Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_26.80252.534ON64643314e-42
KLTH0D06864g2.534ON167643022e-36
SAKL0A09504g2.534ON167642857e-34
TBLA0G022402.534ON167642604e-30
NCAS0F008902.534ON167642581e-29
KNAG0C058002.534ON167642562e-29
Kpol_348.92.534ON130652532e-29
Skud_13.2272.534ON167642544e-29
YMR071C (TVP18)2.534ON167642536e-29
TPHA0G035202.534ON204652556e-29
Smik_13.2502.534ON167642527e-29
Suva_13.2482.534ON167642529e-29
NDAI0H013902.534ON167642511e-28
TDEL0A030802.534ON167642502e-28
KAFR0A018702.534ON167642475e-28
CAGL0K03025g2.534ON167642458e-28
ZYRO0B02024g2.534ON166641892e-19
Ecym_72542.534ON167641684e-16
AGL072W2.534ON167641613e-15
KLLA0E18525g2.534ON171661353e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8025
         (64 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   132   4e-42
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   120   2e-36
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   114   7e-34
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   104   4e-30
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   103   1e-29
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   103   2e-29
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   102   2e-29
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   102   4e-29
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   102   6e-29
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   102   6e-29
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   101   7e-29
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   101   9e-29
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   101   1e-28
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   100   2e-28
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   100   5e-28
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...    99   8e-28
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...    77   2e-19
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...    69   4e-16
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...    67   3e-15
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...    57   3e-11

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
          YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  132 bits (331), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%)

Query: 1  MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
          MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV
Sbjct: 1  MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 61 REML 64
          REML
Sbjct: 61 REML 64

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  120 bits (302), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/64 (87%), Positives = 61/64 (95%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MAAVQWCS+A+M TSLI VA+GLTISAASY VAFFKHQQFQGTSVIK+PAD+DFPHEAVV
Sbjct: 104 MAAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  114 bits (285), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +QWCS+ALM TSLIVVA+GLTISAASY+VA+ KHQQFQ T++IKNP DEDFPHEAVV
Sbjct: 104 MAIIQWCSLALMTTSLIVVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  104 bits (260), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (85%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA VQWCSI L  TSLIVVA+GLTISA SY+VA+FK+Q+FQ  S+IKNP D+DFP EAVV
Sbjct: 104 MATVQWCSIILKATSLIVVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  103 bits (258), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (87%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+CSI LM TSLIVVA+GLTIS+ SY+VAF  HQ+FQ T++IKNPAD DFPHEAVV
Sbjct: 104 MAIIQYCSIILMATSLIVVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVV 163

Query: 61  REML 64
           REM+
Sbjct: 164 REMV 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  103 bits (256), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 56/64 (87%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+CS+ LMVTSL+VVA+ LT+SA  Y+VAF KHQ+FQ T++IKNPAD DFPHEAVV
Sbjct: 104 MAVIQYCSVILMVTSLLVVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  102 bits (253), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 48/65 (73%), Positives = 58/65 (89%), Gaps = 1/65 (1%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQ-GTSVIKNPADEDFPHEAV 59
           MA VQWCS+ALMVTSLIVVA+ LTISA  Y++A+FK+Q+FQ  T+VIKNP D+DFPH+AV
Sbjct: 66  MAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDFPHDAV 125

Query: 60  VREML 64
           VREML
Sbjct: 126 VREML 130

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  102 bits (254), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+ SIA+M TSLIVVAVGLTIS+ SY+VA+ KHQ+FQ T++IKNP D+DFPHEAVV
Sbjct: 104 MAVIQYVSIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  102 bits (253), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+ SIA+M TSLIVVAVGLTIS+ SY+VA+ KHQ+FQ T++IKNP D+DFPHEAVV
Sbjct: 104 MAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  102 bits (255), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/65 (76%), Positives = 57/65 (87%), Gaps = 1/65 (1%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTS-VIKNPADEDFPHEAV 59
           MA VQWCS+ L VTSLIVVA+GL+ISAA Y++AFFK Q+FQ TS VIKNP D+DFPHEAV
Sbjct: 140 MAIVQWCSLILKVTSLIVVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAV 199

Query: 60  VREML 64
           VREML
Sbjct: 200 VREML 204

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  101 bits (252), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+ SIA+M TSLIVVAVGLTIS+ SY+VA+ KHQ+FQ T++IKNP D+DFPHEAVV
Sbjct: 104 MAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  101 bits (252), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 57/64 (89%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+ SIA+M TSLIVVAVGLTIS+ SY+VA+ KHQ+FQ T+++KNP D+DFPHEAVV
Sbjct: 104 MATIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  101 bits (251), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 54/64 (84%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+CSIALM TSLIVVAVGLTIS+ SY++AF  HQ+FQ T ++KNP D DFP EAVV
Sbjct: 104 MAIIQYCSIALMATSLIVVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  100 bits (250), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 54/64 (84%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +QWCSIA+  TSLIVVAVGLTISA SY+VA  KHQ+FQ T ++K+P  +DFPHEAVV
Sbjct: 104 MAVIQWCSIAVQATSLIVVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score = 99.8 bits (247), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (82%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +Q+CSI LM TSLIVVA+ LT+S ASY +A FK Q+FQ T++IKNP D DFPHEAVV
Sbjct: 104 MAIIQYCSIILMATSLIVVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score = 99.0 bits (245), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA VQ+CS+A+M TSL+V+ + LTISA SY +AF KHQ+F  T++IKNP DEDFPH+AVV
Sbjct: 104 MAIVQYCSLAVMTTSLLVLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score = 77.4 bits (189), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 1/64 (1%)

Query: 2   AAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFP-HEAVV 60
           A +QW S+AL +TSLIVVAVGLTISAA Y VA+FKHQ FQ +S IK P  E    +E  V
Sbjct: 103 AVLQWASLALKITSLIVVAVGLTISAAFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNV 162

Query: 61  REML 64
           REML
Sbjct: 163 REML 166

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score = 69.3 bits (168), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 45/64 (70%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           MA +QW S+   VTSL+V+A+ LT+SA  Y+  +   Q+F+ ++V++ P  + FPHEA V
Sbjct: 104 MAVIQWVSLVFEVTSLVVLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASV 163

Query: 61  REML 64
           REML
Sbjct: 164 REML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score = 66.6 bits (161), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60
           +A VQ+ S+++ VTSL+ VA+GLTISA  Y   + K Q+F   +VI+NP D  F  EA V
Sbjct: 104 LAIVQYASLSVQVTSLLAVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAV 163

Query: 61  REML 64
           RE+L
Sbjct: 164 REVL 167

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score = 56.6 bits (135), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPAD--EDFPHEA 58
           M A+QWCSI +  TSLIVVAVGL+I+A  Y++     Q+F+ ++++ +         +EA
Sbjct: 106 MCAIQWCSIIVQSTSLIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEA 165

Query: 59  VVREML 64
           VVR+ML
Sbjct: 166 VVRDML 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.130    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,470,104
Number of extensions: 136635
Number of successful extensions: 529
Number of sequences better than 10.0: 21
Number of HSP's gapped: 527
Number of HSP's successfully gapped: 21
Length of query: 64
Length of database: 53,481,399
Length adjustment: 37
Effective length of query: 27
Effective length of database: 49,238,757
Effective search space: 1329446439
Effective search space used: 1329446439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)