKGHKSKKKGEKPPKVSPEHIAEVRAQREAAKKKKRE 60

Query: 61  XXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120
                GLDP+FPPDLQFI RPML L+ + +  GFVFK+MTYNCLAQALIRRKLFPTSGNA
Sbjct: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120

Query: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180
           LKWFKRSRVLLNEFMHY +DV CLQE+DYIQYQSFWKEEF KLGY+SQFHRHGTKNHGIA
Sbjct: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180

Query: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240
           IVWKRD+FTMVDKML+DYDKEPSG+L+PRTTTKNVGL +AL F+KKVL KYPG+SKRGI+
Sbjct: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240

Query: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD-GSSPEKKWYPFFCGDFNAQP 299
           VGTTHLFWHPFGTFERTRQCYV+LNKMK+F+HR+NVLQD G++ E  WYPFFCGDFN+QP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300

Query: 300 FDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPV 359
           FDTPYLS+SSKPV YK RAKTVIECSTSYTFSKAR           NIEKFGDGQPEHPV
Sbjct: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPV 360

Query: 360 PDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAE 419
           P+ + A  EQK LV++MA LHNSLDMR IS+YSV YKHVH ENAG DN  NEPEISNWAE
Sbjct: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420

Query: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479
           TWRGLLDYIFFIK+W+F+D   PEEL+ F+ EN +KI  LLRMPP++EMPNHGQPHEGEY
Sbjct: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480

Query: 480 GSDHLSLMCEIELNL 494
           GSDHLS+MCE+EL +
Sbjct: 481 GSDHLSMMCELELKI 495

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/455 (69%), Positives = 353/455 (77%), Gaps = 1/455 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     GLDP  PPDLQFI RP+L L      +GF FKIMT
Sbjct: 51  PEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMT 110

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YN LAQALIRRKLFP+SGNA+KWFKRS+VLLNEF HY ADVHCLQEID+IQYQ+FWKEEF
Sbjct: 111 YNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEF 170

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGY SQFHR GTKNHG+AIVW+  LFTMVD MLVDYDKEPSG + PRTTTKN GL+LA
Sbjct: 171 QKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILA 230

Query: 221 LAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDG 280
           L F+ KVL+++PGT K GIL+GTTHLFWHPFGTFERTRQCYV+LNKMK+ IHRVNVLQ+ 
Sbjct: 231 LKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNN 290

Query: 281 SSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXX 339
              +   WYPF CGDFN+QPFDTPYLSM+SKPV Y+ RAKTVIECSTS+TFSK R     
Sbjct: 291 QDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEG 350

Query: 340 XXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVH 399
                 NIEKFG GQPEHPVP  + A  EQ  LV+ M  LHNSLDMRAIS+Y+V YKHVH
Sbjct: 351 EDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVH 410

Query: 400 PENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSL 459
           PENAG DN   EPEISNWAETWRGLLDYIFF+K WN TD    +++  FE+EN +KI  L
Sbjct: 411 PENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGL 470

Query: 460 LRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
           LRMPP EEM  HGQPHEGEY SDHLS+MCEIELN+
Sbjct: 471 LRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIELNV 505

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/455 (64%), Positives = 349/455 (76%), Gaps = 4/455 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+FPP+LQFI RP+LPL    + EGF FK+MT
Sbjct: 41  PEHIAKVRAEREAARAAKKEAMMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMT 100

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFPTSG+ALKW++RS+VLLNEF +Y ADV CLQEIDYIQYQSFWK+E 
Sbjct: 101 YNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDEL 160

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGYDSQFHR  +KNHG+AIVWKR+ F M DKML+D+D+E SG + PRTTT N GL+L+
Sbjct: 161 AKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILS 220

Query: 221 LAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDG 280
           L FS KV  ++    K GI+VGTTHLFWHPFGTFERTRQCYV+LNK+K+F HRVNVLQ+G
Sbjct: 221 LKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNG 279

Query: 281 SSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR--XXX 337
           +  +   WYPFFCGDFN+QPFD+PYLSM+ KP+ Y  RAKTVIECSTSYTFSK R     
Sbjct: 280 NDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEED 339

Query: 338 XXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKH 397
                   NIEKFG  QP+HPVP  YEA   ++ELV+ M  LHNSLDMRA+S+YSVAY+ 
Sbjct: 340 DAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRK 399

Query: 398 VHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKIL 457
           VHPENAG DN   EPEISNWA TWRGLLDY+FFI+ W+F+D K  + L++FE+EN +KI 
Sbjct: 400 VHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIR 459

Query: 458 SLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492
            LLR+PP +EM  HGQPH GEY SDHL ++CE+EL
Sbjct: 460 GLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 346/456 (75%), Gaps = 2/456 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+ P +LQFI RP+L +  N   +GF F +MT
Sbjct: 65  PEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMT 124

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP  G+ALKW +RS+VLLNEF HY  D+ CLQEID++QYQSFWKEEF
Sbjct: 125 YNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEF 184

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGY+ QF++  +KNHG+++VWK++LF M D+MLVDYDKE SG ++PRTTT N+ L+L+
Sbjct: 185 SKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLS 244

Query: 221 LAFSKKVLDKYP-GTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD 279
           L FSKKV +++P   +K GIL+GTTHLFWHPFGT+ERTRQCY++LNKMK+FI RVN+LQ+
Sbjct: 245 LKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQN 304

Query: 280 -GSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXX 338
            G      WYPFFCGDFN+QPFD+PYLSM+SKP+ Y  R+KTVIECSTS+ FSK R    
Sbjct: 305 NGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRDGEE 364

Query: 339 XXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHV 398
                  NIEKFG  QP+HPVPD Y+A  EQK LV  M ELHNSLDMRAIS+YS  Y  V
Sbjct: 365 GDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKV 424

Query: 399 HPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILS 458
           HPEN+G DN  NEPEISNWA  WRGLLDY+F+IK W+FT NK  + L+ FE+END+KI  
Sbjct: 425 HPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRG 484

Query: 459 LLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
            LRMPP++E+P+HGQP EGEY SDHL ++CE+EL L
Sbjct: 485 YLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/458 (63%), Positives = 343/458 (74%), Gaps = 4/458 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     GLDP+ PP+LQFI RP+L L    S  GF FKIMT
Sbjct: 54  PEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMT 113

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG A+KWF+RS+VLLNEF +Y +DV CLQE+D IQ+Q+FWKEEF
Sbjct: 114 YNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEF 173

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGYDSQFH   +KNHGI+I+WKR LFTM DKML+DYDKE SG++ PRTTT NVGLVLA
Sbjct: 174 DKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLA 233

Query: 221 LAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDG 280
           L FS KVL+++P T K GI+VGTTHLFWHPFGT+ERTRQCY++LNK K+F+HRVNVLQ+ 
Sbjct: 234 LKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNN 293

Query: 281 SSPEKK-WYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-XXXX 338
           +   K  WY FF GDFN+QPFDTPYLSM+SKPV Y +RAKTVIECSTSYTFSK+R     
Sbjct: 294 NDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEED 353

Query: 339 XXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHV 398
                  NIEKFG  QP  PVP  ++A+ EQ+ LV  M +LHNSLDMRAIS+YSV Y  V
Sbjct: 354 AEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTV 413

Query: 399 HPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILS 458
           H ENAG DNT  EPEISNWA  W GLLDY+F IK W+F+D  + + L+ FE EN++K+ +
Sbjct: 414 HIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKA 473

Query: 459 LLRMPPSEEMP--NHGQPHEGEYGSDHLSLMCEIELNL 494
            L+MP   EM    HGQPH GEY SDHLS++C++EL L
Sbjct: 474 FLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLELKL 511

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/459 (62%), Positives = 342/459 (74%), Gaps = 5/459 (1%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+ PP+L FI RP L L       GF FK+MT
Sbjct: 57  PEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMT 116

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG+ALKW++RSRVLLNEF HY ADV CLQEID+IQ+QSFWKEEF
Sbjct: 117 YNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEF 176

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGY+ Q+HR+ TKNHG+AI+W+RD+F  VDKML+D+DKE SG++  RTTT NVGLVLA
Sbjct: 177 SKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLA 236

Query: 221 LAFSKKVLDKYPGTS--KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278
           L FS+KVL      S  K GIL+GT+HLFWHPFGT+ERTRQCY++L KM++F+HRVNVLQ
Sbjct: 237 LKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQ 296

Query: 279 DGSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-XX 336
           + +  +   W+PFFCGDFN+QPFDTPYLSM+ KPV Y+ RAKTVIECSTS+ FSK R   
Sbjct: 297 NENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGE 356

Query: 337 XXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396
                    NIEKFG  QPE PVP  + A  EQ ELV  MA+LHNSLDMRA+S+YSVAYK
Sbjct: 357 EGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYK 416

Query: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDN-KRPEELQTFEKENDVK 455
           +VHPENAG DN   EPEISNWA TWRGLLDY+F+IK+W+   N +  + L  FEK+N++K
Sbjct: 417 NVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIK 476

Query: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
               LRMPP  EM  HGQPH GEY SDHLS++C+IEL L
Sbjct: 477 FRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 335/454 (73%), Gaps = 2/454 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEH+                     G+DP+ PP+LQFI RP+L L  +   EG  FK++T
Sbjct: 37  PEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLT 96

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG++LKWF+RS+VL  EF HY ADV CLQEIDYIQYQ FWK+E 
Sbjct: 97  YNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDEL 156

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGYD+QF++   KNHG++I WKR LF + D+ML+DYDKE SG ++ RT T N GL+LA
Sbjct: 157 DKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILA 216

Query: 221 LAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDG 280
           L F+       P   K GILVGT+HLFWHPFGT+ERTRQCYV+L KMK+F+ RVNVLQ+ 
Sbjct: 217 LKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNN 276

Query: 281 SSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX-XXX 338
           +      W PFFCGDFN+QPFDTPYLSM+SKPV Y  RAKTV+ECSTSYTFSK R     
Sbjct: 277 NDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRNGEED 336

Query: 339 XXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHV 398
                  NIEKFG  QP+ PVP+T++A PEQ++LV+ M ELHNS+DMRAIS+Y+V Y  V
Sbjct: 337 AEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEV 396

Query: 399 HPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILS 458
           HPEN+G DN   EPE+SNWA TWRGLLDYI  I QW+ +D K+ + L+TFEKEN +K+  
Sbjct: 397 HPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRG 456

Query: 459 LLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492
           LLRMPP+ EM +HGQPHEGEY SDHLS+MC IEL
Sbjct: 457 LLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/432 (66%), Positives = 334/432 (77%), Gaps = 5/432 (1%)

Query: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFK 125
           GLDP   PDLQFI RP+L L       GF   IMTYNCLAQALIRRKLFP SG+ALKWFK
Sbjct: 124 GLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWFK 183

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKR 185
           RS+VL NEF HY  DV CLQEID++QYQSFWK EF K+GY+SQFHR  +KNHG+AI+W++
Sbjct: 184 RSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRK 243

Query: 186 DLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYP-GTSKRGILVGTT 244
           +LFT+ DKML+D+DKEPSG + PRTTT N GL L+L F++K L K+  GTS+ GI+VGTT
Sbjct: 244 ELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTT 303

Query: 245 HLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKK-WYPFFCGDFNAQPFDTP 303
           HLFWHPFGT+ERTRQCYV+LNKMK+F+HR+NVLQ+ +  +   WYPFFCGDFN+QPFDTP
Sbjct: 304 HLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTP 363

Query: 304 YLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEHPVPDT 362
           YLSM+SKP+ YK RAKTVIECSTSY FSK R            NIEKFG  QP+ PVPD 
Sbjct: 364 YLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPVPDH 423

Query: 363 YEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWR 422
           + A  EQK+LV+ M  LHNSLDMRAIS+Y V Y+ VHPENAG DN   EPEISNWA TW 
Sbjct: 424 FIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWN 483

Query: 423 GLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMP--NHGQPHEGEYG 480
           GLLDYI FIK W F D +  + L+ FEKEN +K+   LRMPPS EM    HGQPH GEY 
Sbjct: 484 GLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYP 543

Query: 481 SDHLSLMCEIEL 492
           SDHLS++CE+EL
Sbjct: 544 SDHLSMICELEL 555

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/459 (62%), Positives = 346/459 (75%), Gaps = 5/459 (1%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+ PP+L FI RP L L       GF FK+MT
Sbjct: 57  PEHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMT 116

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG+ALKW++RSRVLLNEF +YKADV CLQEID+IQ+QSFWK+EF
Sbjct: 117 YNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEF 176

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGYD Q++R+ TKNHG+AI+W+R++F  VDKML+DYDKE S ++  RTTT NVGLVLA
Sbjct: 177 NKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLA 236

Query: 221 LAFSKKVLDKYPGTSKR--GILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278
           L FS+KVL     +S +  GIL+GTTHLFWHPFGT+ERTRQCYV+L KMK+F+HRVNVLQ
Sbjct: 237 LKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQ 296

Query: 279 DGSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX-X 336
           + +  +   W+PFFCGDFN+QPFDTPYLSM+SKPV YK+RAKTVIECSTS+ FSKAR   
Sbjct: 297 NENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGD 356

Query: 337 XXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396
                    NIEK+G  QPE PVP+ Y A  EQ ELV  MA+LHNSLDMRAIS+YSV Y+
Sbjct: 357 ESADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYR 416

Query: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDN-KRPEELQTFEKENDVK 455
           +VHPENAG DN   EPEISNWA TWRGLLDY+F++K+W+   N +  E L  FEK N++K
Sbjct: 417 NVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMK 476

Query: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
               LRMPP +EM  HGQPH GEY SDHLS++C++EL L
Sbjct: 477 CRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLELEL 515

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/459 (62%), Positives = 341/459 (74%), Gaps = 5/459 (1%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+ PP+L FI RP L L       GF FK+MT
Sbjct: 57  PEHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMT 116

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG+ALKW++RS+VLLNEF +Y +DV CLQEID+IQ+QSFWK+EF
Sbjct: 117 YNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEF 176

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGYD Q++R+ TKNHG+AI+W+R+LF  VDKML+DYDKE S S+  RTTT NVGLVLA
Sbjct: 177 SKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLA 236

Query: 221 LAFSKKVLDKYPGTSKR--GILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278
           L FS+KVL      S +  GIL+GTTHLFWHPFGT+ERTRQCY++L KMK+F+HRVNVLQ
Sbjct: 237 LKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQ 296

Query: 279 DGSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX-X 336
           + +  +   W+PFFCGDFN+QPFDTPYLSM+SKPV Y++RAKTVI CSTSY FSK R   
Sbjct: 297 NENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGE 356

Query: 337 XXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396
                    NIEK+G  QPE PVP+ + A  EQ ELV  MA+LHNSLDMRAIS+YSV YK
Sbjct: 357 EGADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYK 416

Query: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDN-KRPEELQTFEKENDVK 455
           +VHPENAG DN   EPEISNWA TWRGLLDY+F++K+W+   N +  E L  FEKEN VK
Sbjct: 417 NVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVK 476

Query: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
               LRMPP  EM  HGQPH GEY SDHLS++C++EL L
Sbjct: 477 CRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLELQL 515

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/459 (62%), Positives = 341/459 (74%), Gaps = 5/459 (1%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PEHI                     G+DP+ PP+L FI RP+L L       GF FK+MT
Sbjct: 56  PEHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMT 115

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG+ALKWF+RS+VLLNEF +Y ADV CLQE+D+IQ+QSFWK +F
Sbjct: 116 YNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKF 175

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            K+GYD Q+HR+ TKNHG+AI+W+R +F  VDKML+DYDKE SGS+  RTTT NVGLVLA
Sbjct: 176 NKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLA 235

Query: 221 LAFSKKVLDKYPGTSKR--GILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278
           L FSK+VL K    S +  GIL+GTTHLFWHPFGT+ERTRQCYV+L KMK+F+HRVNVLQ
Sbjct: 236 LKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQ 295

Query: 279 -DGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX-X 336
            D       W+PFFCGDFN+QPFDTPYLSM+SKPV YK RAKTVIECSTS+ FSK R   
Sbjct: 296 NDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGE 355

Query: 337 XXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396
                    NIEKFG  QPE PVP+ + A  EQ E+V  M +LHNSLDMRAIS+YSV YK
Sbjct: 356 EGADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYK 415

Query: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRP-EELQTFEKENDVK 455
            VHPENAG DN   EPEISNWA TWRGLLDY+F+IK+W+   N++  E L  FEK+N++K
Sbjct: 416 SVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIK 475

Query: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
               LRMPP+ EM  HGQPH GEY SDHLS++C++EL L
Sbjct: 476 CRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/457 (61%), Positives = 334/457 (73%), Gaps = 3/457 (0%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100
           PE I                     GLDP++PP+LQFI RPML L  +    GF F +MT
Sbjct: 47  PEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMT 106

Query: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160
           YNCLAQALIRRKLFP SG A+KWF+RS+VLL EF HY +DV CLQEID+IQYQ+FWK EF
Sbjct: 107 YNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEF 166

Query: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220
            KLGY+SQFHR  +KNHG+AIVWKR++F M D+ML+D+DKE S  + PRT T N GL+L+
Sbjct: 167 EKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILS 226

Query: 221 LAFSKKVLDKYPGTSK-RGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD 279
           L FS K+L   P  +K  GI++GTTHLFWHPFGT+ERTRQCYVLLNKMK+F+HRVNVLQ+
Sbjct: 227 LKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQN 286

Query: 280 GSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX-XX 337
           G+  +   W PFFCGDFN+QPFD+PYLSM+SKP+ Y +RAKTVI+CSTSY FSK R    
Sbjct: 287 GNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEE 346

Query: 338 XXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKH 397
                   NIEKFG  QP+ PVP+T+ A  EQ  LV+ MA +HN L MRA S+YSV YKH
Sbjct: 347 DVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKH 406

Query: 398 VHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKIL 457
           VH ENAG DNT  EP ISNWA TWRGLLDYIF +  W+F + +  + L+ FE EN +++ 
Sbjct: 407 VHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLR 466

Query: 458 SLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494
             LRMP   EMP HGQPHEGEY SDHLS++C IEL L
Sbjct: 467 GFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELLL 503

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/431 (64%), Positives = 323/431 (74%), Gaps = 4/431 (0%)

Query: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFK 125
           G+DP+ PP+LQFI R ML L      EG   KIM+YNCLAQALIRRKLFP SG ALKW++
Sbjct: 62  GVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYR 121

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKR 185
           RSRVLLNEF HY  DV CLQEIDYIQYQSFWKEEF KLGY SQFHR  +KNHG+ I+WK 
Sbjct: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKH 181

Query: 186 DLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKV--LDKYPGTSKRGILVGT 243
           + F M D+ML+D+D E SG ++PRTTT N  L+LAL F++KV  + K     K GILVGT
Sbjct: 182 EKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGT 241

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFDT 302
           THLFWHPFGT+ERTRQCYV+LNKMK+F+HRVNVLQ+ +  +   WYPFFCGDFN+QPFD+
Sbjct: 242 THLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDS 301

Query: 303 PYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXX-XXXXXXXXXNIEKFGDGQPEHPVPD 361
           PYLSM+ KP+ Y  RAKTVIECSTS+ FSK R            NIEKFG  QP+ PVP+
Sbjct: 302 PYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQPQTPVPE 361

Query: 362 TYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETW 421
            + A  EQ +LV  M ELHNSLDMRA+S+YSVAY  VHPEN+G DN   EPEISNWA TW
Sbjct: 362 KFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTW 421

Query: 422 RGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGS 481
           RGLLDY+F I+ W F D    + L+ FE  N++KI  LLRMPP  EM  HGQPH GEY S
Sbjct: 422 RGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPS 481

Query: 482 DHLSLMCEIEL 492
           DHL L+ E+EL
Sbjct: 482 DHLCLLSEVEL 492

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/434 (62%), Positives = 333/434 (76%), Gaps = 6/434 (1%)

Query: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFK 125
           GLDP+ PP+LQFI RP+L L  +   + F F +MTYNCLAQALIRRKLFP SG A+KW++
Sbjct: 95  GLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYR 154

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKR 185
           RSRVLLNEF +Y  D+ CLQEID+IQ+QSFW+EEF K+GY SQFHR  +KNHG+AIVWK 
Sbjct: 155 RSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKN 214

Query: 186 DLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYP---GTSKRGILVG 242
           +LF + D+ML+D+DKE SG + PRT T N GL+L+L +S  VL KYP     +K GI++G
Sbjct: 215 NLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIG 274

Query: 243 TTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFD 301
           TTHLFWHPFGT+ERTRQC+VLLNK+K+F  RVNVLQ+ +      W  FFCGDFN+QPFD
Sbjct: 275 TTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFD 334

Query: 302 TPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX--XXXXXXXXXXNIEKFGDGQPEHPV 359
           TPYLS++SKPV YK+RAK VIECSTSYT+SK R             NIEKFG  QP+ PV
Sbjct: 335 TPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPV 394

Query: 360 PDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAE 419
           PD+Y   PEQ +LV  M  LHNSL+M+A S+Y+V YK VHPEN+G DN   EPEISNWA 
Sbjct: 395 PDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAH 454

Query: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479
           +WRGLLDYIF++  W+F+D K  E+ + FEK+N +K+   LRMPP+ EM  +GQPH+GEY
Sbjct: 455 SWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEY 514

Query: 480 GSDHLSLMCEIELN 493
            SDHLS+MC+IELN
Sbjct: 515 PSDHLSMMCKIELN 528

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/457 (59%), Positives = 334/457 (73%), Gaps = 5/457 (1%)

Query: 41  PEHIXXXXXXXXXXXXXXXXXXXXXGLDPEFPPDLQFISRPML--PLDSN--YSPEGFVF 96
           PE+I                     G+DP+ P DL+FI RPML  P DS+   + E    
Sbjct: 58  PEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPI 117

Query: 97  KIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFW 156
            IMTYNCLAQALIRR LFPTSGNA+KWFKRS+VLLNEF +Y  DV CLQEID +QY+SFW
Sbjct: 118 SIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFW 177

Query: 157 KEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVG 216
           K EF KLGY  QFH + TKNHG+ I WK DLF M DKML+DYDKE +G+++PRTTTKNVG
Sbjct: 178 KMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVG 237

Query: 217 LVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNV 276
           ++L+L F KKVL+KYP T   GI++GTTHLFWHPFGT+ERTRQCY++L K+K+F +R+NV
Sbjct: 238 MLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINV 297

Query: 277 LQDGSSPEKK-WYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX 335
           LQ+    +   W  FFCGDFN+QPFD PYLS++SKPV Y  RAKTVIECSTS+TFSK R 
Sbjct: 298 LQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRD 357

Query: 336 XXXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAY 395
                     NIEKFG GQPE PVP+++    EQK+L + M  LHN +DMRAIS+YS+AY
Sbjct: 358 GDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAY 417

Query: 396 KHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVK 455
             VHPEN+G DN  NEPEISNWA  WRGLLDY++++  W+  D  + +EL TFE+   V+
Sbjct: 418 SKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQ 477

Query: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492
           +L LLR+PP++EM  HGQPHEGEY SDHL ++ ++ +
Sbjct: 478 VLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/426 (62%), Positives = 327/426 (76%), Gaps = 4/426 (0%)

Query: 71  FPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVL 130
            PP+LQFI RP+L L      +GF F +MTYNCLAQALIRRKLFP SG+ALKW++RS+VL
Sbjct: 142 IPPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVL 201

Query: 131 LNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTM 190
           LNEF +Y  D+ CLQE+D+IQYQSFWK EF KLGY SQ+HR G KNHG++I+W+R LFTM
Sbjct: 202 LNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTM 261

Query: 191 VDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPG--TSKRGILVGTTHLFW 248
            DKML+++DKE SG++ PRTTT NVGL+L+L F+ +   ++    T+K GI++GTTHLFW
Sbjct: 262 TDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFW 321

Query: 249 HPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFDTPYLSM 307
           HPFGT+ERTRQCYV+LNKMK+F+HRVNVLQ+ +  +   WYPFFCGDFN+QPFD+PYLSM
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 308 SSKPVVYKDRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEHPVPDTYEAA 366
             KPV Y  RAKTVIECSTSY FSK R            NIEKFG  QP+ PVP+ + A 
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIAN 441

Query: 367 PEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWRGLLD 426
            EQ  LV+ M +LHNSL+MRAIS+Y V YK+VHPENA  DN   EPEISNWA TW GLLD
Sbjct: 442 GEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLD 501

Query: 427 YIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSL 486
           Y+ F+K+W F+D  + E L+ FE+ N ++I   LRMPP+ EM  HGQPH GEY SDHLS+
Sbjct: 502 YLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSM 561

Query: 487 MCEIEL 492
           +C IEL
Sbjct: 562 LCSIEL 567

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/420 (60%), Positives = 328/420 (78%), Gaps = 2/420 (0%)

Query: 74  DLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNE 133
           D+ FI RP+L  + + + +GFVF++MTYNCLAQALIRRKLFPTSGNALKWFKRS+VLL+E
Sbjct: 84  DVGFIKRPLLVCNGDEA-KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 134 FMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDK 193
             +Y  DV CLQEID+ QY+SFW +     GY S+FHR   KNHGIAIVW+R LF  VD+
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 194 MLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGT 253
            L+D+D+E SG ++ RTTTKNVGL++AL ++ ++  +YPG+++ GI+VGT+HLFWHPFGT
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262

Query: 254 FERTRQCYVLLNKMKDFIHRVNVLQDGS-SPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312
           +ER RQCY++L++MK F+ R+ +L+ GS     +W+PFFCGDFN+QPFD PYLSM SKP+
Sbjct: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322

Query: 313 VYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKEL 372
           +Y+ RA+TVIECSTSY FS  R           NIEKFG GQPE PVPD+++  PEQ+ L
Sbjct: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRAL 382

Query: 373 VQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIK 432
           V  M  LHN+LDMRAIS+YS+AY++VHPENAG DN   EPEISNWA  WRGLLDYI ++ 
Sbjct: 383 VDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVM 442

Query: 433 QWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492
            W+F+DN   +++  F+K   V + SLLR+PP+ EMP+HGQPHEGEY SDHLSLMCE+EL
Sbjct: 443 PWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/441 (60%), Positives = 325/441 (73%), Gaps = 14/441 (3%)

Query: 66  GLDPEFPPDLQFISRPMLPL--DSNYSPEG--FVFKIMTYNCLAQALIRRKLFPTSGNAL 121
           G   + P +L+FI RPML +  D     EG      +MTYNCLAQALIRRKLFP SG AL
Sbjct: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPAL 103

Query: 122 KWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAI 181
           KW++RS+VLLN+F HY+ DV CLQE+D +Q+ SFW+ EF KLGY +QFH+  TKNHG+A+
Sbjct: 104 KWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAV 163

Query: 182 VWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILV 241
           VW+  LFTM DKML+D+DKE SG + PRTTT N GLV+AL F+++ L  +  T + GILV
Sbjct: 164 VWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILV 223

Query: 242 GTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ---DGSSPEKKWYPFFCGDFNAQ 298
           GTTHLFWHPFGTFERTRQCYV+LNKMK+F+HRVNVLQ   DG++  + W+PFFCGDFN+Q
Sbjct: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNN--QHWFPFFCGDFNSQ 281

Query: 299 PFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR---XXXXXXXXXXXNIEKFGDGQP 355
           P+D PYLSM+SKPV Y  RA+TVIECSTSYTFSK R              NIE FG  QP
Sbjct: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQP 341

Query: 356 EHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEIS 415
            HPVP T+E   EQ  LV  M  LHNSLDMRA+S+YSV Y++VHPENAG DN   EPEIS
Sbjct: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401

Query: 416 NWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMP--NHGQ 473
           NWA TW GLLDY+F++  W+F D    + L+ FE+++ V +  LLRMP  +EM    HGQ
Sbjct: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461

Query: 474 PHEGEYGSDHLSLMCEIELNL 494
           PH GEY SDHL+++C++EL L
Sbjct: 462 PHTGEYPSDHLAMVCDLELAL 482

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 316/423 (74%), Gaps = 5/423 (1%)

Query: 74  DLQFISRPMLPLDSNYSP-EGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132
           +L+FI+RPMLPL    +  +GF F +MTYNCLAQ+LIRR LFPTSG ALKW KRS VLL 
Sbjct: 68  NLEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLK 127

Query: 133 EFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVD 192
           EF HY ADV CLQEIDY QY SFW      LGY S+FHR   K+HG+AI WK+DLF  +D
Sbjct: 128 EFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMD 187

Query: 193 KMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFG 252
           +ML+++D E SG ++PR TT NVG++LAL FS KV   +PGT K GI+VGT+HLFWHPFG
Sbjct: 188 QMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWHPFG 247

Query: 253 TFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFDTPYLSMSSKP 311
           T+ERTRQCYV+LNKMK+FIHRV++ Q+    +  KWYPFFCGDFN+QPFD PYLS++SKP
Sbjct: 248 TYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKP 307

Query: 312 VVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVPDTYEAAPEQKE 371
           V+Y  RAKTVIECS +Y F                +   G+ +P  PVP++++   E   
Sbjct: 308 VLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTV---GEDRPVDPVPESFQPTAEVSS 364

Query: 372 LVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFI 431
           LVQ M +LHNSLDMRAIS+Y+VAYKHVHP+NAG DN   EPEISNWA TWRGLLDYI +I
Sbjct: 365 LVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMYI 424

Query: 432 KQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIE 491
             W  ++N   + L++FEK + + +  +LRMPP++EM +HGQPH+GEY SDHL++MC++E
Sbjct: 425 TPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKLE 484

Query: 492 LNL 494
           + +
Sbjct: 485 VEM 487

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 297/446 (66%), Gaps = 29/446 (6%)

Query: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFK 125
           G +P+ P +LQFI RP+L L  +   +G + KIMTYNCLAQ+LI+R LFP SG ALKW +
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKR 185
           RS+VLLNE  +Y +D+  LQEID++Q++ +WK    KLGYD +F++   K HG+ I WKR
Sbjct: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180

Query: 186 DLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTH 245
           +LF  V  + +D+D+  SG++KPRT TKNVGLV+AL F  K  DK     K+G+++GTTH
Sbjct: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK--DK-SAIKKKGVIIGTTH 237

Query: 246 LFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYL 305
           LFWH FGTFERTRQCYV++++M  F+ ++  ++       KWYPFF GDFN+QP D PY+
Sbjct: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIE-------KWYPFFTGDFNSQPKDAPYV 290

Query: 306 SMSSKPVVYKDRAKTVIECSTSYTFSKAR------------------XXXXXXXXXXXNI 347
           S++SKPV +++  K VIECS +Y +SK R                               
Sbjct: 291 SITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEEK 350

Query: 348 EKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDN 407
           E+    QP +  P  +    EQ ELV  +A LHNSL++RAIS+YSV Y+ V PENA  +N
Sbjct: 351 EEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINN 410

Query: 408 THNEPEISNWAETWRGLLDYIFFIKQWNF-TDNKRPEELQTFEKENDVKILSLLRMPPSE 466
              EPE+S WA  W GLLDYIFF++ W+  T++++ + L+TFE+EN+VK+  LL+MP S+
Sbjct: 411 DRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSK 470

Query: 467 EMPNHGQPHEGEYGSDHLSLMCEIEL 492
           EM  H  P++GEY SDHL +M ++EL
Sbjct: 471 EMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  428 bits (1101), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/435 (49%), Positives = 280/435 (64%), Gaps = 13/435 (2%)

Query: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEG---FVFKIMTYNCLAQALIRRKLFPTSGNALK 122
           GLDP+ PP+LQF  RP L L  N    G     F I+TYNCLAQ LI R +FP SGNALK
Sbjct: 45  GLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK 104

Query: 123 WFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIV 182
           W +RS+ ++NE  +Y  D+ CLQEID+   + FW  +F  LGY  +F +   K HG+ I 
Sbjct: 105 WTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIA 164

Query: 183 WKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG 242
           W+  +F   D+  VD+D+  +G + PRT T+N+GL++AL F     +  P     GI+V 
Sbjct: 165 WRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDNN-NNNPSRESHGIVVA 223

Query: 243 TTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDT 302
           TTHLFWHPFGTFERTRQCY++L++M  F+  +N      S    WYPF  GDFN+QP D 
Sbjct: 224 TTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN----EHSGITNWYPFLTGDFNSQPKDA 279

Query: 303 PYLSMSSKPVVYKDRAKTVIECSTSYTFSKARX----XXXXXXXXXXNIEKFGDGQPEHP 358
           PY+SM++KP+ Y D  +TVIECSTSYT+SK R                 E+F   QP  P
Sbjct: 280 PYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIKKQPTDP 339

Query: 359 VPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWA 418
            P  ++   EQ  LV T+ +LHNSL  RAIS+YSV Y++VHPEN+  +NT  EPE S+W 
Sbjct: 340 RPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWG 399

Query: 419 ETWRGLLDYIFFIKQWNFTD-NKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEG 477
             W GLLDYIF+IK WN  D N   E L+TFEK N +KIL  L++P  +EM +H QP+EG
Sbjct: 400 IHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEG 459

Query: 478 EYGSDHLSLMCEIEL 492
           EY SDHL+LMC+++L
Sbjct: 460 EYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  409 bits (1050), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 202/439 (46%), Positives = 284/439 (64%), Gaps = 17/439 (3%)

Query: 66  GLDPEFPPDLQFISRPML--PLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKW 123
           G DP+ P +L FI RP+L  P   + + +GF F +MTYNCLAQA+IRR++F  SG ALKW
Sbjct: 41  GEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKW 100

Query: 124 FKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF-GKLGYDSQFHRHGTKNHGIAIV 182
           F+RS+VL+NE  +Y  D+ CLQEID  QY++FWK++    L  ++ +++   K+HG+ I 
Sbjct: 101 FRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIA 160

Query: 183 WKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDK-YPG------TS 235
           WK+ +F  VD M+VD+D   + ++  RT T+N+ + +AL F+ + + K +P        +
Sbjct: 161 WKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQN 220

Query: 236 KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDF 295
             G ++ TTHLFWHPFGTFERTRQCY+LL KMK FI  +NV       +  WYPF CGDF
Sbjct: 221 DIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV---KDHLKTHWYPFICGDF 277

Query: 296 NAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQP 355
           N+ P D PYLSM+SKP+ Y  R K VIECST+Y FSK R             EK    QP
Sbjct: 278 NSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKLINQP 335

Query: 356 EHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEIS 415
           +  VPD++    EQ +LV  +  LHN L +RA S+Y +AYK V P N   +N   EPE +
Sbjct: 336 KDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFT 395

Query: 416 NWAETWRGLLDYIFFIKQWNFTD--NKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQ 473
           +WA++W G+LDYI ++  W+  +  ++  E L+ FEK N + I  LL+MP +++MP H Q
Sbjct: 396 SWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQ 455

Query: 474 PHEGEYGSDHLSLMCEIEL 492
           P E EY SDH+S++CE+E+
Sbjct: 456 PFEREYPSDHISILCEMEI 474

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 198/444 (44%), Positives = 274/444 (61%), Gaps = 33/444 (7%)

Query: 66  GLDPEFP-PDLQFISRPMLPLDSNYSP-----------EGFVFKIMTYNCLAQALIRRKL 113
           G DP+FP PDLQFI RP LP++ + S            +    KIMTYN LAQ LIRR  
Sbjct: 67  GKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDF 126

Query: 114 FPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHG 173
           FP SG ALKW KRS+VL++E   Y+ DV  LQE+DY +  +FW+E F KLG+D  F RH 
Sbjct: 127 FPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRHE 185

Query: 174 TKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGS-LKPRTTTKNVGLVLALAFSKKVLDKYP 232
            K HG+ + W    F + +  ++DYD   +G+ +  RT TKN+ L+++L F K + D   
Sbjct: 186 GKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-KGITD--- 241

Query: 233 GTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFC 292
            +S RGI+V  THLFWHPFG FER RQ Y++L K+++            S    W+    
Sbjct: 242 -SSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI--------KACSKYNGWHSLLM 292

Query: 293 GDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKF-G 351
           GDFN +P + PYL+++ +P++ K   + ++ECS +Y +SK R             EK  G
Sbjct: 293 GDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRG 352

Query: 352 DG---QPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNT 408
           +G   QP++P P+++ A  E+K LV  +  LHNSL ++ +S+Y + Y  VHPENA  + +
Sbjct: 353 EGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGS 410

Query: 409 HNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEM 468
           H EP +SNWA TW GLLDYIF+I+  +  D ++ E L  FE  N+VKI+  LRMP ++EM
Sbjct: 411 HGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEM 470

Query: 469 PNHGQPHEGEYGSDHLSLMCEIEL 492
           P H QP EGEY SDH+SLMC+I L
Sbjct: 471 PKHSQPFEGEYASDHISLMCQIRL 494

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  367 bits (943), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/444 (42%), Positives = 270/444 (60%), Gaps = 34/444 (7%)

Query: 66  GLDPEFP-PDLQFISRPMLPL------DSNYS-----PEGFVFKIMTYNCLAQALIRRKL 113
           G DP+FP PDLQFI RP L +      DS  S     P     +IMTYN LAQ LIRR  
Sbjct: 69  GKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRDF 128

Query: 114 FPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHG 173
           FP SG+ALKW KRS+VL++E   YK D+  LQE+DY +   FW E F KLG+ S F RH 
Sbjct: 129 FPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTFRRHE 187

Query: 174 TKNHGIAIVWKRDLFTMVDKMLVDYDKEPSG-SLKPRTTTKNVGLVLALAFSKKVLDKYP 232
            K HG+ + W  + F   ++ ++DYD   +G ++  RT TKN+ L+++L+     +    
Sbjct: 188 GKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLS-----VKNMT 242

Query: 233 GTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEK-KWYPFF 291
             S  G++V  THLFWHPFG FER RQ +++L K+++           + P+   W+   
Sbjct: 243 NLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEI---------KTCPKYYGWHSLL 293

Query: 292 CGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFG 351
            GDFN +P + PY++++ +P+     A+ + ECS +Y +SK R           + E  G
Sbjct: 294 MGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDEESTG 353

Query: 352 DGQ---PEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNT 408
           +GQ   P++P P  + A  EQK LV  +  LHNSL ++ IS+Y ++Y  VHP+N+  +  
Sbjct: 354 EGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNSKEN-- 411

Query: 409 HNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEM 468
           H EPE+SNWA TW GLLDYIF+I++ +   + + E ++ FE +N+VKI+  LRMP +EEM
Sbjct: 412 HGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEEM 471

Query: 469 PNHGQPHEGEYGSDHLSLMCEIEL 492
           P H QP EGEY SDH+SLMC++ L
Sbjct: 472 PKHSQPFEGEYASDHISLMCQLRL 495

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  365 bits (936), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/448 (42%), Positives = 263/448 (58%), Gaps = 40/448 (8%)

Query: 66  GLDPEFP-PDLQFISRPMLPLDSNYSPEGFV------------FKIMTYNCLAQALIRRK 112
           G DP+FP PDLQFI RP+L + S  +   F              KIMTYN LAQ LIRR 
Sbjct: 67  GKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRD 126

Query: 113 LFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRH 172
            FP SG+ALKW KRS+VL++E   Y  D+  LQE+DY + + FW+E F KLG+D  F R+
Sbjct: 127 FFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRRN 185

Query: 173 GTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGS-LKPRTTTKNVGLVLALAFSKKVLDKY 231
           G K HG+ + W  + F + ++ ++DYD+  +G+ +  RT TKN+ L+++L F        
Sbjct: 186 GGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT----- 240

Query: 232 PGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKM---KDFIHRVNVLQDGSSPEKKWY 288
              S  GI+V  THLFWHPFG FER RQ Y++L K+   KDF                W+
Sbjct: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDF-----------PKYHGWH 289

Query: 289 PFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIE 348
               GDFN +P + PYL+++SKP+      + ++ECS +Y +SK R             E
Sbjct: 290 SLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDE 349

Query: 349 KFGD----GQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAG 404
                    QP++P P  + A  E+K+LV  +  LHNSL ++ IS+Y + Y  VHPENA 
Sbjct: 350 NSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA- 408

Query: 405 RDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPP 464
            +  H EPE+SNWA TW GLLDYIF+I+  +    ++ + L  FE+ N V ++  LRMP 
Sbjct: 409 -NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPC 467

Query: 465 SEEMPNHGQPHEGEYGSDHLSLMCEIEL 492
            +EMP H QP EGEY SDH+SLMC+I L
Sbjct: 468 KQEMPKHSQPFEGEYASDHISLMCQIRL 495

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  356 bits (914), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 259/442 (58%), Gaps = 35/442 (7%)

Query: 66  GLDPEFPPDLQFISRPML--PLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKW 123
           GLDP+FP + QFI RP+L  P   NY   G    IMTYNCLAQ LIRR++FP SG ALKW
Sbjct: 49  GLDPDFPAECQFIERPILLVPHGDNYE-RGLPLSIMTYNCLAQTLIRREMFPESGPALKW 107

Query: 124 FKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVW 183
           F RS+VLL+E  HY AD+ CLQEID +QY  FW EE  K GY + +    +K+HG+ I W
Sbjct: 108 FVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAW 167

Query: 184 KRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSK--KVLDKYPGTSKRGILV 241
           K +LF +   M +++DKE    ++PRT T NVGL++ALAF+   +  +    TS+ G+++
Sbjct: 168 KEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVII 227

Query: 242 GTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFD 301
           GT HLFWHPFGT++RTRQC V+  K+ +F   V         +  +   F GDFN+QP  
Sbjct: 228 GTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTV---------KGDYCKMFTGDFNSQPNS 278

Query: 302 TPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKF----------- 350
            PYL ++        + +T IE ST+Y +S+ R             E+            
Sbjct: 279 VPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYDQ 338

Query: 351 GDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHN 410
           G      P PD +++  EQ++LV  + +  N + + A S+YS+ Y  V P +      H+
Sbjct: 339 GTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA---DHH 395

Query: 411 EPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPN 470
           EPE+S+W+  W GLLDYIF++       N+RP    TFE  N++ I   L+MP   +M N
Sbjct: 396 EPELSSWSTKWAGLLDYIFYV-------NQRPSTPATFETANNIAIAGYLQMPTHAQMHN 448

Query: 471 HGQPHEGEYGSDHLSLMCEIEL 492
           H QP+ GEY SDH+S+MC +E+
Sbjct: 449 HSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  357 bits (916), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/439 (43%), Positives = 264/439 (60%), Gaps = 31/439 (7%)

Query: 66  GLDPEFP-PDLQFISRPMLPL-------DSNYSPEGFVFKIMTYNCLAQALIRRKLFPTS 117
           G DP+FP PDLQFI RP L L        +  +P     KIMTYN LAQ LIRR  FP S
Sbjct: 69  GKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQS 128

Query: 118 GNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNH 177
           G+ALKW KRS+VL++E   YK D+  LQE+DY + + FW+E F KLG+D  F RH  K H
Sbjct: 129 GSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGKTH 187

Query: 178 GIAIVWKRDLFTMVDKMLVDYDKEPSGSLKP-RTTTKNVGLVLALAFSKKVLDKYPGTSK 236
           G+ I W    F + ++ ++DYD   +G+  P RT TKN+ L+ +L   K + D  P T  
Sbjct: 188 GLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRL-KNISD--PSTD- 243

Query: 237 RGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDF 295
            G++V  THLFWHPFG FER RQ Y++L K+++           + P+   W+    GDF
Sbjct: 244 -GVIVANTHLFWHPFGVFERLRQSYLVLAKIQEI---------KACPKYNGWHSVLMGDF 293

Query: 296 NAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKF-GDG- 353
           N +P + PYL+++ KPV     A+ + ECS +Y +SK R             E+  G+G 
Sbjct: 294 NTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQSRGEGR 353

Query: 354 --QPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNE 411
             QP++P P ++ A  EQK LV  +  LHNSL +R +S+Y + Y  V PEN+   N   E
Sbjct: 354 FNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN--GE 411

Query: 412 PEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNH 471
           PE+SNWA +W GLLDYIF+I+  +         +  FE +N+++++  L+MP ++EMP H
Sbjct: 412 PELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPKH 471

Query: 472 GQPHEGEYGSDHLSLMCEI 490
            QP EGEY SDH+SLMC++
Sbjct: 472 SQPFEGEYASDHVSLMCQL 490

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  347 bits (889), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 267/445 (60%), Gaps = 27/445 (6%)

Query: 68  DPEF-PPDLQFISRPMLPLDSNYSPEGFV-FKIMTYNCLAQALIRRKLFPTSGNALKWFK 125
           +PEF      FI R +L L +    +  V  KIMTYN L+Q+LIRR+++P + +A+KW  
Sbjct: 43  NPEFLNSKYDFIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHV 102

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHR--HGTKNHGIAIVW 183
           RS+V+LNE  +Y  D+ C QE+D IQ+  FW  E  KLGY+ +F++   G K HG+AI W
Sbjct: 103 RSKVILNEIKYYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFW 162

Query: 184 KRDLFTMVDKMLVDYDKEPSGSLKPRTT-TKNVGLVLALAFSKKVLDKYPGTSKRGILVG 242
           + +LF   D + +++D   +G+   +TT T NVGL++AL F            + GI++G
Sbjct: 163 RSNLFEQFDVIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSS-----NAKFRSGIVIG 217

Query: 243 TTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE--KKWYPFFCGDFNAQPF 300
           TTHLFWHPFGTFERTRQ  +LL K +  I  +N  + G   E   +W P   GDFN+QP 
Sbjct: 218 TTHLFWHPFGTFERTRQLAILLKKFRKLIDNLNT-ECGHINEMSNRWLPILTGDFNSQPC 276

Query: 301 DTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGD-------- 352
           D PYLS++SKPV     AKTVIECST+Y FS+ R           + E+           
Sbjct: 277 DMPYLSITSKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEE 336

Query: 353 ---GQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTH 409
                P  P P  +EA  EQK+L+  + ++HNS++++A S++ +AYK VH       N  
Sbjct: 337 DEESNPIDPRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVHSIGL---NCK 393

Query: 410 NEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMP 469
           NEPE+S+ +  W GLLDYIF ++ WN  +      L+ FEK   +++  LL+MP  +E+P
Sbjct: 394 NEPELSHTSIFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELP 453

Query: 470 NHGQPHEGEYGSDHLSLMCEIELNL 494
            + QPH+G+Y SDHLS++C++ + +
Sbjct: 454 KNVQPHQGQYPSDHLSMICDLNVRI 478

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  346 bits (887), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/435 (44%), Positives = 264/435 (60%), Gaps = 28/435 (6%)

Query: 77  FISRPMLPL---DSNYSPEGFV-FKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132
           FI RP+L +         +G+V  KIMTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 133 EFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLF--TM 190
           E  +Y ADV CLQE D IQ+  FW EEF +LGY   F     K HG+AIVWK  +F  T 
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 191 VDKMLVDYDKEPSG-SLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWH 249
           +DK+ +  D   +G  +   T T+ V L +AL        K+  TS R I+  TTHLFWH
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTS-RPIIFSTTHLFWH 215

Query: 250 PFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFDTPYLSMS 308
            FGTFERTRQ +V+L+++  FI +V    D   P  ++ Y FF GDFN+QP D PYLS++
Sbjct: 216 LFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272

Query: 309 SKPVVYKDRAKTVIECSTSYTFSKARXXXX-----XXXXXXXNIEKFGD--GQPEHPVPD 361
            KPV  K RAK++IECS SY +SK R                + E   D   +P+ P P 
Sbjct: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332

Query: 362 TYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNT--HNEPEISNWAE 419
           TY+A PEQ E VQ +  LHN + ++ +S+Y + Y  VHPEN+ + +T  + EP++S+ A 
Sbjct: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392

Query: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479
            W GLLDYIF I +W+  +  +  +LQ  E++  +KI   LRMP  EEM +H +PHE EY
Sbjct: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451

Query: 480 GSDHLSLMCEIELNL 494
            SDHL++MC+I L L
Sbjct: 452 PSDHLAMMCDISLPL 466

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 98/233 (42%), Gaps = 25/233 (10%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + Y  D+ CLQE++   ++ 
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 155 FWKEEFGKLGYDSQF----------HRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSG 204
           FW     K GY   F          HR   K  G  + +KR  F ++ K  VD+      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 205 SLKPRTTTKNVGLVL-----ALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQ 259
             K + T   +   +     AL F  + +      S   I V TTHL W P     +T Q
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQHI-----ASGEHIWVATTHLHWDPKFNDVKTFQ 609

Query: 260 CYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312
             VLL+ ++  I + N  QD     KK     CGDFN+      Y  +SS  V
Sbjct: 610 VGVLLDHLQTLIRQDNPRQD----VKKAPVIICGDFNSYIDSAVYELLSSGSV 658

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 32/224 (14%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++      AL W  R   L +E + Y+ D+ CLQE++   Y+ 
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE 457

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     K GY   FH          +   K  G  I +K   FT V K  +D+      
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV L++ L   +         +   + V TTHL W P     
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALIIKLRHER---------TGEHVWVVTTHLHWDPHFNDV 568

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPF-FCGDFNAQ 298
           +T Q  V+L+ ++  + +   +  GS  +KK  P   CGDFN+Q
Sbjct: 569 KTFQVAVMLDYIEKLLKQHGGV--GSPQDKKKIPLVICGDFNSQ 610

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 98/238 (41%), Gaps = 32/238 (13%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + ++ADV CLQE++   ++ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     K GY   FH          +   K  G  + +K   F +V K  VD+      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         +   I V TTHL W P     
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHLK---------TNEQIWVTTTHLHWDPQFNDV 569

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPF-FCGDFNAQPFDTPYLSMSSKPV 312
           +T Q  VLL+ M+  +   N +  G++ E K  P   CGDFN+Q     Y   SS  V
Sbjct: 570 KTFQVGVLLDYMEKLLRDQNGV--GNNQEMKKVPLVICGDFNSQLDSAVYELFSSGTV 625

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 93/224 (41%), Gaps = 32/224 (14%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++      AL W  R   L  E + Y+ DV CLQE++   Y+ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     K GY   FH          +   K  G  I +K   F+ + K  +D+      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       N+ L++ L             S   + V TTHL W P     
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKLKHE---------LSGEHVWVVTTHLHWDPHFNDV 615

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPF-FCGDFNAQ 298
           +T Q  VLL+ ++  + + + +  G+  EKK  P   CGDFN+Q
Sbjct: 616 KTFQVGVLLDYIEKLLKQQSNI--GNPQEKKKVPLIICGDFNSQ 657

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 92/222 (41%), Gaps = 30/222 (13%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + Y +DV CLQE++   ++ 
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           +W     K GY   FH          +   K  G  I +KRD F MV++  +D+      
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMK 618

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV L L L            +S   I V TTHL W P     
Sbjct: 619 HKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDPKFNDV 669

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           +T Q  VLL+ ++  + + +   +     KK     CGDFN+
Sbjct: 670 KTFQVGVLLDHLETLL-KEDTTHNSRQDIKKSPVLICGDFNS 710

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 93/217 (42%), Gaps = 23/217 (10%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F I++YN L Q     K++  T   AL+W  R   L  + + Y  D+ CLQE++   Y+ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSG 204
           FW     K GY   FH          +   K  G  + +K+  F ++ K  +D+    SG
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDF----SG 581

Query: 205 SLKPRTTTKNVGLVLALAFSKKVLDKYPG----TSKRGILVGTTHLFWHPFGTFERTRQC 260
           + +     +     L  A +K  +  Y       S   + V TTHL W P     +T Q 
Sbjct: 582 AWQKHKRFQRTEDYLNRAMNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQV 641

Query: 261 YVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
            VLL+ M+  I   N  QD     KK+     GDFN+
Sbjct: 642 GVLLDHMESIIKEENPKQD----VKKFPIIITGDFNS 674

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 89/229 (38%), Gaps = 30/229 (13%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F I++YN L Q     K++  T   AL W  R   L  + + Y  D+ CLQE++   Y+ 
Sbjct: 408 FTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYED 467

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     + GY   FH          +   K  G    +K   F ++ K  VD+      
Sbjct: 468 FWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMK 527

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV LV+ L   K         S   +   TTHL W P     
Sbjct: 528 HKKFQRTEDYLNRAMNKDNVALVVKLQHIK---------SGEHVWAATTHLHWDPQFNDV 578

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPY 304
           +T Q  VLL+ M+  I   N   + +   KK     CGDFN+Q     Y
Sbjct: 579 KTFQVGVLLDYMEKVIKEQNNCNN-TQELKKVPVVICGDFNSQTNSAVY 626

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 92/217 (42%), Gaps = 23/217 (10%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F I++YN L Q     K++  T   AL W  R   L  + + Y++D+ CLQE++   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSG 204
           FW     K  Y   FH          +   K  G  I +K+  F ++ K  +D+    SG
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDF----SG 684

Query: 205 SLKPRTTTKNVGLVLALAFSKKVLDKY----PGTSKRGILVGTTHLFWHPFGTFERTRQC 260
           +       +     L  A +K  +  Y      TS   + V TTHL W P     +T Q 
Sbjct: 685 TWMKHKKFQRTEDYLNRAMNKDNVALYMKLQSITSGETVWVVTTHLHWDPKFNDVKTFQV 744

Query: 261 YVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
            +LL+ M+  +   N  QD     KK     CGD N+
Sbjct: 745 GILLDHMETLLKEENPKQD----VKKANVVICGDLNS 777

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 91/223 (40%), Gaps = 30/223 (13%)

Query: 95  VFKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y +DV CLQE++   ++
Sbjct: 536 TFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFE 595

Query: 154 SFWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD---- 199
            +W     K GY   F+          +   K  G  I +KRD F +V K  +D+     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 200 -----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTF 254
                +     L       NV L L L            +S   I V TTHL W P    
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDPKFND 706

Query: 255 ERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
            +T Q  VLL+ ++  + + +   +     KK     CGDFN+
Sbjct: 707 VKTFQVGVLLDHLESLL-KEDTTHNSRQDIKKSPVLICGDFNS 748

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 96/237 (40%), Gaps = 30/237 (12%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + ++Y  D+ CLQE++   Y+ 
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     + GY   FH          +   K  G  + ++   F ++ K  VD+      
Sbjct: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV L++ L   K         S   +   TTHL W P     
Sbjct: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHLK---------SGEHVWAATTHLHWDPQFNDV 580

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312
           +T Q  VLL+ M+  I + +   + S   KK     CGDFN+Q     Y  +S+  V
Sbjct: 581 KTFQVGVLLDHMEKVI-KEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSV 636

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 92/237 (38%), Gaps = 30/237 (12%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F IM+YN L Q     K++  T   AL W  R + L  E M Y  D+ CLQE++   Y+ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
            W     K GY   FH          +   K  G  + +K   F +  K  VD+      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV + + L   K         S   + + TTHL W P     
Sbjct: 644 HKKFQRTEDYLNRAMNKDNVVIYIKLNHLK---------SGESVWIATTHLHWDPQFNDV 694

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312
           +T Q  +L++ +++ I           P KK     CGDFN+Q     Y  +S+  V
Sbjct: 695 KTFQVGILMDHLEELIKEHGSPSSRQDP-KKSPVIICGDFNSQKDSAVYELLSTGHV 750

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 94/226 (41%), Gaps = 36/226 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L       K++  T   AL W  R   L  + + +  DV CLQE++ + Y+ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYDK---- 200
           +W     K  Y   FH          +   K  G AI +K+D F +V +  +D+      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 201 -----EPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
                     L       NV L+  L        K+  T++  + V TTHL W P     
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAEL--------KHLNTNE-NVWVVTTHLHWDPQFNDV 624

Query: 256 RTRQCYVLLNKMKDFI---HRVNVLQDGSSPEKKWYPFFCGDFNAQ 298
           +T Q  V+L+ ++  I   H VN   D     KK     CGDFN+Q
Sbjct: 625 KTFQVGVMLDYLETLIKQHHHVNNNND----IKKIPMVICGDFNSQ 666

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 102/244 (41%), Gaps = 35/244 (14%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + +K+DV CLQE++   Y+ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW     K GY   F+          +   K  G  I +K   F ++ K  VD+      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         S   + V TTHL W P     
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHIK---------SGESVWVVTTHLHWDPQFNDV 622

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPE--KKWYPFFCGDFNAQPFDTPYLSMSSKPV- 312
           +T Q  +LL+ +++ +   N   + SS +  +K     CGD N+      Y  +S+  V 
Sbjct: 623 KTFQVGILLDHLEELLKDNN---NASSKQEIRKCPVIICGDLNSHLDSAVYELLSTGHVQ 679

Query: 313 VYKD 316
           V+KD
Sbjct: 680 VHKD 683

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 90/226 (39%), Gaps = 36/226 (15%)

Query: 95  VFKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y +D+ CLQE++   ++
Sbjct: 504 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 563

Query: 154 SFWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD---- 199
            +W     K GY   FH          +   K  G  I +KRD F ++ K  +D+     
Sbjct: 564 EYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWM 623

Query: 200 -----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTF 254
                +     L       NV L L L             S   I   TTHL W P    
Sbjct: 624 KHKKFQRTEDYLNRAMNKDNVALFLKLQHIP---------SGDTIWAVTTHLHWDPKFND 674

Query: 255 ERTRQCYVLLNKMKDFIHRV---NVLQDGSSPEKKWYPFFCGDFNA 297
            +T Q  VLL+ ++  +      N  QD     KK+    CGDFN+
Sbjct: 675 VKTFQVGVLLDHLETLLKEETSHNFRQD----IKKFPVLICGDFNS 716

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 97/245 (39%), Gaps = 32/245 (13%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + Y  DV CLQE++   ++ 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           +W     K GY   FH          +   K  G  + ++ + F +  K  VD+      
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV + L L   K         S   + + TTHL W P     
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQHIK---------SGESVWIVTTHLHWDPQFNDV 634

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYP-FFCGDFNAQPFDTPYLSMSSKPVVY 314
           +T Q  VL++ +++ +   +  Q  S  E K  P   CGD N++     Y  +S+  V  
Sbjct: 635 KTFQVGVLMDHIENLLKEQSNAQ--SKQEAKKCPVILCGDLNSEIHSAVYELLSTGRVQA 692

Query: 315 KDRAK 319
            D  K
Sbjct: 693 HDDIK 697

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 90/222 (40%), Gaps = 33/222 (14%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + +++  D+ CLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW+    K GY   FH          +   K  G    +K   F M+ K  VD+      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV +V+ L   +         S   + + TTHL W P     
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQ---------SGEIMWLVTTHLHWDPKFNDV 708

Query: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           +T Q  VLL+ M+  +   N  QD     KK+    CGD N+
Sbjct: 709 KTFQVGVLLDHMETLLKEQNPKQD----VKKYPLVICGDLNS 746

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 88/223 (39%), Gaps = 30/223 (13%)

Query: 95  VFKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y +D+ CLQE++   ++
Sbjct: 506 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 565

Query: 154 SFWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD---- 199
            +W     K GY   FH          +   K  G  I +K+D F ++ K  +D+     
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWM 625

Query: 200 -----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTF 254
                +     L       NV L L L             S   I   TTHL W P    
Sbjct: 626 KHKKFQRTEDYLNRAMNKDNVALFLKLQHIP---------SGDTIWAVTTHLHWDPKFND 676

Query: 255 ERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
            +T Q  VLL+ ++  + R     +     KK     CGDFN+
Sbjct: 677 VKTFQVGVLLDHLETLL-REETTHNFRQDIKKSPVLICGDFNS 718

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 102/256 (39%), Gaps = 37/256 (14%)

Query: 86  DSNYSPEGF--VFKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVH 142
           DS+ S E     F +++YN L Q     K++  T    L W  R   L N+ +  ++DV 
Sbjct: 528 DSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVI 587

Query: 143 CLQEIDYIQYQSFWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVD 192
           CLQE++   Y+ FW     K GY   FH          +   K  G  I +K   F +  
Sbjct: 588 CLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQH 647

Query: 193 KMLVDYD---------KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGT 243
           +  VD+          +     L       NV L + L             S   + V T
Sbjct: 648 QESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLEHI---------NSGESVWVVT 698

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE--KKWYPFFCGDFNAQPFD 301
           THL W P     +T Q  VLL+ ++  +   N   + SS +  +K     CGD N+    
Sbjct: 699 THLHWDPQFNDVKTFQVGVLLDHLESLLKDYN---NASSKQEIRKCPVIICGDLNSHLQS 755

Query: 302 TPYLSMSSKPV-VYKD 316
             Y  +S+  V V++D
Sbjct: 756 AVYELLSTGHVKVHED 771

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 110/262 (41%), Gaps = 23/262 (8%)

Query: 67  LDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFP-TSGNALKWFK 125
           +D E  P  ++ S  +   + N   E   F +++YN L Q     K++  T   AL W  
Sbjct: 497 IDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDY 556

Query: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFH----------RHGTK 175
           R   L ++ + Y++D+ CLQE++   ++ FW     K  Y   FH          +   K
Sbjct: 557 RREKLKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKK 616

Query: 176 NHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKY---- 231
             G  I +K+  F ++ K  +D+    SG+       +     L  A +K  +  Y    
Sbjct: 617 VDGCCIFFKKSKFKLLFKEAMDF----SGTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQ 672

Query: 232 PGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFF 291
             TS   + V TTHL W P     +T Q  +LL+ M+  +   N  QD     KK     
Sbjct: 673 SLTSGESVWVVTTHLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQD----VKKANVVI 728

Query: 292 CGDFNAQPFDTPYLSMSSKPVV 313
           CGD N+      Y  +S+  VV
Sbjct: 729 CGDLNSYFDSAVYELLSTGRVV 750

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 90/225 (40%), Gaps = 36/225 (16%)

Query: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + +K+D+ CLQE++   Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199
           FW+    K GY   FH          +   K  G  I +K   F ++ K  VD+      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255
               +     L       NV + + L   K         S     + TTHL W P     
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHIK---------SGEVTWIVTTHLHWDPQFNDV 734

Query: 256 RTRQCYVLLNKMKDFI---HRVNVLQDGSSPEKKWYPFFCGDFNA 297
           +T Q  VLL+ ++  +     ++  QD     KK     CGD N+
Sbjct: 735 KTFQVGVLLDHLESLLKEHSNIHSKQD----VKKCPIIICGDLNS 775

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 105/258 (40%), Gaps = 41/258 (15%)

Query: 76  QFISRPMLPLDSNYSPEGFV----FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVL 130
           + I+R +LP+ S  +  G      F ++TYN L+   +  +++       K W  R ++L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 131 LNEFMH-YKADVHCLQEIDYIQYQSFWKEEFG-KLGYDSQF---------HRHGTKNHGI 179
             E  H Y AD+ CLQE+    Y+ FW+++   ++ ++SQ+          R   +  G+
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 180 AIVWKRDLFTMVDKMLVDYDKEPSGSLKPR----------TTTKNVGLVLALAFSKKVLD 229
              +  D F  V   L +Y  +  G L P             T   G V+     K VL 
Sbjct: 138 GTFYNADKFEHVATDL-EYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLT 196

Query: 230 KYPGT----------SKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD 279
           +              +    +V  T L+W       +  QC++++ ++K  + R+   +D
Sbjct: 197 QRNQVCLFVTLLHKPTGSLFVVVNTQLYWKYDEV--KLAQCFIIMRRLKAIVKRLLTRKD 254

Query: 280 GSSPEKKWYPFFCGDFNA 297
            S    K      GD N+
Sbjct: 255 TSYSNIK--VLLSGDLNS 270

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 93  GFVFKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYI 150
           G  F ++TYN L+   +  +++    +  K W  R  +L +E +  YKADV CLQE+ + 
Sbjct: 34  GHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELTWE 93

Query: 151 QYQSFWKEEFGK-LGYDSQF 169
            Y S+WK  FGK L Y S+F
Sbjct: 94  DYLSYWKPVFGKQLNYGSKF 113

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 109/251 (43%), Gaps = 41/251 (16%)

Query: 79  SRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-H 136
           S P +PL      + F   +++YN L+ + +  +++    +  K W  R  +L  E +  
Sbjct: 15  SLPKIPLSRRIMNDKFT--VLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDK 72

Query: 137 YKADVHCLQEIDYIQYQSFWKEEFG-KLGYDSQF---------HRHGTKNHGIAIVWKRD 186
           YKAD+ C+QE+    Y  +W+ + G  +GY S+F          RH     G+AI +   
Sbjct: 73  YKADIMCVQEMTKRDYIDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQ 132

Query: 187 LFTMV-------DKMLVDYDKEPSGSLKPRT--TTKNVGL---------VLALA--FSKK 226
            F  +       ++ L  ++ E    LK +T   T   G+         +L++    S  
Sbjct: 133 KFDFISSSGIYLNEFLDVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLF 192

Query: 227 VLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKK 286
           V  K+  T +  I++  THL+W       +  QC +++ ++   I    +LQD    + K
Sbjct: 193 VCLKHKETGQVFIIIN-THLYWKYDEV--KLSQCIIIMRELSKIIDE--LLQDVRHSKVK 247

Query: 287 WYPFFCGDFNA 297
               F GD N+
Sbjct: 248 --IIFAGDLNS 256

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 99/241 (41%), Gaps = 39/241 (16%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F  MTYN L+   +  +++       K W  R R+L  E ++ Y+AD+ C+QE+    Y 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 154 SFWKEEF-GKLGYDSQF---------HRHGTKNHGIAIVWKRDLF-------TMVDKMLV 196
            FWK  F  K+ Y S F          R   +  G+ I +  D F         ++ ++ 
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIG 153

Query: 197 DYDKEPSGSLKPRTTTKNVGL--------VLALAFSKKVLDKYPGT----SKRGILVGTT 244
            ++      LK    T   G         +L +   +  +  +       ++   +V  T
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 245 HLFWHPFGTFERTR--QCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDT 302
           HL+W     ++  +  QC  ++ K+   I  + + ++G +  K     F GD N+ P D+
Sbjct: 214 HLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGREGVTYSKV-KILFAGDLNSAP-DS 267

Query: 303 P 303
           P
Sbjct: 268 P 268

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 103/234 (44%), Gaps = 39/234 (16%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+Q+ +  +++       K W  R ++L  E +  Y AD+ CLQE+    Y+
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 154 SFWKEEFGKLGYDSQFH-----RHGTKN----HGIAIVWKRDLFTMVDK--------MLV 196
            +W+++  K    S F      ++ TK      G+ I +  D+F ++D         ++ 
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 197 DYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG-------------T 243
           D+++     L  R      G    +  S  +LD     ++  + +              T
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVS-NILDVLEEKNQVCLFMTLKHKRTGATVVVVT 200

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           THL+W  +   + T QC +++ ++   I +  + +DGSS  K     F GD N+
Sbjct: 201 THLYW-KYDEIKLT-QCMIIMRQLSK-IMKDQLKKDGSSFVK---VLFAGDLNS 248

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 106/247 (42%), Gaps = 56/247 (22%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+   +  +++    +  K W  R ++L  E M  YKAD+ CLQE+ +  Y 
Sbjct: 48  FTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYI 107

Query: 154 SFWKEEFG-KLGYDSQF---------HRHGTKNHGIAIVWKRDLFTMVDK---------- 193
           S+WK +   K+ Y S+F          +   +  G  I + ++ F  +            
Sbjct: 108 SYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVG 167

Query: 194 ---------------MLVDYDKEPSGS--LKPRTTTKN-VGLVLALAFSKKVLDKYPGTS 235
                           L D   +P+G+  L    TT+N V L ++L        ++  T+
Sbjct: 168 TFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSL--------RHKATN 219

Query: 236 KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNV-----LQDGSSPEKKWYPF 290
              +++  THL+W  +   + T QC +++ K+   I+ + +     + D S+  K     
Sbjct: 220 TVFVVIN-THLYW-KYDEVKLT-QCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKII 276

Query: 291 FCGDFNA 297
           F GD N+
Sbjct: 277 FSGDLNS 283

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 106/235 (45%), Gaps = 38/235 (16%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYKADVHCLQEIDYIQYQ 153
           F ++TYN L+   +  +++    +  K W  R R+L +E F  YK+D+ CLQE+    Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 154 SFWKEE-FGKLGYDSQFH-----RHGTK----NHGIAIVWKRDLF-------TMVDKMLV 196
            FWK++   ++ Y S F      ++ TK      G+ I +  D F         ++ ++ 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVG 153

Query: 197 DYDKEPSGSLKPR--TTTKNVGLVLA------LAFSKKVLDKYPGT----SKRGILVGTT 244
            +D++    L     T T   G V+       +A ++  +  +       SK  I+V  T
Sbjct: 154 TFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVINT 213

Query: 245 HLFWHPFGTFERTR--QCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           HL+W     ++  +  QC +++ K++  I  + +  +G +        F GDFN+
Sbjct: 214 HLYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNV-KILFSGDFNS 263

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 107/259 (41%), Gaps = 40/259 (15%)

Query: 80  RPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-Y 137
           +P LP   N S     F +MTYN L+   +  +++       K W  R R+L  E ++ Y
Sbjct: 15  KPSLPEIRN-SVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLY 73

Query: 138 KADVHCLQEIDYIQYQSFWKEEF-GKLGYDSQF---------HRHGTKNHGIAI------ 181
           +AD+ C+QE+    Y+ FWK  F  K+ Y S +          R   +  G+ I      
Sbjct: 74  RADIMCVQELTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNK 133

Query: 182 --------VWKRDLFTMVDKMLVDYDKE-----PSGSLKPRTTTKNVGLVLALAFSKKVL 228
                   ++  DL  + +   ++Y K       +G+ +P      + ++         +
Sbjct: 134 FEHISTSSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFV 193

Query: 229 DKYPGTSKRGILVGTTHLFWHPFGTFERTR--QCYVLLNKMKDFIHRVNVLQDGSSPEKK 286
                 ++   +V  THL+W     ++  +  QC  ++ K+   I  + +  +G +  K 
Sbjct: 194 SLLHKETRTLFVVVNTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGVTYSKV 249

Query: 287 WYPFFCGDFNAQPFDTPYL 305
               F GD N+ P D+P +
Sbjct: 250 -KILFAGDLNSAP-DSPVI 266

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 36/234 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYKADVHCLQEIDYIQYQ 153
           F ++TYN L+ A +  +++       K W  R  +L  E +  YKAD+ C+QE+    YQ
Sbjct: 39  FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQ 98

Query: 154 SFWKE-EFGKLGYDSQF---------HRHGTKNHGIAIVWKRDLFTMV-------DKML- 195
            FW     GK    S+F          R   +  G+AI + R +F  V       ++ML 
Sbjct: 99  QFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQMLD 158

Query: 196 --VDYDKEPSGSLKPRTT------TKNVGLVLALAFSKKV---LDKYPGTSKRGILVGTT 244
              D++ E  G  K   T      T    L+  L    +V   +     ++    +V  T
Sbjct: 159 AFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVVINT 218

Query: 245 HLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEK-KWYPFFCGDFNA 297
           HL+W  +   + T QC V++ ++   I   ++L+D     K K    F GD N+
Sbjct: 219 HLYWK-YDEVKLT-QCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 113/278 (40%), Gaps = 39/278 (14%)

Query: 78  ISRPMLPLDSNYSPEGF--VFKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEF 134
           ++R  +P+ +N        +F +++YN L+ + +  +++       K W  R ++L  E 
Sbjct: 2   LARQFIPIGANVLKNSAKPLFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQEL 61

Query: 135 M-HYKADVHCLQEIDYIQYQSFWKEEF-GKLGYDSQF---------HRHGTKNHGIAIVW 183
           +  Y+AD+ CLQE+    Y +FWK+     + Y S +          R   +  G+ I +
Sbjct: 62  LDKYRADIMCLQELTSEDYSNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFY 121

Query: 184 KRDLFTMVDKMLVDYDKEPSGSL----------KPRTTTKNVG------LVLALAFSKKV 227
             D F  + +  + Y  +  G            KP T T   G       +L +  SK  
Sbjct: 122 NLDKFEFISRSGI-YLNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQ 180

Query: 228 LDKYPGTSKRG----ILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSP 283
           +  +     +      +V  THL+W       +  QC +++ ++   I + +++   +  
Sbjct: 181 VALFVSLKHKETGNVFVVINTHLYWKYDDV--KLTQCMIIMRELARIIEK-HLVGLENVT 237

Query: 284 EKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTV 321
           + K    F GD N+   D+  ++     +V  D    +
Sbjct: 238 DDKIKILFTGDLNSTS-DSLVINFLKGQIVSHDNLNVI 274

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 90/218 (41%), Gaps = 33/218 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYKADVHCLQEIDYIQYQ 153
             ++TYN L+   +  +++    +  K W  R ++L  E F  +KAD+ CLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 154 SFWKEEFG-KLGYDSQFHRHGTKNHGIA-----------------------IVWKRDLFT 189
            FW+++   +L Y S F       +  A                       +++  D  +
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 190 MVDKMLVDYDK-----EPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTT 244
           M  K  +D+       + +G+  P TT   + ++L        +      +K  I+V  T
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTKSLIVVVNT 209

Query: 245 HLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSS 282
           HL+W       +  QC  ++ K+K  I+++    +G +
Sbjct: 210 HLYWKYDEV--KLSQCLTIMRKLKQVINKLTTTLEGVT 245

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 97/242 (40%), Gaps = 52/242 (21%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F  MTYN L+   +  +++    +  K W  R ++L  E ++ Y+AD+ CLQE+    Y 
Sbjct: 29  FTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYH 88

Query: 154 SFWKEEFGK-LGYDSQF---------HRHGTKNHGIAIVWKRDLFTMVDKM--------- 194
            +W+E   +   Y S+F          +      G+ I +  + F  +            
Sbjct: 89  QYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIG 148

Query: 195 ----------------LVDYDKEPSGS---LKPRTTTKNVGLVLALAFSKKVLDKYPGTS 235
                           L D    P G    L+   +   VGL +AL        K+  T+
Sbjct: 149 SFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVAL--------KHKDTN 200

Query: 236 KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDF 295
              +++  THL+W  +   + T QC +++ K+   I  + V + G++   K    F GD 
Sbjct: 201 TIFVVIN-THLYW-KYDEVKLT-QCLIIMRKLAKIIRDLLVGEHGTT-YNKMKVVFAGDL 256

Query: 296 NA 297
           N+
Sbjct: 257 NS 258

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 96/238 (40%), Gaps = 42/238 (17%)

Query: 95  VFKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYKADVHCLQEIDYIQY 152
            F  ++YN L+   +  +++       K W  R  +L  E +  Y++D+ C+QE+  I Y
Sbjct: 43  TFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELTTIDY 102

Query: 153 QSFWKEEFGK-LGYDSQFHRHGTKNH---------GIAIVWKRDLFTMVDKMLVDYDKEP 202
            SFW++   K   Y S+F      N+         G+ I +  D+F  +    ++ +   
Sbjct: 103 YSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINLNDLA 162

Query: 203 SG---------SLKPRTTTKNVGLVLA------LAFSKKVLDKYP----GTSKRGILVGT 243
           S          + K  T     G V        LA SK  +  +       SK   ++  
Sbjct: 163 STFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVEHKISKDVFVIIN 222

Query: 244 THLFWHPFGTFERTR--QCYVLLNKMKDFIHRVNVLQDGSSPE---KKWYPFFCGDFN 296
           THL+W     +E  +  QC +++ K+   ++   +L +  S +    K    F GD N
Sbjct: 223 THLYW----KYEEVKLTQCMIIMRKLAKIVNE--LLFNAESRDMNYNKVKILFSGDLN 274

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 93/238 (39%), Gaps = 42/238 (17%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYKADVHCLQEIDYIQYQ 153
           F ++TYN L+   +  +++       K W  R R+L +E F  YKAD+ CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYH 89

Query: 154 SFWKEEFGK-LGYDSQF---------HRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPS 203
           +FW ++  + L Y S F          R   +  G+ I +  D F  +    + Y  +  
Sbjct: 90  NFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI-YLNDVL 148

Query: 204 GSLKPR----------TTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG----------- 242
           G    R          T T   G  +       +++   G ++  + V            
Sbjct: 149 GIFNVRELKYMKETMITLTNGAGEAIG---KDNLMNILQGRNQVCLFVSLRHKDTNTVFV 205

Query: 243 --TTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQ 298
              THL+W       +  QC  ++ K++  I  + +  +G +  K     F GD N+ 
Sbjct: 206 VINTHLYWKYDEV--KLSQCLTIMRKLERIIKSLLMGVEGVTYSKV-KILFSGDLNSN 260

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 93/234 (39%), Gaps = 38/234 (16%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYKADVHCLQEIDYIQYQ 153
           F ++TYN L+ + +  +++    +  K W  R ++L +E +  YKAD+ CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYN 89

Query: 154 SFWKEEFGK-LGYDSQF---------HRHGTKNHGIAIVWKRDLFTMV-------DKMLV 196
             WK   G  +GY S+F          R   +  G+ I +    F  +       ++ L 
Sbjct: 90  ENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFLN 149

Query: 197 DYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG-------------T 243
            +       L  +      G  + +   K +LD   G ++  + V               
Sbjct: 150 VFSSTELEYLHSKRLVLTDGAGVPIG-EKNLLDVISGKNQVCLFVSLKHKETGEMFVVIN 208

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           THL+W  +   + T QC +++ ++   I     L  G     K    F GD N+
Sbjct: 209 THLYWK-YDEVKLT-QCMIIMRELSKIIDE---LVKGVDDPGKVKILFTGDLNS 257

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 105/234 (44%), Gaps = 37/234 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+ + +  +++       K W  R ++L  E ++ +KAD+ CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYE 86

Query: 154 SFWKEEFG-KLGYDSQF--------HRHGTKN-HGIAIVWKRDLFTMV-------DKMLV 196
            +W++  G  + Y S+F         ++  K+  G++I +  + F  +       +++L 
Sbjct: 87  DYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLLN 146

Query: 197 DYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILV-------GT------ 243
            +++     L  +  T   G    +     +LD   G ++  + V       GT      
Sbjct: 147 VFNERELKYLFNKKVTLTDG-ASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           THL+W  +   + T QC +++ ++   I +  +L      ++K    F GD N+
Sbjct: 206 THLYWK-YDEVKLT-QCMIIMRELSKIIKQ--LLSGDVKSQRKVKILFTGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 100/234 (42%), Gaps = 37/234 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+ + +  +++       K W  R ++L  E +  +KAD+ CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYE 86

Query: 154 SFWKEEFG-KLGYDSQFHRHGTKNH---------GIAIVWKRDLFTMV-------DKMLV 196
           ++W    G  + Y S+F       +         G++I +  + F  +       +++L 
Sbjct: 87  NYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLLN 146

Query: 197 DYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG-------------T 243
            +++     L  +  T   G    +     +LD   G ++  + V               
Sbjct: 147 VFNERELKYLYNKKVTLTDGASNVIG-EDSLLDVLKGKNQVCLFVSLKHKETNTIFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           THL+W  +   + T QC +++ ++   I +  +L   ++ ++K    F GD N+
Sbjct: 206 THLYW-KYDEVKLT-QCMIIMRELSKIIKQ--LLPGDANAQEKVKILFTGDLNS 255

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+ + +  +++       K W  R R+L  E ++ +KAD+ CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYE 86

Query: 154 SFWKEEFG-KLGYDSQF 169
            +W +  G  + Y S+F
Sbjct: 87  DYWHDSIGVDVNYGSKF 103

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 97/234 (41%), Gaps = 37/234 (15%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
           F ++TYN L+ + +  +++       K W  R ++L  E ++ +KAD+ CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDYE 86

Query: 154 SFWKEEFG-KLGYDSQFHRHGTKNH---------GIAIVWKRDLFTMV-------DKMLV 196
            +W +  G  + Y S+F       +         G++I +  D F  +       +++L 
Sbjct: 87  DYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLLN 146

Query: 197 DYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVG-------------T 243
            +++     L  +      G    +     +LD   G ++  + V               
Sbjct: 147 VFNERELKYLYNKRVILTDGASNVVG-EDSLLDVLKGKNQVCLFVSLKHKETDTIFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNA 297
           THL+W  +   + T QC +++ ++   I +  +L   +    K    F GD N+
Sbjct: 206 THLYW-KYDEVKLT-QCMIIMRELSKIIEQ--LLPGDAKGRGKVKILFTGDLNS 255

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 103/245 (42%), Gaps = 58/245 (23%)

Query: 96  FKIMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YKADVHCLQEIDYIQYQ 153
             ++TYN L+   +  +++    +  K W  R ++L  E +  Y+AD+ CLQE+  + YQ
Sbjct: 22  LSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDYQ 81

Query: 154 SFW-KEEFGKLGYDSQF---------HRHGTKNHGIAI--------------VWKRDLFT 189
            +W K    K  Y S++          R  ++  G+ +              ++  DLF 
Sbjct: 82  QYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLFG 141

Query: 190 MVD---------KMLVDYDKEPSGSLKPRTTTKNV-----GLVLALAFSKKVLDKYPGTS 235
             D         KML   D +  G+   + T  +V      + + ++   K  + +    
Sbjct: 142 TFDLKEQNYLEHKMLQLTDGQ--GNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTF---- 195

Query: 236 KRGILVGTTHLFWHPFGTFERTR--QCYVLLNKMKDFIHRVNV-LQDGSSPEKKWYPFFC 292
              ++V  THL+W     ++  +  QC +++ ++   I  + + +QD +  + K    F 
Sbjct: 196 ---LIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIKDLLIGVQDTTYNKVKI--IFA 246

Query: 293 GDFNA 297
           GD N+
Sbjct: 247 GDMNS 251

>SAKL0H09130g Chr8 (778200..779408) [1209 bp, 402 aa] {ON} similar
           to uniprot|Q02887 Saccharomyces cerevisiae YPL100W ATG21
           Phosphatidylinositol 3 5-bisphosphate- binding protein
           required for maturation of pro- aminopeptidase I
           predicted to fold as a seven-bladed beta- propeller
           displays punctate cytoplasmic localization
          Length = 402

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 176 NHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTS 235
           N  I +++   L  +VDK   +   + S  LK    TK    +  L F  +++D      
Sbjct: 61  NFVIEMLFSTSLVVIVDK---NQGLQKSKKLKV-VNTKRKSTICELTFPHEIVDVVMNRK 116

Query: 236 KRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHR 273
           +  IL+ +  +F +     +  +   VL +K+KD +HR
Sbjct: 117 RMCILLSSDQIFIYDISCMKLLQTIDVLEDKLKDVVHR 154

>Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}
           YIL014C-A (REAL)
          Length = 107

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 28/63 (44%)

Query: 94  FVFKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQ 153
           ++  +   + + + L+  KL PT  NA +W        ++F + +   +C +  D   + 
Sbjct: 43  YILNVSAIDGIMETLVETKLVPTLENATQWVSDMSAYWSQFEYGEEPTYCPKSFDLNDFY 102

Query: 154 SFW 156
            +W
Sbjct: 103 EYW 105

>SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] {ON}
            highly similar to gnl|GLV|CAGL0J05610g Candida glabrata
            CAGL0J05610g uniprot|O93794 Candida glabrata DNA
            topoisomerase II identified start CAGL0J05610g|CAGL-
            IPF7937|CAGL-CDS0143.1 and similar to YNL088W
            uniprot|P06786 Saccharomyces cerevisiae YNL088W TOP2
            Essential type II topoisomerase catalyzes topology
            changes in DNA via transient breakage and rejoining of
            phosphodiester bonds in the DNA backbone localizes to
            axial cores in meiosis
          Length = 1448

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 402  NAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLR 461
            NA  +N  +E  + N  +   G  DY+  +K W+ T  +R E+L   ++E +V++  LL 
Sbjct: 1094 NANEENNDDEAGVINGPQEIYGTFDYLLGMKLWSLT-KERYEKLLNQQQEKEVELERLLS 1152

Query: 462  MPPSE 466
            +   +
Sbjct: 1153 LSAKD 1157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,873,136
Number of extensions: 2293745
Number of successful extensions: 5071
Number of sequences better than 10.0: 75
Number of HSP's gapped: 5040
Number of HSP's successfully gapped: 75
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)