Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_26.80212.533ON50750715900.0
KLTH0D06842g2.533ON5061184924e-55
SAKL0A09482g2.533ON3881303153e-31
TPHA0G035102.533ON3871313041e-29
KNAG0C058102.533ON5541193021e-28
TDEL0A030702.533ON2391152871e-28
ZYRO0B02002g2.533ON2941182902e-28
NCAS0A048002.533ON5111182904e-27
NDAI0H014002.533ON5411462905e-27
CAGL0K03003g2.533ON6471142891e-26
TBLA0G022302.533ON2161092665e-26
AGL071C2.533ON3961192741e-25
NDAI0K018602.533ON7301432792e-25
KAFR0A018602.533ON4901112753e-25
Kpol_1018.332.533ON5891172738e-25
NCAS0F009002.533ON5251382674e-24
KLLA0E18547g2.533ON4311222644e-24
Smik_13.2492.533ON4731352646e-24
Ecym_72552.533ON5441332657e-24
Skud_13.2262.533ON4751472541e-22
YMR070W (MOT3)2.533ON4901642523e-22
TBLA0I014802.533ON513622336e-20
Suva_13.2462.533ON419602246e-19
KNAG0A070402.533ON3521132191e-18
KAFR0J003402.533ON218632084e-18
TPHA0C041902.533ON417521901e-14
Kpol_185.32.598ON647561492e-09
NCAS0A129102.598ON822591492e-09
TPHA0C025802.598ON365561462e-09
CAGL0M13189g2.598ON541561482e-09
ZYRO0F01012g2.598ON584561473e-09
NCAS0H030802.598ON730561465e-09
KNAG0H005502.598ON620561456e-09
NDAI0C005602.598ON972561456e-09
Suva_11.1642.598ON639561447e-09
Smik_11.1862.598ON641561431e-08
YKL062W (MSN4)2.598ON630561431e-08
ABR089C2.598ON571561412e-08
Skud_11.1672.598ON628561412e-08
KLLA0F26961g2.598ON694561412e-08
TBLA0G019202.598ON523561402e-08
TPHA0N014602.598ON519561402e-08
KAFR0F020702.598ON370561392e-08
SAKL0B11330g2.598ON499561383e-08
NDAI0B013402.598ON769561394e-08
TDEL0B069102.598ON437561365e-08
Kwal_26.83512.598ON698561375e-08
CAGL0K02145g8.144ON317601345e-08
Ecym_23012.598ON767621375e-08
TBLA0H028302.598ON746561376e-08
Suva_13.2062.598ON709561367e-08
KNAG0M023102.598ON660561367e-08
CAGL0F05995g2.598ON597511359e-08
KLTH0D08734g2.598ON677561359e-08
Smik_13.2072.598ON703561351e-07
YMR037C (MSN2)2.598ON704561341e-07
KAFR0A023202.598ON443561331e-07
Kpol_1031.428.144ON359571321e-07
Skud_13.1932.598ON704561341e-07
NDAI0B019308.144ON436601312e-07
Kpol_1013.212.598ON494561312e-07
SAKL0H24816g8.144ON410511303e-07
KLTH0E06688g8.144ON397511284e-07
KLLA0C17072g8.144ON474511294e-07
Skud_5.2488.144ON442621284e-07
Smik_5.2768.144ON442591284e-07
Suva_5.2518.144ON449591276e-07
Kwal_47.172418.144ON403511276e-07
YER130C8.144ON443601276e-07
TPHA0D010508.144ON439511278e-07
CAGL0L06072g8.144ON300561258e-07
KNAG0D041904.214ON1010631271e-06
NCAS0B046008.144ON547601251e-06
TDEL0B046708.144ON312511231e-06
KNAG0D021208.144ON402511241e-06
Kwal_47.190453.518ON266521222e-06
ACL057W8.144ON520511232e-06
ZYRO0G19140g8.144ON557511232e-06
KNAG0G012808.144ON472551223e-06
ZYRO0B07568g4.214ON6161101233e-06
Ecym_84038.144ON573511223e-06
KLTH0G01826g3.518ON307521203e-06
NDAI0D042404.214ON1169881233e-06
Kpol_529.138.425ON1410621224e-06
Ecym_4128na 1ON312591194e-06
KAFR0B021608.144ON453511204e-06
SAKL0F01980g3.518ON385511195e-06
SAKL0H04070g4.214ON899581215e-06
TPHA0C021608.425ON1375521206e-06
AFR580C4.214ON838601206e-06
KAFR0G030504.214ON749521207e-06
ZYRO0B14894g4.351ON11191111207e-06
NDAI0G034208.144ON484761188e-06
Suva_7.523.518ON400521188e-06
TBLA0I027004.214ON737551199e-06
Ecym_27604.214ON938771199e-06
TDEL0E015904.214ON7701081199e-06
KLLA0F13046g8.425ON1379621199e-06
KLLA0B07909g4.214ON922651191e-05
TBLA0F003708.144ON687551181e-05
TPHA0A039103.298ON351811161e-05
Smik_13.3876.256ON212921131e-05
Skud_7.3644.214ON810941181e-05
TBLA0E04210singletonON454591171e-05
NCAS0A023104.214ON879661181e-05
CAGL0K04631g4.214ON1013501181e-05
Kwal_26.80112.531ON190521111e-05
ZYRO0E08426g3.518ON171521102e-05
NCAS0B028408.425ON1152551172e-05
AGR186Cna 1ON287511142e-05
KAFR0B025508.234ON890531162e-05
KNAG0I020702.162ON572611152e-05
KNAG0G018708.234ON875531152e-05
Kpol_472.104.214ON830501152e-05
KAFR0C029808.144ON225511112e-05
NDAI0C048608.425ON1350571162e-05
YGL209W (MIG2)3.518ON382521143e-05
KNAG0B005903.518ON439521143e-05
Kpol_1052.83.298ON386581143e-05
SAKL0H12958g8.425ON1129551153e-05
KAFR0C003403.298ON394531143e-05
AGR172W8.425ON1057671153e-05
CAGL0E04884g8.425ON1489711153e-05
TPHA0A019408.234ON912531153e-05
TBLA0F038308.234ON967521153e-05
TBLA0I032803.518ON330901123e-05
NCAS0C040708.144ON289501114e-05
Smik_7.543.518ON382521124e-05
Suva_7.3494.214ON812941144e-05
NDAI0B060203.518ON426521124e-05
ZYRO0B11770g8.234ON867531134e-05
TDEL0F055008.425ON1207551144e-05
YGR067C4.214ON804821134e-05
KAFR0B063608.425ON627621134e-05
Skud_7.593.518ON383521124e-05
Kpol_1032.528.234ON824531134e-05
Smik_6.1504.214ON806521134e-05
Kpol_1050.193.518ON221561095e-05
TDEL0A013008.234ON837531135e-05
Smik_4.3378.234ON894521126e-05
KAFR0I023703.518ON391521116e-05
TBLA0E042208.234ON519651116e-05
Skud_4.3548.234ON916521126e-05
YDR096W (GIS1)8.234ON894521126e-05
YDR216W (ADR1)8.425ON1323531127e-05
ADL051Wna 2ON173471067e-05
Suva_2.2558.234ON894521127e-05
Kwal_47.166214.351ON1178551127e-05
Suva_2.3838.425ON1319531127e-05
ZYRO0A09416g8.425ON1346551127e-05
KNAG0G011408.117ON519721117e-05
AGR117C8.234ON799531117e-05
Ecym_35208.234ON819531117e-05
TPHA0B003804.351ON1310551118e-05
YML081W (TDA9)4.351ON12511121118e-05
KNAG0A044608.425ON1290551118e-05
Smik_4.4638.425ON1324531118e-05
KLTH0D18062g4.351ON1128551118e-05
Skud_5.3088.234ON802811119e-05
KNAG0M003504.351ON1076601119e-05
Skud_4.4788.425ON1323531119e-05
TDEL0F026904.80ON350541099e-05
KLLA0F20636gsingletonON285491089e-05
CAGL0L11880g8.234ON980521109e-05
SAKL0D06776g1.326ON767531101e-04
KLLA0E08713g2.303ON596931091e-04
YER169W (RPH1)8.234ON796521101e-04
KAFR0B068104.351ON1155551101e-04
KNAG0J022503.296ON296821071e-04
SAKL0H20988g4.80ON548541091e-04
SAKL0G18062g4.351ON1238621091e-04
YMR182C (RGM1)6.256ON211891051e-04
TBLA0B012802.162ON823501091e-04
Smik_5.3418.234ON798521091e-04
Kpol_1001.14.351ON1341551091e-04
Smik_5.1513.518ON3881041071e-04
Suva_5.3038.234ON797521091e-04
TDEL0D058603.518ON330951071e-04
KNAG0H030108.234ON784531082e-04
Ecym_21596.256ON460581072e-04
ADL042Wna 3ON281491062e-04
Ecym_8379na 3ON305491062e-04
Klac_YGOB_Anc_3.5183.518ON239521052e-04
NCAS0E006103.518ON401521072e-04
KLTH0E09922g8.425ON1119551082e-04
NCAS0A062504.351ON13411111082e-04
TBLA0B061604.351ON1384551082e-04
NDAI0I029003.518ON524521072e-04
AER159C4.351ON1191621082e-04
CAGL0H04213g4.351ON13211081082e-04
Suva_13.704.351ON777681072e-04
Skud_5.1373.518ON394581062e-04
Suva_16.5187.543ON427351062e-04
CAGL0K04697g4.222ON5151191062e-04
KLLA0B04477g4.351ON1332761072e-04
NDAI0D032404.351ON1362551072e-04
SAKL0H17842g8.234ON814531073e-04
Skud_10.3514.351ON1327791073e-04
KLTH0G14454g8.234ON832531063e-04
NDAI0B022508.234ON1156521073e-04
NCAS0A152707.543ON433441053e-04
KAFR0F041503.518ON416521053e-04
NCAS0B048408.234ON864531063e-04
TDEL0D006704.351ON1199551063e-04
NCAS0G037302.303ON571671063e-04
KAFR0A008001.326ON753501063e-04
KLTH0H09196g4.80ON460541053e-04
Skud_16.2438.486ON177671013e-04
Ecym_25368.486ON240641033e-04
Kwal_56.234538.234ON828531063e-04
Smik_13.584.351ON1253741063e-04
Kwal_14.22784.80ON463591053e-04
Smik_10.4204.351ON1348791064e-04
Suva_12.2184.351ON1270791054e-04
CAGL0L03916g2.162ON642651054e-04
Skud_13.3486.256ON216761014e-04
KLLA0C17710g8.234ON821531054e-04
YJR127C (RSF2)4.351ON1380791054e-04
CAGL0M00594g4.351ON1020851054e-04
ADL198W2.303ON547551044e-04
CAGL0K09372g3.518ON396521044e-04
Suva_13.3636.256ON211871014e-04
TBLA0H006608.425ON1311521054e-04
Ecym_8387na 4ON179671005e-04
CAGL0A01628g4.80ON424601035e-04
TBLA0A016058.486ON224681015e-04
Skud_13.614.351ON1253781045e-04
AEL278W7.543ON476481035e-04
NDAI0C06260na 5ON582621035e-04
TBLA0B060502.303ON762551046e-04
SAKL0E10714g2.162ON819501036e-04
Suva_14.3182.303ON681711036e-04
KLTH0G10802g2.303ON526691036e-04
CAGL0C02519g3.518ON318521026e-04
Kpol_1050.1097.543ON384471026e-04
AFR531Wna 6ON274621017e-04
KNAG0H019302.303ON618551037e-04
Kpol_423.153.518ON392501027e-04
Suva_2.4198.486ON19164997e-04
KNAG0E016003.518ON338511017e-04
TBLA0G032403.298ON511511027e-04
TBLA0F013001.326ON985531037e-04
Ecym_14154.80ON504541027e-04
CAGL0E06116g6.256ON613621037e-04
KLLA0F01463g1.326ON781501037e-04
NDAI0B042902.162ON1064691037e-04
NDAI0A075403.298ON370781018e-04
KLTH0E11330g8.486ON19962998e-04
KNAG0D037104.80ON459641028e-04
CAGL0J05060g1.326ON713451028e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8021
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   617   0.0  
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   194   4e-55
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   125   3e-31
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   121   1e-29
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   120   1e-28
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   115   1e-28
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   116   2e-28
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   116   4e-27
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   116   5e-27
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   115   1e-26
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   107   5e-26
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   110   1e-25
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   112   2e-25
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   110   3e-25
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   109   8e-25
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   107   4e-24
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   106   4e-24
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   106   6e-24
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   106   7e-24
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   102   1e-22
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   101   3e-22
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    94   6e-20
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    91   6e-19
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    89   1e-18
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       85   4e-18
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    78   1e-14
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    62   2e-09
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    62   2e-09
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    61   2e-09
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    62   2e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    61   3e-09
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    61   5e-09
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    60   6e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     60   6e-09
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    60   7e-09
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    60   1e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    60   1e-08
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    59   2e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    59   2e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    59   2e-08
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    59   2e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    59   2e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    58   2e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    58   3e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     58   4e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    57   5e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    57   5e-08
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    56   5e-08
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    57   5e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    57   6e-08
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    57   7e-08
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    57   7e-08
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    57   9e-08
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    57   9e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    57   1e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    56   1e-07
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    56   1e-07
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    55   1e-07
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    56   1e-07
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     55   2e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    55   2e-07
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    55   3e-07
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    54   4e-07
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    54   4e-07
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    54   4e-07
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    54   4e-07
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    54   6e-07
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    54   6e-07
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    54   6e-07
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    54   8e-07
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    53   8e-07
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    54   1e-06
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    53   1e-06
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    52   1e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    52   1e-06
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    52   2e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    52   2e-06
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    52   2e-06
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    52   3e-06
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    52   3e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    52   3e-06
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    51   3e-06
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    52   3e-06
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    52   4e-06
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    50   4e-06
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    51   4e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    50   5e-06
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    51   5e-06
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    51   6e-06
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    51   6e-06
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    51   7e-06
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    51   7e-06
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    50   8e-06
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    50   8e-06
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    50   9e-06
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    50   9e-06
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    50   9e-06
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    50   9e-06
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    50   1e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    50   1e-05
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    49   1e-05
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    48   1e-05
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    50   1e-05
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             50   1e-05
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    50   1e-05
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    50   1e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    47   1e-05
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    47   2e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    50   2e-05
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    49   2e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    49   2e-05
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    49   2e-05
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    49   2e-05
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    49   2e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    47   2e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    49   2e-05
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    49   3e-05
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    49   3e-05
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    49   3e-05
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    49   3e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    49   3e-05
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    49   3e-05
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    49   3e-05
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    49   3e-05
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    49   3e-05
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    48   3e-05
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      47   4e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    48   4e-05
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    49   4e-05
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    48   4e-05
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    48   4e-05
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    49   4e-05
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    48   4e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    48   4e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    48   4e-05
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    48   4e-05
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    48   4e-05
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    47   5e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    48   5e-05
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    48   6e-05
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    47   6e-05
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    47   6e-05
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    48   6e-05
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    48   6e-05
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    48   7e-05
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    45   7e-05
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    48   7e-05
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    48   7e-05
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    48   7e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    48   7e-05
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    47   7e-05
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    47   7e-05
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    47   7e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    47   8e-05
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    47   8e-05
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    47   8e-05
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    47   8e-05
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    47   8e-05
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    47   9e-05
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    47   9e-05
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    47   9e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    47   9e-05
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    46   9e-05
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    47   9e-05
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    47   1e-04
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    47   1e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    47   1e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    47   1e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               46   1e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    47   1e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    47   1e-04
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    45   1e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    47   1e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    47   1e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    47   1e-04
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    46   1e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    47   1e-04
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    46   1e-04
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    46   2e-04
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    46   2e-04
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    45   2e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    45   2e-04
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    45   2e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     46   2e-04
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    46   2e-04
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    46   2e-04
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    46   2e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    46   2e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    46   2e-04
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    46   2e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    46   2e-04
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    45   2e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    45   2e-04
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    45   2e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    46   2e-04
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    46   2e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    46   3e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    46   3e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    45   3e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    46   3e-04
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    45   3e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    45   3e-04
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     45   3e-04
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    45   3e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     45   3e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    45   3e-04
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    45   3e-04
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    44   3e-04
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    44   3e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    45   3e-04
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    45   3e-04
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    45   3e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    45   4e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    45   4e-04
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    45   4e-04
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    44   4e-04
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    45   4e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    45   4e-04
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    45   4e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    45   4e-04
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    45   4e-04
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    44   4e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    45   4e-04
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    43   5e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    44   5e-04
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                44   5e-04
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    45   5e-04
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    44   5e-04
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             44   5e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    45   6e-04
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    44   6e-04
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    44   6e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    44   6e-04
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    44   6e-04
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    44   6e-04
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    44   7e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    44   7e-04
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    44   7e-04
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    43   7e-04
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    44   7e-04
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     44   7e-04
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    44   7e-04
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    44   7e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    44   7e-04
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    44   7e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    44   7e-04
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    44   8e-04
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    43   8e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    44   8e-04
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    44   8e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    44   8e-04
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    44   8e-04
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    44   9e-04
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    44   0.001
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    43   0.001
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   0.001
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    44   0.001
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    44   0.001
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    44   0.001
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    44   0.001
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    43   0.001
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    44   0.001
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    43   0.001
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    43   0.001
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    44   0.001
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    41   0.001
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    44   0.001
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    43   0.001
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    44   0.001
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    43   0.001
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    42   0.001
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    41   0.001
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    43   0.002
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    43   0.002
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    43   0.002
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    43   0.002
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    43   0.002
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    43   0.002
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    43   0.002
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    43   0.002
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    43   0.002
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    40   0.002
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    43   0.002
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    42   0.002
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    43   0.002
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    41   0.002
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   0.002
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    42   0.002
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    42   0.002
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    42   0.002
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    42   0.002
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    43   0.002
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    42   0.002
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    41   0.003
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    42   0.003
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    42   0.003
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    41   0.003
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      42   0.003
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    42   0.003
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    41   0.003
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    42   0.003
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    42   0.003
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    41   0.003
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    42   0.003
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    42   0.003
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    42   0.003
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    42   0.003
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    42   0.003
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    42   0.003
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    42   0.003
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    42   0.003
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    40   0.003
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    41   0.003
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    42   0.003
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    42   0.003
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    42   0.003
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    40   0.003
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    41   0.003
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    42   0.004
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    42   0.004
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    42   0.004
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    41   0.004
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      42   0.004
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    42   0.004
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    42   0.004
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    42   0.004
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    41   0.004
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    41   0.004
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    41   0.005
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    42   0.005
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    42   0.005
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    40   0.005
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    41   0.005
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    40   0.005
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               41   0.005
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    40   0.005
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    40   0.006
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    42   0.006
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    41   0.006
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    41   0.006
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    41   0.006
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    41   0.006
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    41   0.006
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    41   0.006
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    41   0.006
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    40   0.006
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    41   0.006
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    41   0.006
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    41   0.006
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    40   0.007
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    39   0.007
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    41   0.007
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    41   0.007
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      41   0.007
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    41   0.007
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    41   0.007
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    40   0.007
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    41   0.007
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    41   0.007
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    41   0.007
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    41   0.008
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    40   0.008
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    41   0.008
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                40   0.008
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    41   0.008
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    40   0.008
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    40   0.008
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    40   0.008
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    40   0.008
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    41   0.008
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    40   0.009
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    41   0.009
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               40   0.009
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    40   0.009
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    40   0.009
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    40   0.009
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    40   0.009
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    40   0.010
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                40   0.010
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    40   0.010
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    39   0.010
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.011
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    40   0.011
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    40   0.011
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    40   0.011
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    40   0.011
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    40   0.011
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    40   0.012
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    40   0.012
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     40   0.012
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    40   0.012
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    40   0.012
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    40   0.012
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    40   0.012
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    40   0.012
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    40   0.012
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    40   0.012
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    40   0.012
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    40   0.012
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    39   0.012
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    40   0.012
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    40   0.013
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    40   0.013
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    40   0.013
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     40   0.013
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    40   0.014
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      39   0.014
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    40   0.014
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    39   0.015
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    40   0.016
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    39   0.016
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    40   0.016
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    39   0.016
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    39   0.017
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    40   0.017
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    40   0.017
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    40   0.018
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    40   0.018
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               39   0.019
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    39   0.019
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    40   0.019
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    40   0.019
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    39   0.020
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    39   0.020
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    39   0.022
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    39   0.023
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    39   0.023
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    39   0.023
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    39   0.023
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     39   0.024
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    39   0.024
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    38   0.024
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     39   0.025
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     39   0.025
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    39   0.027
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    39   0.028
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    39   0.028
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    39   0.030
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               39   0.030
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    39   0.031
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    38   0.033
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    39   0.034
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    39   0.036
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    37   0.037
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    39   0.037
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    39   0.038
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    38   0.040
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    37   0.040
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.041
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    39   0.041
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    38   0.042
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    38   0.042
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      38   0.042
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    38   0.042
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    37   0.043
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    38   0.048
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    38   0.049
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    38   0.050
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             38   0.055
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    38   0.055
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    37   0.056
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    37   0.056
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    38   0.058
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    38   0.058
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    37   0.058
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    38   0.061
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    37   0.061
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                37   0.063
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    37   0.063
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    37   0.066
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    37   0.067
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    36   0.069
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    37   0.072
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    37   0.073
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    34   0.073
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    37   0.073
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    37   0.082
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    37   0.087
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    37   0.092
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    37   0.095
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    37   0.098
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    37   0.098
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    37   0.098
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    37   0.10 
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    37   0.10 
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    37   0.11 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    36   0.11 
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    37   0.12 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    37   0.12 
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    36   0.14 
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    36   0.14 
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    36   0.14 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    36   0.14 
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    37   0.15 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    36   0.15 
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               37   0.15 
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    36   0.15 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.16 
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    37   0.16 
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    36   0.16 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    36   0.17 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    35   0.18 
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      36   0.18 
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    36   0.18 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    36   0.18 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    36   0.19 
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    36   0.19 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    36   0.20 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.20 
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    36   0.21 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    36   0.21 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    35   0.22 
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    36   0.23 
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    36   0.23 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    36   0.24 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    35   0.26 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    36   0.26 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    35   0.27 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.27 
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    36   0.29 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    36   0.29 
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    35   0.29 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    35   0.30 
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    35   0.31 
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    35   0.31 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    35   0.34 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    35   0.34 
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    35   0.35 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      35   0.36 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    35   0.37 
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    35   0.37 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    35   0.39 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    35   0.40 
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    35   0.43 
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    35   0.47 
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    35   0.50 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    35   0.50 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    34   0.50 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    35   0.55 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    35   0.61 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    34   0.63 
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    35   0.64 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    34   0.66 
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     34   0.75 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    34   0.78 
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    34   0.79 
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    34   0.87 
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    34   0.90 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    34   0.91 
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 34   0.98 
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    32   1.00 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    33   1.0  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    34   1.1  
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    34   1.1  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    34   1.1  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    34   1.1  
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    33   1.2  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    33   1.4  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.4  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    33   1.4  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    33   1.6  
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    33   1.7  
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.7  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    33   1.8  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    33   1.9  
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    33   2.1  
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    33   2.1  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    33   2.2  
TDEL0A01830 Chr1 complement(332279..335968) [3690 bp, 1229 aa] {...    33   2.4  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    33   2.6  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    32   2.6  
Kpol_1002.4 s1002 complement(8436..9872) [1437 bp, 478 aa] {ON} ...    32   2.7  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  32   2.7  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    32   2.8  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    32   2.9  
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    32   3.1  
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      32   3.1  
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    32   3.2  
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    32   3.3  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  32   3.5  
KAFR0A05850 Chr1 complement(1184001..1185713) [1713 bp, 570 aa] ...    32   3.7  
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    32   3.8  
TBLA0I03040 Chr9 (726297..728009) [1713 bp, 570 aa] {ON} Anc_4.2...    32   3.8  
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      32   4.0  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    32   4.0  
Ecym_3253 Chr3 complement(481569..483458) [1890 bp, 629 aa] {ON}...    32   4.1  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    32   4.5  
KLLA0B03047g Chr2 complement(275298..277343) [2046 bp, 681 aa] {...    32   4.5  
KLTH0D14718g Chr4 (1206105..1208195) [2091 bp, 696 aa] {ON} some...    32   4.7  
SAKL0G15752g Chr7 (1355625..1357604) [1980 bp, 659 aa] {ON} some...    32   5.2  
AER071W Chr5 (767038..768891) [1854 bp, 617 aa] {ON} Syntenic ho...    32   5.2  
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    32   5.6  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    32   5.6  
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    31   5.9  
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    31   6.5  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    32   7.0  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    31   7.1  
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    31   7.2  
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    31   7.3  
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       29   7.6  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    31   7.6  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    30   7.7  
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    31   7.8  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    31   8.4  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    31   8.6  
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    31   8.7  
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    31   9.3  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    31   9.4  
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    30   9.8  
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    30   9.8  

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/507 (64%), Positives = 326/507 (64%)

Query: 1   MLSAHSFEGDSGLDSETHTEANNSTTSTQPPMXXXXXXXXXXXXXVGSDPMRTTTRVGSS 60
           MLSAHSFEGDSGLDSETHTEANNSTTSTQPPM             VGSDPMRTTTRVGSS
Sbjct: 1   MLSAHSFEGDSGLDSETHTEANNSTTSTQPPMAFRRRSSAASLASVGSDPMRTTTRVGSS 60

Query: 61  SHGTWVXXXXXXXXXXXXXXXXXXXXXXXXXXVSTHYSVAPIHSQAQSIRQTPAWDTAAS 120
           SHGTWV                          VSTHYSVAPIHSQAQSIRQTPAWDTAAS
Sbjct: 61  SHGTWVPPYAAAAAAPPPPPMQLPAPLPAPAPVSTHYSVAPIHSQAQSIRQTPAWDTAAS 120

Query: 121 PGSAPQLQQYPNTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFRGSFSEYTEY 180
           PGSAPQLQQYPNTL                                  YFRGSFSEYTEY
Sbjct: 121 PGSAPQLQQYPNTLQAQYPVPSQAQPQSPQAPGHAQQPQQPQQPQQAPYFRGSFSEYTEY 180

Query: 181 DQRYVPYYYKPAYPGWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           DQRYVPYYYKPAYPGWG                                           
Sbjct: 181 DQRYVPYYYKPAYPGWGPPQPLPPPPPPAQQQSQQHQPPYQQQPQPHPQQQQQQHHHHLQ 240

Query: 241 XXXXXXXAAWNPYQVPSHAFGTHHVPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                  AAWNPYQVPSHAFGTHHVPN                                 
Sbjct: 241 QQHPYQAAAWNPYQVPSHAFGTHHVPNQQQQPQQQQQQQHTPQTQPQSQSQPQSQLQQAP 300

Query: 301 XXYKQTYNQGFAPASDRPQMQPQPQRWATEMPQSAYMPDPQHIGALXXXXXXXXXXXXXX 360
             YKQTYNQGFAPASDRPQMQPQPQRWATEMPQSAYMPDPQHIGAL              
Sbjct: 301 TPYKQTYNQGFAPASDRPQMQPQPQRWATEMPQSAYMPDPQHIGALAARQYAGGYGSGSA 360

Query: 361 XXXXXXXXXLLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCP 420
                    LLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCP
Sbjct: 361 AGPDSGPVALLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCP 420

Query: 421 WCQSRHKRRDNLFQHMKTKHVRHVVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQ 480
           WCQSRHKRRDNLFQHMKTKHVRHVVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQ
Sbjct: 421 WCQSRHKRRDNLFQHMKTKHVRHVVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQ 480

Query: 481 DGQVKKERVKAVLNAVIARVNGEINEP 507
           DGQVKKERVKAVLNAVIARVNGEINEP
Sbjct: 481 DGQVKKERVKAVLNAVIARVNGEINEP 507

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  194 bits (492), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 104/118 (88%), Gaps = 1/118 (0%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446
           + YRCSMC+KSFKR+SWH+RHLLSHSSFKPY+CPWCQSRHKRRDNLFQHMKTKHV  V+Q
Sbjct: 386 MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445

Query: 447 ELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARV-NGE 503
           EL+E GD+DGS+ + +++  D+    PSI+TL+QDG+VKKERVK VLNAVIARV +GE
Sbjct: 446 ELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGE 503

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 172 GSFSEYTEYDQRYVPYYYKPAYPGW 196
           G   E  EYD RY+PY+YK AYP W
Sbjct: 146 GPLYELMEYDTRYLPYHYKSAYPMW 170

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  125 bits (315), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 15/130 (11%)

Query: 385 PPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHV 444
           P   ++C +CDKSFKR+SW KRHLLSHSS KP++CPWCQSRHKR+DNL QHMK KH   V
Sbjct: 254 PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQV 313

Query: 445 VQELLEVG---DVDGSVMSGMQVTSDES------------APEPSIKTLIQDGQVKKERV 489
           +QEL   G    V    +  +  T+ ++            +   SIKT+I DG + K+ V
Sbjct: 314 LQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDV 373

Query: 490 KAVLNAVIAR 499
           K VLN +I R
Sbjct: 374 KRVLNMLINR 383

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  121 bits (304), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 20/131 (15%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           +RC++C K FKR+SW KRHLLSHSS + YSCPWC S+HKR+DNL QHMK KH + V+QE+
Sbjct: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313

Query: 449 -------LEVGD------------VDGSVMSGMQVTSDESAPEP-SIKTLIQDGQVKKER 488
                  LE+ D            V+ + +S +   S  S+ +  SI  ++ +G +KKE 
Sbjct: 314 DKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKKEN 373

Query: 489 VKAVLNAVIAR 499
           VK VLN++I R
Sbjct: 374 VKKVLNSIIER 384

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  120 bits (302), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 74/119 (62%), Gaps = 6/119 (5%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C +C+KSFKRRSW KRHLLSHS+ + Y CPWC SRHKR+DNL QHMK KH  +++ EL
Sbjct: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495

Query: 449 LEV------GDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVN 501
                    G  DG   +     +    P+ SIK L+  G + K+ VK VLN +I R N
Sbjct: 496 KNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  115 bits (287), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 79/115 (68%), Gaps = 10/115 (8%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
            ++C +C+KSFKR+SW +RHLLSHS  + +SCPWC S+HKR+DNL QHMK KH  +V+QE
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192

Query: 448 LLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNG 502
            L + +V           S E + + +I+TL+ +G++ K+ VK VLN++I R N 
Sbjct: 193 -LRLNNV---------YVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHNN 237

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  116 bits (290), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 15/118 (12%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446
           +++ C MCDKSFKR+SW +RHLLSHS  + + CPWC S+HKR+DNL QHMK KH  +V++
Sbjct: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE 249

Query: 447 ELL--EVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNG 502
           +L    VG +DG V +             +I+TL+ +G++ KE VK VLN +I   NG
Sbjct: 250 KLRNQNVG-IDGEVRND------------NIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  116 bits (290), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 75/118 (63%), Gaps = 1/118 (0%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  Y+C MC KSF+R SW KRHLL+HSS + YSCP C S+HKR+DNL QH+K KH   V+
Sbjct: 384 PSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVL 443

Query: 446 QELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNGE 503
           ++L +  ++D             +A   +IKTL+ +G++ KE VK VLN +I   N E
Sbjct: 444 EQLRQ-DNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLIDSANQE 500

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  116 bits (290), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 78/146 (53%), Gaps = 34/146 (23%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
           +YRC +C+K FKRRSW KRHLLSHSS + Y CPWC SRHKRRDNL QHMK KH  +++ E
Sbjct: 399 SYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINE 458

Query: 448 L-------------------------LEVGDVDGSVMSGMQVTSDESAPEP------SIK 476
           L                         + + D   + ++G   T D +   P      +IK
Sbjct: 459 LKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAG---TVDNAVSTPGYETGITIK 515

Query: 477 TLIQDGQVKKERVKAVLNAVIARVNG 502
            LI +G + KE VK +LN +I   N 
Sbjct: 516 DLISEGLINKEDVKRLLNILIDEYNN 541

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           +RC +C K FKR+SW KRHLLSHS  + + CPWC SRHKRRDNL QHMK KHV +++QE+
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

Query: 449 LEVG-DVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVN 501
                  +  ++  +    D +   P  KTLI +G + K+ +K +LN VI + N
Sbjct: 594 NSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTVIDKHN 647

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  107 bits (266), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 7/109 (6%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+K FKR+SW KRH+LSHS  + YSCPWC SRHKR+DNL QHMK KH   V+++L
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 449 LEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVI 497
                ++G          +E     +I+T++ +G + K+ VK VLN ++
Sbjct: 173 KMTCYLEGD-------DGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELL 214

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  110 bits (274), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 75/119 (63%), Gaps = 11/119 (9%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+K+FKR+SW KRHLLSHS+ KPYSCPWC SRHKR+DNL QH+K KH   +++ L
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 244

Query: 449 LEVGDVDGSVMSGMQVTSDESAPEP----------SIKTLIQDGQVKKERVKAVLNAVI 497
               +   S+++ +  +SD +A             SIK +I  G + K  VK  LN++I
Sbjct: 245 SSNPNTPTSLINRLH-SSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVKKTLNSLI 302

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 82/143 (57%), Gaps = 24/143 (16%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
            ++CS C KSFKR SW KRHLL+HS  + YSCPWC S+HKR+DNL QH+K KH   V+Q+
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 448 L----LEVGDVD--------------GSVMSGMQVTSDE------SAPEPSIKTLIQDGQ 483
           L    +E+  ++               SV +G    +D+        P  +IKTL+ DG+
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 484 VKKERVKAVLNAVIARVNGEINE 506
           + KE VK VLN ++   N   ++
Sbjct: 679 LNKEDVKKVLNKLLDGTNSTFSD 701

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  110 bits (275), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (64%), Gaps = 3/111 (2%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446
           + + C +C+KSF+R+SW KRHLLSHS+ + + CPWC SRHKR+DNL QHMK KH  ++V 
Sbjct: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410

Query: 447 ELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVI 497
           EL +   V   V  G +   +++     I+ LI  G + K+ VK V+N +I
Sbjct: 411 ELKKNNAVFSCVNGGNREKLNDT---DDIRNLISLGVINKDDVKKVINKLI 458

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  109 bits (273), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 78/117 (66%), Gaps = 8/117 (6%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
           A+ C +C K FKR+SW +RHLLSHSS + + CPWC S+HKR+DNL QHMK KH  +V+++
Sbjct: 476 AHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQ 535

Query: 448 L---LEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVN 501
           L   L+  + + +    ++   D      +I+TL+ +G + K+ VK +LN+++A+ N
Sbjct: 536 LRINLKANNPNDNSEPTLEGNGDH-----NIRTLMGEGILNKDEVKKLLNSLVAQHN 587

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  107 bits (267), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 72/138 (52%), Gaps = 22/138 (15%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
            Y C +C K+FKRRSW KRHLLSHSS + Y CPWC SRHKRRDNL QHMK KH ++++ E
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 448 LLEVGDV---------------DGSVMSGMQVTSDESAPEP-------SIKTLIQDGQVK 485
           L     +                     G        A EP       +I+TL+ +G V 
Sbjct: 447 LKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGVVN 506

Query: 486 KERVKAVLNAVIARVNGE 503
           KE VK VLN ++     E
Sbjct: 507 KEDVKRVLNQLVDENENE 524

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 76/122 (62%), Gaps = 12/122 (9%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
           +Y+C +C+K F+R+SW KRHLLSHS+ K + CPWC S HKR+DNL QH+K KH ++++ E
Sbjct: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364

Query: 448 ------LLEVGDVDGSVMSGMQVTSDESA------PEPSIKTLIQDGQVKKERVKAVLNA 495
                 L+ V +  G+  + +  ++ E+       P  +I+ ++    + K++VK  LN 
Sbjct: 365 FTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNY 424

Query: 496 VI 497
           ++
Sbjct: 425 IV 426

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  106 bits (264), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (54%), Gaps = 22/135 (16%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR+DNL QHMK KH  +++ EL
Sbjct: 338 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 397

Query: 449 LEVGDVDGSVMSGMQV----------------------TSDESAPEPSIKTLIQDGQVKK 486
            +   +     S +                          D ++ +P+IKTLI DG + K
Sbjct: 398 KKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLNK 457

Query: 487 ERVKAVLNAVIARVN 501
           + VK VLN +I   N
Sbjct: 458 DDVKRVLNNLIVSHN 472

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  106 bits (265), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 72/133 (54%), Gaps = 24/133 (18%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+K+FKR+SW KRHLLSHS+ KPYSCPWC SRHKR+DNL QH+K KH   +++ L
Sbjct: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345

Query: 449 LEVGDVDGSVM-------SGMQVTSDESAPEP-----------------SIKTLIQDGQV 484
               +    +M       +G    +  SA                    SIK +I  G +
Sbjct: 346 SSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGML 405

Query: 485 KKERVKAVLNAVI 497
            K  VK  LN++I
Sbjct: 406 SKNEVKKTLNSLI 418

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 75/147 (51%), Gaps = 34/147 (23%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR+DNL QHMK KH  +++ EL
Sbjct: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387

Query: 449 LEVGDV----------------------------------DGSVMSGMQVTSDESAPEPS 474
            +   +                                   G+  +      D S+ +P+
Sbjct: 388 KKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDPN 447

Query: 475 IKTLIQDGQVKKERVKAVLNAVIARVN 501
           IKTLI DG + K+ VK VLN +I   N
Sbjct: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 78/164 (47%), Gaps = 37/164 (22%)

Query: 375 SNGPFGMGLVPP------VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKR 428
           S+ P    LVP         ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR
Sbjct: 326 SSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKR 385

Query: 429 RDNLFQHMKTKHVRHVVQELLEVGDV-----------------------DGSVMSGMQVT 465
           +DNL QHMK KH  +++ EL +   +                                  
Sbjct: 386 KDNLLQHMKLKHTNYLLDELKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAA 445

Query: 466 SDESAPE--------PSIKTLIQDGQVKKERVKAVLNAVIARVN 501
           +  +APE         +IKTLI DG + K+ VK VLN +I   N
Sbjct: 446 AAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRVLNNLIVSHN 489

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 51/62 (82%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446
           + ++C +C+KSFKR+SW KRHLLSHS  + +SCP C S+HKR+DNL QH+K KH+ ++++
Sbjct: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILK 397

Query: 447 EL 448
           +L
Sbjct: 398 KL 399

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (76%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR+DNL QHMK KH  +++ EL
Sbjct: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 19/113 (16%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVR---HV 444
           +Y C  C KSF+R +W KRH ++H++  P+ C WC+S HKRRDN+F+HMK KH+     V
Sbjct: 249 SYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKV 308

Query: 445 VQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVI 497
           ++    + + +G  + G                L+ DG++ KE VK VL  ++
Sbjct: 309 IRNYYPLAEFEGKDLKG----------------LLADGRLHKEDVKRVLVDIV 345

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 50/63 (79%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
            YRC++C+K F+R +W +RH LSH++ + + CPWC+S+HKRRDNLF+H+K KH+  +++ 
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 448 LLE 450
           + E
Sbjct: 178 IRE 180

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 37/52 (71%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           Y C +C K+FKR SW KRH  SHS  K +SC WC  ++KR+DNL QH++ KH
Sbjct: 324 YECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C+ C+K+F+R    KRH+ S HSS +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKT-HKKH 644

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
            ++C  C K+F+R    KRH+ S HSS +P++CP C  +  R DNL QH+KT   R  V
Sbjct: 764 TFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIKTHKKRGDV 822

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C+ C+K FKR    KRH+ S HS+ +PY C +C+    R DNL QH+KT H RH
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLKT-HKRH 362

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C+ CDK+F+R    KRH+ S HS+ +P+ C +C+ +  R DNL QH+KT H RH
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLKT-HKRH 538

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HSS +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 527 FKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKT-HKKH 581

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++CS C K+F+R    KRH+ S HSS +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 673 FKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKT-HKKH 727

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+FKR    KRH+ S HS+ +P++C  C+ +  R DNL QH+KT H +H
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKT-HKKH 617

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++CS C+K+F+R    KRH  S HS+ +P+ C +C  R  R DNL QH+KT H +H
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKT-HKKH 969

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C  CDK+F+R    KRH+ S HS+ +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKT-HKKH 636

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C+K+F+R    KRH+ S HS+ +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKT-HKKH 638

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C+K+F+R    KRH+ S HS+ +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKT-HKKH 627

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HSS +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKT-HRKH 558

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C+K+F+R    KRH+ S HS+ +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKT-HKKH 625

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C+K+F+R    KRH+ S HS+ +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKT-HKKH 675

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C+K+F+R    KRH+ S HSS +P+ C +C  R  R DNL QH+KT H +H
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKT-HKKH 520

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C+ C+K+F+R    KRH+ S HSS +P+ C +C+ +  R DNL QH+KT H +H
Sbjct: 462 FKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKT-HKKH 516

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++CS C+K FKR    KRH  S HS+ +P+ C  C+ +  R DNL QH+KT H +H
Sbjct: 313 FKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKT-HKKH 367

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HSS +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKT-HKKH 496

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C KSF+R    KRH+ S HS  +P++C  C+ +  R DNL QH+KT H +H
Sbjct: 712 FQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKT-HKKH 766

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HS+ +P++C +C+ +  R DNL QH+KT H +H
Sbjct: 380 FKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKT-HKKH 434

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HSS +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKT-HKKH 695

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 382 GLVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
            LVP ++  + C  CD+ FKR+   KRH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 255 SLVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIKT 314

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
           ++C  C K+F+R    KRH+ S HS+ +P+ C +C  +  R DNL QH+KT      +++
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKD 757

Query: 448 LL 449
           +L
Sbjct: 758 VL 759

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HS  +P+SC  C  +  R DNL QH+KT H +H
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLKT-HKKH 743

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C +C KSFKR    KRH+ S HS+ +P++C  C  +  R DNL QH+KT H +H
Sbjct: 652 FHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKT-HKKH 706

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C  C K+FKR    KRH+ S HS  +PY C  C  +  R DNL QH+KT H RH
Sbjct: 603 FHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLKT-HKRH 657

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C +C K+FKR    KRH+ S HS+ +P+SC  C+ +  R DNL QH+KT
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIKT 585

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HS+ +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKT-HKKH 674

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C +C KSFKR    KRH+ S HS+ +P++C  C+ +  R DNL QH+KT H +H
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIKT-HKKH 700

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C +C KSFKR    KRH+ S HS+ +P++C  C  +  R DNL QH+KT H +H
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKT-HKKH 701

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K+F+R    KRH+ S HS+ +P++C  C  +  R DNL QH+KT H +H
Sbjct: 386 FKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKT-HKKH 440

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 383 LVPPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           L P   + C  CD+ FKR+   KRH+ S H   KP+SC  C+ +  R DNL QH+KT
Sbjct: 297 LDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIKT 353

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           + C +C KSFKR    KRH+ S HS+ +P++C  C  +  R DNL QH+KT H +H
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKT-HKKH 701

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 382 GLVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
            L+P  +  + C  C++ FKR+   KRH+ S H   KPY+C  CQ    R DNL QH+KT
Sbjct: 375 SLIPDASKQFGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIKT 434

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 20/27 (74%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           K + C +C+ R KR+++L +H+++ H+
Sbjct: 382 KQFGCEYCERRFKRQEHLKRHVRSLHI 408

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C  C K F+R    KRH+ S HS  +P+ C +C  +  R DNL QH+KT H +H
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKT-HKKH 491

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKT 404

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KP+ C  C  +  R DNL QH+KT
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVKT 390

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLKT 468

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           KP+ C +C  R KR+++L +H+++ H+
Sbjct: 416 KPFGCEYCDRRFKRQEHLKRHIRSLHI 442

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 4/62 (6%)

Query: 383 LVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           L+P  +  + C  CD+ FKR+   KRH+ S H   KP++C  C     R DNL QH+KT 
Sbjct: 380 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT- 438

Query: 440 HV 441
           HV
Sbjct: 439 HV 440

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 383 LVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           L+P  +  + C  CD+ FKR+   KRH+ S H   KP++C  C     R DNL QH+KT
Sbjct: 380 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 438

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 383 LVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           L+P     + C  CD+ FKR+   KRH+ S H   KP++C  C     R DNL QH+KT
Sbjct: 387 LIPDATKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 445

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KP+ C  C  +  R DNL QH+KT
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIKT 396

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 382 GLVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
            L+P  +  + C  CD+ FKR+   KRH+ S H   KP++C  C     R DNL QH+KT
Sbjct: 380 SLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 439

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  C++ FKR+   KRH+ S H   KPY+C  C  +  R DNL QH+KT
Sbjct: 386 FGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIKT 436

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRH 443
           ++C MC++ FKR+   KRH+ S H   +PYSC  C     R DNL QH +T +  H
Sbjct: 218 FKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKRTHNNPH 273

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K+F R     RH  SH+ +KP+ C  CQ    RRD + +H+KT H   ++   
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKICQHCFVRRDLVQRHIKTVHRLLILSNK 67

Query: 449 LEV 451
            E+
Sbjct: 68  TEI 70

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 382 GLVPPVA--YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
            L+P     + C  C++ FKR+   KRH+ S H   KPY+C  C     R DNL QH+KT
Sbjct: 486 SLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIKT 545

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 21/27 (77%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           K ++C +C+ R KR+++L +H+++ H+
Sbjct: 493 KQFACDYCERRFKRQEHLKRHVRSLHI 519

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KP++C  C  +  R DNL QH+KT
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIKT 308

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           Y C  C++ FKR+   KRH+ S H   KPY+C  C  +  R DNL QH KT
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTKT 399

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 21/27 (77%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           K YSC +C+ R KR+++L +H+++ H+
Sbjct: 347 KHYSCEYCERRFKRQEHLKRHIRSLHL 373

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           ++C MC K F R    +RH+ +H+  KP+SC  P C  R  R D L +H++T
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRT 65

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  C++ FKR+   KRH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT 510

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 21/27 (77%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           KP+ C +C+ R KR+++L +H+++ H+
Sbjct: 458 KPFGCEYCERRFKRQEHLKRHIRSLHM 484

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KP+ C  C  +  R DNL QH+KT
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIKT 553

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 385 PPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           P   + C  C + FKR+   KRH+LS H   K + CP C     R DNL QH+KT
Sbjct: 396 PSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIKT 450

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 6/110 (5%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K+F R     RH  SH+  KP+ C  C+    RRD L +H++T H R ++  L
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVH-RELL--L 64

Query: 449 LEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIA 498
           ++ G  +G   S + V   E      IK   ++G   +     +L+ +I 
Sbjct: 65  MKKGMEEGGNKSDLIV---ELLVNSMIKVTKREGSGLRGEKAEILSRLIG 111

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  C++ FKR+   KRH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT 564

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 21/27 (77%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           KP+ C +C+ R KR+++L +H+++ H+
Sbjct: 512 KPFGCEFCERRFKRQEHLKRHVRSLHM 538

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           ++C MC K F R    +RH+ +H+  KP++C  P C  R  R D L +H++T
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRT 64

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           + CS C K+F R     RH  SH+ FKPY C  C     R D   +H+KT H   +   L
Sbjct: 87  FICSFCAKAFSRSEHKIRHERSHTGFKPYKCLLCDHSFVRSDLTIRHLKTVHKDQI--NL 144

Query: 449 LEVGDVDGSVMSGMQVTSDESAPEPSIK 476
           L+  ++     S    TS E+     IK
Sbjct: 145 LQKDNLKNEDPSEFSQTSIETIIRSLIK 172

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 382 GLVP---PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           G+ P   P  + CS+C ++F R+    RH  SH+  KPY C  CQ +  RRD L +H   
Sbjct: 108 GVTPSGKPRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHK 167

Query: 439 KH 440
            H
Sbjct: 168 IH 169

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           V+  C +C KSF RRS  + HLL H++ KP+ C +C+     + NL +H +  H + V+
Sbjct: 169 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI-HRQKVI 226

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  CD+ FKR+   KRH+ S H   KP+ C  C     R DNL QH+KT
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIKT 448

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHV 441
           K +SC +C  R KR+++L +H+++ H+
Sbjct: 396 KQFSCEYCDRRFKRQEHLKRHIRSLHI 422

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           Y+C +C+K F R    +RH+ +H+  KP++C  P C  R  R D L +H++
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLR 75

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446
           Y CS C K+F R     RH  SH+  KP++C  C     RRD L +H++T H   ++Q
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQ 65

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           + CS+C ++F R+    RH  SH+  KPY C  CQ +  RRD L +H +  H
Sbjct: 44  FVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C ++F R     RH  SH+  KP+SC  C     RRD L +H++T H R ++ E+
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVH-RSMLLEI 66

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           Y CS C K+F R     RH  SH+ +KP+ C  C     RRD + +H+KT H
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNICNHAFVRRDLVQRHIKTVH 59

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 50/111 (45%)

Query: 370 LLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRR 429
           L+ P+      +    P  + CS+C + F R+   KRH  SH++ KP+ C +C     RR
Sbjct: 56  LMLPIPKKSRTIKTDKPRPFLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARR 115

Query: 430 DNLFQHMKTKHVRHVVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQ 480
           D + +H    H   V + L E   +D S       T+     EP  K +I+
Sbjct: 116 DLVLRHQHKLHAALVSKTLEEDVMMDFSEAGDNNSTNINGNNEPMDKNIIK 166

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 375 SNGPFGMGLVPPVA------YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHK 427
           SN P   G  P +       + C++C + F+R+   KRH+ + H   +PY+C  C+    
Sbjct: 393 SNRPKPRGRKPSIVPDGSKQFLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFS 452

Query: 428 RRDNLFQHMKTKHVRH 443
           R DNL QH++T H R+
Sbjct: 453 RSDNLNQHLRT-HTRN 467

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C++ F R    KRHL +H+  KP+ C  P C     R D L +HM+T
Sbjct: 17  FRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRT 68

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P ++ C+ C ++F R    KRH  SH   KP+ C  C     RRD L +H+KT H
Sbjct: 2   PKSHVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVH 56

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y C  C ++F R     RH  SH+  KP+SC  C     RRD L +H++T H R ++ EL
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVH-RSMLLEL 66

Query: 449 ----LEVGDVDGSVMSG 461
               +++G+    V+ G
Sbjct: 67  QLKQVKLGEGREGVLQG 83

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 48/108 (44%), Gaps = 20/108 (18%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H     +EL
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVH-----REL 66

Query: 449 LEV--------GDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKER 488
           L V        G   G +M  ++V S        IK    D +V K R
Sbjct: 67  LLVESSLEPAAGSSKGDLMLELRVNS-------MIKVSGDDKRVDKCR 107

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 382 GLVP---PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           G+ P   P  + C +C ++F R+    RH  SH+  KPY C  C+ R  RRD L +H + 
Sbjct: 115 GVTPSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQK 174

Query: 439 KH 440
            H
Sbjct: 175 LH 176

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K F R     RH  SH+  KP+SC  C     RRD L +H++T H +  +  +
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVH-KSSLNSM 66

Query: 449 LEVGD 453
           L+ G+
Sbjct: 67  LKTGN 71

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 385 PPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           P   + C  C++ FKR+   KRH  S H   KP+ C  C  +  R DNL QH+KT
Sbjct: 630 PSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIKT 684

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 379 FGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCP--WCQSRHKRRDNLFQHM 436
           +  G +  + Y C++C K FKR S    H+  H+  KPY CP   C      + N+ +H 
Sbjct: 260 YSTGCIDKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHY 319

Query: 437 KTKHVRHVVQELLEVGDVDGS 457
           K     +  Q +L  G++  +
Sbjct: 320 KLHFKLNTGQYILPNGEISAT 340

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 14/92 (15%)

Query: 389 YRC---SMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           YRC     C+ SF R     RH+  H+  KP+ C  C     R DNL QH  + H     
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH----- 73

Query: 446 QELLEVGDVDGSVMSGMQVTSDESAPEPSIKT 477
                  DVD   +  +Q +++ +A EP+  T
Sbjct: 74  ------SDVDLMSLRRLQQSANNTANEPNATT 99

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H   ++   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRSFLLSSC 67

Query: 449 LEVGDVDGSVMSGMQVTSDE--SAPEPSIKTLIQ 480
             + D    V + + V+  +  SA +  ++TL+ 
Sbjct: 68  ASMTDSKVEVPASLGVSDYDPTSAKDIKLETLVN 101

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 382 GLVPPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           G + P  Y C  C +SF       RH  + H + KP+SCP C+ R KRRD++ QH+  K
Sbjct: 384 GTINPSTY-CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 385 PPVAYR----CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           PP  ++    CS C K F R     RH  SH+  KPY C  C     R D   +H+KT H
Sbjct: 7   PPTTFQKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTHCFVRSDLALRHIKTVH 66

Query: 441 VRHVVQ 446
            + ++Q
Sbjct: 67  KKEILQ 72

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           CS C+K+F R     RH  SH+  KP+ C  C     RRD L +H++T H
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVH 63

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438
           Y+C +C K F R S  + HLL+H+  +P+ CP+  C      + N+ +H+KT
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKT 179

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC +C++ F R    KRH+ +H+  KP+ C  P C     R D L +H++T
Sbjct: 14  FRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRT 65

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R+    RH  SH++ KPY C  C  +  RRD L +H +  H
Sbjct: 75  PRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           V+  C +C KSF RRS  + HLL H++ KP+ C +C      + NL +H +
Sbjct: 165 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHER 215

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C +C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT-KHVRHVVQE 447
           Y+C+ C K F +    K H+  H+  KP+SC +C  R  R+ NL  H+ T + VR  V +
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCK 475

Query: 448 L 448
           L
Sbjct: 476 L 476

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           + C++C K F + +  + HL SH   KPY C WC     +  NL  H++
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVR 436

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 2/69 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           + C  C K F R+     HL++H   +P+ C    C     +  N+  H    H   + +
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTE 503

Query: 447 ELLEVGDVD 455
               + ++D
Sbjct: 504 LTRRLANLD 512

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KPYSCP C  R KRRD++ QH+  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           CS C+++F R     RH  SH+  KPY C  C     RRD L +H++T H
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVH 60

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           + C  C + F+R+   KRH+ S H + KPYSC  C     R DNL QH KT
Sbjct: 171 FACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRKT 221

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           + C +C ++F R+    RH  SH+  KPY+C  C  +  RRD L +H +  H  +VV
Sbjct: 116 FVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVV 172

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C + F R    KRHL +H+  KP+ C  P C     R D L +HM+T
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           Y+C +C + F R    KRHL +H+  KP+ C  P C     R D L +H++T
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRT 71

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 382 GLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           G +  + Y CS+C K FKR S    H+  H+  KP++CP+  C      + N+ +H K
Sbjct: 298 GNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYK 355

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R+    RH  SH+  KPY C  C  R  RRD L +H    H
Sbjct: 56  PRLFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLH 110

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           V Y C +C K FKR S    H+  H+ +KPY CP+  CQ     + N+ +H K
Sbjct: 276 VKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYK 328

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C  C ++F R+    RH  SH++ KPY C  C  R  RRD L +H    H     
Sbjct: 46  PRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCG 105

Query: 446 QELLEVG 452
             LL+ G
Sbjct: 106 DALLKKG 112

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 382 GLVP---PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           G  P   P  + C  C ++F R+    RH  SH+  KPY C  C  R  RRD L +H   
Sbjct: 20  GFTPSGKPRLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHK 79

Query: 439 KHVRHVVQELL 449
            H  +  + LL
Sbjct: 80  VHGGNCGESLL 90

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 776 VYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 859 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK-----TKHV 441
           ++C MC + F R    KRH+ +H+  KP+ CP   C     R D L +HMK     T ++
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKVHPASTHNL 75

Query: 442 RHVVQELLEVGDVDGSVMSGMQVTSDESAP 471
                  L + +   S+ S +Q  S  + P
Sbjct: 76  HSTSTTSLNISNSTMSMTSLLQSNSVSNLP 105

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           Y C +C K FKR    KRH  + H   +P+ C  C  R  R DNL QH++
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVR 272

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 415 KPYSCPWCQSRHKRRDNLFQHMKTKHVR 442
           K Y C  C+ R KR ++L +H +T H+R
Sbjct: 221 KQYFCHLCKKRFKRHEHLKRHFRTIHLR 248

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C + F R    KRHL +H+  KP+ C  P C     R D L +HM+T
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H   ++   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRSFLLSNC 67

Query: 449 LEVGDV---DGSVMSGMQVTSDESAPEPSIKTLI 479
             V D    + S   G       S  +  ++TL+
Sbjct: 68  ASVVDSKAEEESASLGADAADSASTRDIKLETLV 101

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C + F R    KRH+ +H+  KP+ C  P C+    RRD L +H++T
Sbjct: 21  FRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRT 72

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KPYSCP C  + KRRD++ QH+  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R+    RH  SH+  KPYSC  C     RRD L +H    H
Sbjct: 56  PRLFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVH 110

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H   ++   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRTFLLSSY 67

Query: 449 -------------LEVGDVDGS 457
                        L VGDVD +
Sbjct: 68  ASMTGDKADIPVSLGVGDVDST 89

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 382 GLVP---PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           GL P      + C +C K+F R+    RHL SH++ KP+ C  C     RRD L +H   
Sbjct: 39  GLTPSGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNK 98

Query: 439 KH 440
            H
Sbjct: 99  LH 100

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C + F R    KRHL +H+  KP+ C  P C     R D L +HM+T
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVH 59

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVR 442
           Y C +C++ F R    KRHL  H+  KPY C +  C  +  R D L +H K  H R
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHSR 74

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KPYSCP C  + KRRD++ QH+  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C++ F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC +C + F R    KRH+ +H+  KP++C  P C+    R D L +H +T
Sbjct: 17  FRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSRT 68

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 376 NGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQ 434
           N P    ++ P +Y C  C +SF       RH  + H + KP+SCP C  R KRRD++ Q
Sbjct: 435 NTPNPTLMINPSSY-CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQ 493

Query: 435 HMKTK 439
           H+  K
Sbjct: 494 HLNKK 498

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C++ F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 850 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C++ F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           ++ C +C ++F R+   KRH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 103 SFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQH 435
           C++C KSF R++  + H+L H+  KPY CP+  C      + NL++H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRH 164

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C++ F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS+C + F R+   KRH  +H++ KP+ C +C     RRD + +H +  H
Sbjct: 75  PRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 129

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           ++ C +C ++F R+   KRH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 103 SFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R+    RH  SH+  KPY C  C  +  RRD L +H    H
Sbjct: 83  PRLFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIH 137

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 381 MGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438
           + L   +  +C +C K   R S  K H + H+   P+ CPW  C      + N+F+H+K+
Sbjct: 447 LTLATKLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKS 506

Query: 439 KHVRHVVQELLE 450
            H R + Q  L+
Sbjct: 507 -HKRKLEQRQLQ 517

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           AY C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           AY C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 751 AYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS+C + F R+   KRH +SH++ KP+ C +C     R+D + +H    H
Sbjct: 31  PRPFLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLH 85

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  +H++ KP+ C +C     RRD + +H    H   V 
Sbjct: 58  PRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVS 117

Query: 446 QELL------EVGDVDGSVMSGMQVTSDESAPEPS---IKTLIQDGQVKKER 488
           +E +      E+  ++   +  +Q       P PS    KT +Q  +  KE+
Sbjct: 118 KESINSKDKTEIDAINDKNIIQIQGNKQTILPTPSNPLAKTAVQLKKAAKEK 169

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R    +RH  SH++ KPY C  C     RRD L +H    H
Sbjct: 72  PRRFVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           ++ C +C ++F R+   KRH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 109 SFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 161

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS+C + F R+   KRH  +H++ KP+ C +C     RRD + +H +  H
Sbjct: 29  PRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 83

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K     +  
Sbjct: 716 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK-----IPC 770

Query: 448 LLEVGDVDGSVMSGMQVTSDE 468
           +     V+ S+MS    T DE
Sbjct: 771 VPNDTTVNDSIMSTDVQTQDE 791

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           + CS+C ++F R+   KRH  SH++ KP+ C +C     RRD + +H    H   +  EL
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTEL 111

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           ++ C +C ++F R+   KRH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 103 SFVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           P  + C +C ++F+R     RHL +H+  KP++C  P C  R  R D L +H +
Sbjct: 26  PRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRR 79

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           C+ C K F R S  + H+L HS  KP+ C W  C  +   + NL +H+K
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLK 282

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 388 AYRCS--MCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           +Y+CS   C KSF +R    RHL  HS +KP+ CP C  +    D L QH++T
Sbjct: 627 SYQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKCPHCTKKFSTEDILQQHIRT 679

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C+ C K F   S  + H+ +H+  KP  C  C  R     NL +HMKT
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMKT 735

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 26/50 (52%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C  C K F      ++H+ +HS  +P+ C +C  +     +L  H++T
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT 707

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 39/93 (41%), Gaps = 12/93 (12%)

Query: 373 PMSNGPFGMGLVP----------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWC 422
           P  NG   + L+           P  Y C +CDK F R    K HL SH+  +PY C  C
Sbjct: 443 PKDNGESTLNLIGTTKKKQAQKHPAVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVC 502

Query: 423 QSRHKR--RDNLFQHMKTKHVRHVVQELLEVGD 453
                R    N  + + T   R+V   +L+ G+
Sbjct: 503 GKAFARMHDKNRHEDLHTGKRRYVCGGILKNGN 535

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS+C + F R+   KRH  +H+S KP+ C +C     RRD + +H    H
Sbjct: 51  PRPFLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLH 105

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           ++C +C K F+R S    H   H+ FKPY CP+  C      + N+F+H K         
Sbjct: 208 FKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFKLPSGA 267

Query: 447 ELLEVGDVDGSVMSGMQVTSDE 468
            +L  G++  +  S  Q+  D+
Sbjct: 268 YMLPNGEITTTKPSSKQLLPDD 289

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           P  Y C +C ++F R     RH+ +H+  KP++C  P C  R  R D L +H +
Sbjct: 31  PRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTR 84

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  SH++ KP+ C +C     RRD + +H +  H   + 
Sbjct: 70  PRPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMD 129

Query: 446 QE 447
           Q+
Sbjct: 130 QD 131

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 389 YRC---SMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           YRC     C+ SF R     RH+  H+  KP+ C  C     R DNL QH  + H     
Sbjct: 19  YRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH----- 73

Query: 446 QELLEVGDVDGSVMSGMQVTSDESAPEPS 474
                  DVD   +  +Q +++ +A +P+
Sbjct: 74  ------SDVDLMSLRRLQQSANSTANDPN 96

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           Y+C+ C K F +    K H   H+  KPYSC  C  R  R+ NL  H+ T
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLT 594

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           Y C +C+K F R+     H+L+H   KPY C    C     +  N+  H    H   +++
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFHYNTLIE 632

Query: 447 ELLEVGDVD 455
              ++ +++
Sbjct: 633 LTNKLANMN 641

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 50/123 (40%), Gaps = 6/123 (4%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHM------KTKHVR 442
           ++C  C + F + +  + H+ SH  +KPY C +C  +  +  NL  H       K    +
Sbjct: 517 HQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCK 576

Query: 443 HVVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNG 502
              +     G++   V++  ++       +   KT  Q G +K  + K   N +I   N 
Sbjct: 577 ICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFHYNTLIELTNK 636

Query: 503 EIN 505
             N
Sbjct: 637 LAN 639

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 711 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 762

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS+C + F R    KRH +SH++ KP+ C +C     R+D + +H    H
Sbjct: 33  PRPFLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLH 87

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT------KH 440
           +RC +C + F R    KRH+ +H+  KP+ C +  C     R D L +H++T      K 
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRHLRTHTNTVKKR 76

Query: 441 VRHVVQELLEVGDVDGSVMSGMQV---TSDESAPEPSIKTLIQD 481
            R +  + L+   VD +      V   T   S   P + ++ QD
Sbjct: 77  SRRLKSKGLQKSAVDAATTISTTVKEQTRAASEISPVLISVAQD 120

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 710 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 761

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 11/95 (11%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT---KHVRH 443
           ++C +C + F R    KRH+ +H+  KP+ C +  C     R D L +H++T      R 
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRTHAGSSQRR 76

Query: 444 VVQELLEVGDVDGSVMSGMQVTSDESAPEPSIKTL 478
             ++L E G      ++  ++T DE    P I +L
Sbjct: 77  SRKQLKEKG------VAKPRLTHDEGTTLPRISSL 105

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSF-KPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C ++F       RH  S  SF KP+SCP C  + KRRD++ QH+  K
Sbjct: 724 TYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 386 PVAYRCS---MCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P +++C+    CD SF R     RH+  H+  KP+ C  C     R DNL QH ++ H
Sbjct: 17  PRSFKCTGYGSCDMSFTRAEHLARHIRKHTGEKPFQCEVCNRFFSRIDNLKQHRESVH 74

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCP--WCQSRHKRRDNLFQHMK 437
           C +C K FKR S  + H++ H++ KPY+C    CQ R   + N+ +HM+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           C +C K FKR S  + H++ H++ KPY C    CQ R   + N+ +HM+
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR 299

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           Y C +C   F R     RH+ +H+  KP++C  P C  R  R D L +H+KT
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKT 63

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC  C + F R    KRH+ +H+  KP+ C  P C     R D L +H++T
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRT 69

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C ++F R     RH   H+  KPY C  C+ ++ RRD L +H+   H
Sbjct: 50  PRLFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH 104

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C  C + F R+   KRH  SH++ KP+ C +C     RRD + +H    H   + 
Sbjct: 69  PRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIG 128

Query: 446 QEL-------LEVGDVDGSVMSGMQVTSDESA--PEPSIKTLIQDGQVKKE 487
            EL       L+V   D      ++VT +++   P P+        Q+KKE
Sbjct: 129 NELQQNLSNQLDVTHEDIIDKHIVKVTGNKATILPTPTNPMAKSAAQLKKE 179

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  Y C  C + F R+   KRH  SH++ KP+ C +C     RRD + +H +  H
Sbjct: 102 PRPYICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLH 156

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           ++C +C + F R    KRH+ +H+  KP+ C  P C     R D L +H++T
Sbjct: 18  FKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLRT 69

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  SH++ KP+ C +C     RRD + +H +  H   + 
Sbjct: 77  PRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMD 136

Query: 446 QE 447
           Q+
Sbjct: 137 QD 138

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 2/108 (1%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R    KRH  +H++ KP+ C +C     RRD + +H    H   V 
Sbjct: 30  PRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHPTLVS 89

Query: 446 QELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVL 493
           +     G +D S  + +   SD S+     +  I D  +K    +A +
Sbjct: 90  KN--NEGSLDNSRNNSVSPGSDNSSDALKAEAAINDNIIKVSGNRATI 135

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  +H++ KP+ C +C     RRD + +H    H   V 
Sbjct: 58  PRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVS 117

Query: 446 QELLEVGD 453
           +E ++  D
Sbjct: 118 KESVDSRD 125

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHV 444
           +RC +C + F R    KRH+ +H+  KPY C    C     R D L +H +T H R V
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRT-HTRTV 73

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWC 422
           A+RC  C KSF ++S  +RHL SHS  KP+ C +C
Sbjct: 79  AFRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYC 113

>CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some
           similarities with uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3
          Length = 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 390 RCSMCDKSFKRRSWHKR-HLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           +C +C K F   S HK  HL S    +P+ C  CQS   R ++L +H K +H +  +Q +
Sbjct: 325 QCPICHKYFANLSTHKSTHLTSQD--RPHKCIICQSGFARNNDLIRHRK-RHWKDDIQNI 381

Query: 449 LEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNGEINEP 507
             +G+ +    + +Q    + A + +   LIQ  Q+K    K   NA +  V+ E+N P
Sbjct: 382 ANLGNTNQQCQNTIQ---GQRALKKN--QLIQLHQIKCA-FKCPYNANLIEVDLELNSP 434

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   +RH  SH++ KP+ C +C     RRD + +H +  H   + 
Sbjct: 80  PRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMD 139

Query: 446 QELLEVGDVDGSVMSG 461
           Q      D D  ++S 
Sbjct: 140 Q------DKDADIVSA 149

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + CS C + F R+   KRH  SH++ KP+ C +C     RRD + +H    H
Sbjct: 68  PRPFVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 122

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 717 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 378 PFGMGLVP------------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSR 425
           P G G++P            P  + C  C + F R+   KRH  SH+  KPY C +C   
Sbjct: 81  PAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRC 140

Query: 426 HKRRDNLFQHMKTKHVRHV 444
             RRD + +H +  H   V
Sbjct: 141 FARRDLVLRHQQKLHAALV 159

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 738 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 389  YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 998  YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa]
           {ON} Anc_7.543
          Length = 433

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 379 FGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWC 422
           F  G+ P   ++C  CDK F R++  +RHL+SHS  KP+ C  C
Sbjct: 81  FHQGIKP---FKCEQCDKQFSRKTHLERHLISHSDSKPFCCLHC 121

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           ++C +C + F R     RH+++H+  KP+ C  P C  +  R D L +H KT
Sbjct: 18  FKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAKT 69

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  Y C +C + F R+   KRH  SH++ KP+ C +C     RRD + +H    H
Sbjct: 54  PRPYLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 108

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH--MKTKHVRHVV 445
           AY C +CDK+F R    K HL +H++ KP+ C  C     R+ +  +H  + T   R+V 
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDLHTGKKRYVC 510

Query: 446 QELLEVG 452
             +L+ G
Sbjct: 511 GGVLKNG 517

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C +CDKSF   +  K H+ +H+  KP  C  C  R     NL +HMKT
Sbjct: 668 FKCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMKT 717

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%)

Query: 394 CDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH 435
           C+K F +R    RHL  HS FKPY C  C       + L QH
Sbjct: 617 CNKEFSQRQKIVRHLKVHSGFKPYKCEVCSKCFSSDETLKQH 658

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           Y+C +C K F      K+H   HS  KP+ C  C        +L  H++T
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHLCDKSFSVSTSLKIHIRT 689

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           P  Y C +C ++F R     RH+ +H+  KP++C  P C  +  R D L +H +
Sbjct: 23  PRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKR 76

>Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W
           (REAL)
          Length = 177

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           Y C+ C   F R S  +RH   HS   P+ C  C     R+D L +H  T   R   ++L
Sbjct: 95  YSCAKCRLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTCRRNRKKL 154

Query: 449 LEVGDVD 455
            E  DVD
Sbjct: 155 CEGSDVD 161

>Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON}
           similar to Ashbya gossypii AGL246W
          Length = 240

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           + CS C+  F+R    +RH   H S  P  C  C     R+D L +H  T   +   Q+L
Sbjct: 160 FHCSKCELVFRRSGDLRRHEKVHLSILPNICSLCGKGFARKDALKRHFNTLTCKRNRQKL 219

Query: 449 LEVG 452
           L +G
Sbjct: 220 LSIG 223

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  +H++ KP+ C +C     RRD + +H    H   V 
Sbjct: 58  PRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVS 117

Query: 446 QELLEVGD---VDG 456
           +E +   D   +DG
Sbjct: 118 KESVNSKDKTQIDG 131

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 381 MGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           +G   P  Y C +C ++F R     RH+ +H+  KP++C +  C  R  R D L +H +
Sbjct: 15  LGQESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKR 73

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 378 PFGMGLVP------------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSR 425
           P G G++P            P  + C  C + F R+   KRH  SH+  KPY C +C   
Sbjct: 102 PAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRC 161

Query: 426 HKRRDNLFQHMKTKHVRHV 444
             RRD + +H +  H   V
Sbjct: 162 FARRDLVLRHQQKLHAALV 180

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 378 PFGMGLVP------------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSR 425
           P G G++P            P  + C  C + F R+   KRH  SH+  KPY C +C   
Sbjct: 13  PTGHGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRC 72

Query: 426 HKRRDNLFQHMKTKHVRHV 444
             RRD + +H +  H   V
Sbjct: 73  FARRDLVLRHQQKLHAALV 91

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKH---VRH 443
           ++C  CDK+F RR     H  +H S KPY C    C  R  +  N+  H    H   ++ 
Sbjct: 536 FKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSHQNKYHPQTIKE 595

Query: 444 VVQEL 448
           + Q+L
Sbjct: 596 LTQKL 600

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           Y+C+ C K F + +    H+ +H  +KP+ C +C  R  +  NL  H +
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAGNLRTHRR 528

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%)

Query: 381 MGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH 435
           MG  P   + C  C K F +    + H   H+  +P+ C  C     RR NL  H
Sbjct: 503 MGYKP---FECEFCGKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAH 554

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 389 YRC---SMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           YRC     C+ SF R     RH+  H+  KP+ C  C     R DNL QH  + H    +
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDL 78

Query: 446 QELLEVGDVDGSVMSG 461
             L       G+ ++G
Sbjct: 79  MSLRRQKQSSGNTVNG 94

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 378 PFGMGLVP------------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSR 425
           P G G++P            P  + C  C + F R+   KRH  SH+  KPY C +C   
Sbjct: 128 PAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRC 187

Query: 426 HKRRDNLFQHMKTKHVRHV 444
             RRD + +H +  H   V
Sbjct: 188 FARRDLVLRHQQKLHAALV 206

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 10/85 (11%)

Query: 374 MSNGPFGMGLVP----------PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQ 423
           M+NG     L+P          P  + C +C + F R+   KRH  SH+  KP+ C  C 
Sbjct: 2   MTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICG 61

Query: 424 SRHKRRDNLFQHMKTKHVRHVVQEL 448
               R+D + +H++  H  +  ++L
Sbjct: 62  KCFARKDLVLRHLQKLHRDYKTEQL 86

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  Y C++CDK F R    K HL +H+  +P+SC  C     R     QH + +H
Sbjct: 423 PAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFAR-----QHDRKRH 472

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--------PW-CQSRHKRRDNLFQHMKTK 439
           + CS+C K+F R+   KRH   HS  K Y C         W C  +  R D L +H KT+
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

Query: 440 HVRHVVQELLE 450
             R  +  L +
Sbjct: 514 SGRRCIAPLYD 524

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           ++C  C + F R    KRH+ +H+  KP+ C  P C     R D L +H +T
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRT 68

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 14/87 (16%)

Query: 389 YRC---SMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           YRC     C+ SF R     RH+  H+  KP+ C  C     R DNL QH  + H     
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH----- 73

Query: 446 QELLEVGDVDGSVMSGMQVTSDESAPE 472
                  D+D   +  +Q  +  +A E
Sbjct: 74  ------SDIDLVSLRRLQQLASNTASE 94

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           + C  C ++F R+    RH  SH++ KP+ C  C     RRD L +H +  H
Sbjct: 152 FLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 384 VPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKTKHV 441
           +P     C +C K F R++    HLL H+  +PY C  P C+     + NL +H+K    
Sbjct: 104 IPLTDKTCPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKI--- 160

Query: 442 RHVVQEL 448
            H  QEL
Sbjct: 161 -HKKQEL 166

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 380 GMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           G G   P  + C +C ++F R     RH+ +H+  KP++C  P C  R  R D L +H +
Sbjct: 34  GKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRR 93

>TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}
          Length = 224

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH---MKTKHVRHVVQE 447
           C+ CD  F R+S  KRH  +H S  P+ C  C     R+D+L +H   M+ K  R  +Q 
Sbjct: 140 CNKCDMEFTRQSDLKRHEKTHMSVGPHICSQCGKDFARKDSLKRHANTMQCKKNREKLQN 199

Query: 448 LLEVGDVD 455
                DVD
Sbjct: 200 EYFGQDVD 207

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           P  + C +C + F R+   KRH  +H++ KP+ C +C     RRD + +H    H   V 
Sbjct: 58  PRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVS 117

Query: 446 QELLEVGDVDGSVMSGMQ 463
           +E   V   D + +  M 
Sbjct: 118 KE--SVNSKDKTEIDAMN 133

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH 435
           AY+C  C + F ++S  +RHL SHS  KP+SC  C      R  L +H
Sbjct: 149 AYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRH 196

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 390 RCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQE 447
           +C +C KS  R S  + H+L H+  +P+ C W  C  R   + N+ +H K    + +  E
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 448 LL 449
           +L
Sbjct: 552 VL 553

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  Y C +CDK F R    K HL +H++ +P+ C  C     R     QH + +H
Sbjct: 648 PAIYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFAR-----QHDRKRH 697

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--------PW-CQSRHKRRDNLFQHMKTK 439
           + CS+C+K+F R+   KRH   H+  K Y C         W C  +  R D L +H KT+
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

Query: 440 HVRHVVQELLE 450
             +  +  L E
Sbjct: 739 SGKRCIAPLYE 749

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C  C K F +    + H   H+  KPYSC  C  R  R+ NL  HM T
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHMLT 617

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           Y C  C K F R+     H+L+H + KPY C    C     +  NL  H    H++ + Q
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQ 655

Query: 447 ELLEVGDVD 455
               + ++D
Sbjct: 656 LTQRLAEMD 664

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           + C  C K F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTR 588

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--------PW-CQSRHKRRDNLFQHMKTK 439
           + CS+C K+F R+   KRH   H+  K Y C        PW C  +  R D L +H KT+
Sbjct: 600 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCSKKFARSDALGRHFKTE 659

Query: 440 HVRHVVQELLE 450
             R  +  L E
Sbjct: 660 SGRRCITPLYE 670

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  + C +C K F R    K HL +H++ +P+ C  C     R     QH + +H
Sbjct: 569 PANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFAR-----QHDRKRH 618

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH--MKTKHVRH 443
           P  Y C +CDK F R    K HL +H+  +P++C  C     R+ +  +H  + T   R+
Sbjct: 405 PAVYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDLHTGKKRY 464

Query: 444 VVQELLEVG 452
             +  L+ G
Sbjct: 465 TCKGKLKDG 473

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCP--------W-CQSRHKRRDNLFQHMKTK 439
           + C++C K+F R+   KRH   H+  K Y+C         W C  +  R D L +H KT+
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

Query: 440 HVRHVVQELLE 450
             +  +  L E
Sbjct: 496 GGKRCIAPLYE 506

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438
           +RC +C + F R    KRH  +H+  KP+ C  P C     R D L +H +T
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRT 71

>Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]
           {ON} complement(246366..247520) [1155 nt, 385 aa]
          Length = 384

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH 435
           ++C  CD +F ++S  +RHL SHSS KP++C  C      R  L +H
Sbjct: 73  FKCDQCDSAFSKKSHLERHLFSHSSEKPFTCAVCNKGLTTRQQLKRH 119

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 8/62 (12%)

Query: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW------CQS--RHKRRDNLFQHMKT 438
             YRCS C  +FK R +  RHL  H  +K + CP+      C S     R+D    H+K+
Sbjct: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213

Query: 439 KH 440
            H
Sbjct: 214 IH 215

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440
           P  Y C MCDK F R    K HL +H++ +P+ C  C     R     QH + +H
Sbjct: 496 PAIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFAR-----QHDRKRH 545

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--------PW-CQSRHKRRDNLFQHMKTK 439
           + CS+C K+F R+   KRH   HS  K Y C         W C  +  R D L +H KT+
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

Query: 440 HVRHVVQELLE 450
             +  +  L E
Sbjct: 587 AGKRCISLLYE 597

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHM 436
           Y C +C K F+R    KRH+ +H+  KP+ C +  C     R D L +HM
Sbjct: 27  YICEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHM 76

>Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}
           YDR253C (REAL)
          Length = 191

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448
           +RC+ C   F R S  +RH  +H +  P  CP C     R+D L +H  T   R    +L
Sbjct: 98  FRCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNRSKL 157

Query: 449 LEVG 452
           L  G
Sbjct: 158 LSAG 161

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437
           ++C +C + F R    KRH+ +H+  KPY C  P C     R D L +H K
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSK 67

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           Y C +C K F+R S  K H+  H+  KPY CP+  C      + N+ +H K
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFK 465

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 388 AYRCS--MCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           +Y C    C K FK+R    RHL +HS FKP+ C  C      ++ L QH +T
Sbjct: 869 SYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYRT 921

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           Y+C +C KSF   S  K H+ +H+  KP+ C  C  R     N  +HMK
Sbjct: 928 YKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMK 976

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C +C + F  +    +H  +HS  KPY C  C        +L  H++T
Sbjct: 900 FKCDVCSRCFSSKETLIQHYRTHSGEKPYKCEICGKSFSISSSLKIHVRT 949

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 386 PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437
           P  Y C +C ++F R     RH+ +H+  KP+ C +  C  +  RRD L +H +
Sbjct: 19  PRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRR 72

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 389 YRCSM---CDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVV 445
           ++C+    C+ SF R     RH+  H+  KP+ C  C     R DNL QH  T H +  V
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAKDNV 84

Query: 446 QE 447
           + 
Sbjct: 85  KN 86

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C +C KS+   S  + H+ +H+  KP SCP C  R     NL +H++T
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIRT 769

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 388 AYRCS--MCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           +Y+C    C+K F ++    RHL  HS +KP+ C  C      +D L QH++ 
Sbjct: 661 SYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRV 713

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           +RC+ C K F  +    +HL  HS  +P+ C  C   +    +L  H++T
Sbjct: 692 FRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT 741

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           YRC +CDK F R+     H L+H   KP+ C    C     +  N+  H    H++ +++
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLE 715

Query: 447 ELLEVGDVD 455
              ++ +++
Sbjct: 716 LTSKIAEMN 724

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           ++C+ C K F +    + H   H+  KPY C  C  R  R+ NL  H  T
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAHKLT 677

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMK 437
           + C  C + F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQR 648

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKHVRHVVQ 446
           Y C  C+K FKR S    H+  H+  KPY CP+  C+     + N+ +H K     +   
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKLHFKLNSGA 317

Query: 447 ELLEVGDVDGSVMSGMQV 464
            +L  G++     +  Q+
Sbjct: 318 YILPNGEISAEKPTSKQL 335

>KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa]
           {ON} similar to uniprot|Q12041 Saccharomyces cerevisiae
           YDR253C MET32 Zinc-finger DNA-binding protein, involved
           in regulating expression of the methionine biosynthetic
           genes
          Length = 199

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQELLE 450
           C  CD  F+R S  +RH  +H    P  C  C     R+D L +H  T   +   ++LL 
Sbjct: 121 CGKCDLVFRRSSDLRRHERAHLPILPNICSLCGKGFARKDALKRHFDTLTCKRNREKLLS 180

Query: 451 VG 452
           +G
Sbjct: 181 IG 182

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 380 GMGLVP----PVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLF 433
           G+  +P    P  + C +C ++F R     RH+ +H+  KP++C  P C  R  R D L 
Sbjct: 30  GLKKIPGENAPRPHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELT 89

Query: 434 QHMK 437
           +H +
Sbjct: 90  RHKR 93

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 394 CDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           C+K+F +R    RHL  HS +KPY CP CQ      D L QH + 
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRV 618

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           Y C +C K F   +  K H+ +H+  KP  C  C        NL +HMKT
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKVCGRCFNESSNLSKHMKT 674

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%)

Query: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKT 438
           Y+C  C K F       +H   HS  KPY C  C  R    ++L  H++T
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHICHKRFAISNSLKIHIRT 646

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,865,151
Number of extensions: 1038338
Number of successful extensions: 5046
Number of sequences better than 10.0: 631
Number of HSP's gapped: 4758
Number of HSP's successfully gapped: 794
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)