Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_26.80162.532ON24024011511e-161
KLTH0D06820g2.532ON2602635733e-73
SAKL0A09460g2.532ON2402484063e-48
Kpol_1018.342.532ON2922802594e-26
KAFR0A018502.532ON2562492566e-26
NCAS0D026402.532ON2602542426e-24
TPHA0C041802.532ON2642102392e-23
CAGL0K02981g2.532ON2782722375e-23
KNAG0C058202.532ON2711942358e-23
TDEL0A030602.532ON2442222286e-22
NDAI0I022702.532ON2772752192e-20
Ecym_72562.532ON2432411944e-17
Smik_13.2482.532ON2551851875e-16
YMR069W (NAT4)2.532ON2851611842e-15
ZYRO0B01980g2.532ON1881561731e-14
TBLA0G022202.532ON2782791735e-14
Suva_13.2442.532ON2571491594e-12
Skud_13.2252.532ON2541541514e-11
Agos_YGOB_Anc_2.5322.532ON1871511372e-09
Kwal_56.238708.309ON54156657.8
NOTE: 1 genes in the same pillar as Kwal_26.8016 were not hit in these BLAST results
LIST: KLLA0E18569g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8016
         (240 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...   447   e-161
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   225   3e-73
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   160   3e-48
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   104   4e-26
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   103   6e-26
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...    98   6e-24
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    97   2e-23
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    96   5e-23
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    95   8e-23
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    92   6e-22
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    89   2e-20
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    79   4e-17
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    77   5e-16
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    75   2e-15
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    71   1e-14
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    71   5e-14
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    66   4e-12
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    63   4e-11
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    57   2e-09
Kwal_56.23870 s56 (751380..753005) [1626 bp, 541 aa] {ON} YLR116...    30   7.8  

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score =  447 bits (1151), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 231/240 (96%), Positives = 231/240 (96%)

Query: 1   MADYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDPCLLEQLLALV 60
           MADYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDPCLLEQLLALV
Sbjct: 1   MADYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDPCLLEQLLALV 60

Query: 61  DSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSL 120
           DSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSL
Sbjct: 61  DSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSL 120

Query: 121 LLTDEPELGPAPAAVVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGARRAHPFIQGTEL 180
           LLTDEPELGPAPAAVVYLMEIHVADIIR         REGVAGTVRGARRAHPFIQGTEL
Sbjct: 121 LLTDEPELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGARRAHPFIQGTEL 180

Query: 181 TVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESRKVTRPTYYLLFWPHEA 240
           TVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESRKVTRPTYYLLFWPHEA
Sbjct: 181 TVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESRKVTRPTYYLLFWPHEA 240

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  225 bits (573), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 136/263 (51%), Positives = 163/263 (61%), Gaps = 32/263 (12%)

Query: 1   MADYPADYLVPHVTDSFPTTLTLASGQR-IQRAVYGVPMDTVRS------RAEIPDP--- 50
           M DYPA  L PHVT  FP  LTL +GQ+ + RAVYG+P D  +       RA  P P   
Sbjct: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60

Query: 51  ------C---------LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPG 95
                 C         LL+QLL+LV +NLGP+Y +HA+A+YG    SW  RKR EM TPG
Sbjct: 61  PTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120

Query: 96  LVYVVYRAVDEETGKEGLPLAFLSLLLTDEPELGPAPAA-VVYLMEIHVADIIRXXXXXX 154
           LVYVVY      +     PL F+SLLLTDEPELG   AA V+YL EIHV+DIIR      
Sbjct: 121 LVYVVY------SDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGT 174

Query: 155 XXXREGVAGTVRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHR 214
              R+ + GT+    RA P + G ELTVF++N+ ALRLYL LGM +AAWSPQD   +V R
Sbjct: 175 HLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQVRR 234

Query: 215 RTRATRYESRKVTRPTYYLLFWP 237
           RTRA  Y+S  VTRP YY+LFWP
Sbjct: 235 RTRAIAYDSSLVTRPAYYILFWP 257

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  160 bits (406), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 131/248 (52%), Gaps = 20/248 (8%)

Query: 1   MADYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGV--PMDTVRSRAEI--------PDP 50
           M DYPA+ L+P+V DSFPT++TL  G    R V  +  P   +    ++           
Sbjct: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSN 60

Query: 51  CLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGK 110
            LL Q L ++D NLG  Y   +  LYG+   SW E K +EM T GLVYV Y         
Sbjct: 61  SLLIQFLKVLDLNLGSKYRSVSATLYGN-TRSWTENKLEEMQTIGLVYVGYF-------- 111

Query: 111 EGL-PLAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGAR 169
           +G+ PL FLS LLTDEP+  P P  VVYL EI +   ++         +  +  TV    
Sbjct: 112 QGVSPLMFLSFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLS 171

Query: 170 RAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESRKVTRP 229
           R  P ++G ELTVF+DN+ AL LY  +GM +A  SP D      RRTR +  + + V+RP
Sbjct: 172 RLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSRP 231

Query: 230 TYYLLFWP 237
            YYL+F P
Sbjct: 232 DYYLMFLP 239

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  104 bits (259), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 132/280 (47%), Gaps = 57/280 (20%)

Query: 8   YLVPHVTDSFPTTLTL---ASGQRIQRAVYG---VPMDTVRSRAEIPDPCL--------- 52
           +LV    + FP TL L    S    Q+ V     + +D+  ++ ++ +  L         
Sbjct: 6   HLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVKC 65

Query: 53  ---LEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETG 109
              L +LL ++D+NLGP+Y + +  +Y ++   WKE K  EM + GL+YV+Y   +++  
Sbjct: 66  DVVLNKLLDILDNNLGPIYLEKSSKIYCNE-KPWKENKIVEMKSEGLLYVIY---NDDIT 121

Query: 110 KEGLPLAFLSLLLTDEP-----------ELGPAPAAVVYLMEIHVADIIRXXXXXXXXXR 158
           KE  PL F+S ++TD+P           EL  + AAV+YL EI + ++IR          
Sbjct: 122 KE--PLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILIT 179

Query: 159 EGVAGTVRGARRAH-PFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCI-EVHRRT 216
             +  T+    + +   I   ELTVF++N  A+  Y ++GM     SP+D  I    RRT
Sbjct: 180 NYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRT 239

Query: 217 RATR--YESRKVTRPT-----------------YYLLFWP 237
           R+T    ES+    P+                 YYLLF P
Sbjct: 240 RSTTIALESKN-NEPSSRLTTSKPIKKIIKKPDYYLLFLP 278

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 121/249 (48%), Gaps = 31/249 (12%)

Query: 13  VTDSFPTTLTLASGQRIQRAVYGV---------------PMDTVRSRAEIPDPCLLEQLL 57
           V+D FP  L    GQ ++R +  +                 D +    E     LL+  L
Sbjct: 14  VSDEFPKELR-TKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFL 72

Query: 58  ALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAF 117
            ++D+NLG  Y + ++ +Y D   SWK+ K  EM +PGL+YV Y    EE  K+   L F
Sbjct: 73  EILDNNLGNKYEKISREIY-DNNDSWKKNKLVEMKSPGLIYVSYWK--EEAEKKTCAL-F 128

Query: 118 LSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGA----RRA 171
           LS +LT+E  +       +V+YL EI + +  R         + G++   + A    R A
Sbjct: 129 LSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIK-GLSNVCQIAQVKIRPA 187

Query: 172 HPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHR---RTRATRYESRKVTR 228
            P I G +LTVF+DN+ A++ Y R+GM+    SP+D   ++     RT   R   + V +
Sbjct: 188 FPLI-GIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVRK 246

Query: 229 PTYYLLFWP 237
           P YYLL+ P
Sbjct: 247 PIYYLLYLP 255

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score = 97.8 bits (242), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 119/254 (46%), Gaps = 36/254 (14%)

Query: 13  VTDSFPTTLTLASGQRIQ---RAVYGVPMDTVRSRAEIPD----PC-------LLEQLLA 58
           + + FP TL +   ++++   R +  +  D   S     D     C       +L+Q L 
Sbjct: 11  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLD 70

Query: 59  LVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFL 118
           ++D NLG  Y + +K +Y +    WK  K +EM +PGLVYV Y   DEE+ +   P+ FL
Sbjct: 71  ILDVNLGEKYTKVSKKIY-ENARPWKVNKLEEMRSPGLVYVSY--WDEESDE---PMLFL 124

Query: 119 SLLLTDEPELGPAPA--AVVYLMEIHVADIIRXXXXXXXXXREGVAGTV------RGARR 170
           S +LT+E          +VVYL EI +   +R          E +           G   
Sbjct: 125 SFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELL 184

Query: 171 AHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVH-RRTR------ATRYES 223
            +P I G ELTVF+DNE A++ Y  +GM++   SP+D    +  RRTR      +T    
Sbjct: 185 EYPLI-GIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVGR 243

Query: 224 RKVTRPTYYLLFWP 237
             V +P YYL + P
Sbjct: 244 TIVQKPIYYLFYLP 257

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 102/210 (48%), Gaps = 32/210 (15%)

Query: 51  CLLE--QLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEET 108
           C +E  ++L ++D+NLG +Y    K LYG+    WKE K QEM T GL+YVVY   DE  
Sbjct: 63  CEIEFSKILTILDNNLGDIYTIKNKKLYGN-SKPWKENKIQEMKTEGLIYVVYHLEDE-- 119

Query: 109 GKEGLPLAFLSLLLTDEPELGP---APAAVVYLMEIHVADIIRXXXXXXXXXREGVAGTV 165
            K+ + L +LS  LT E    P     + V+YL EI +   +R            +AG +
Sbjct: 120 -KKTVSL-YLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKL----IAGYL 173

Query: 166 RGA-----RRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEV-HR-RTRA 218
           +          H  I G ELTVF+DN  A+R Y  +GM++   SP D  I   HR +TR+
Sbjct: 174 KDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRS 233

Query: 219 TRYESRK-----------VTRPTYYLLFWP 237
                +            V +P YYL + P
Sbjct: 234 QNSSKKGSSSDKPTSLSVVKKPDYYLYYLP 263

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 95.9 bits (237), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 119/272 (43%), Gaps = 49/272 (18%)

Query: 7   DYLVPHVTDSFPTTLTLASGQ-------RIQRAVYGVPMD-------------TVRSRAE 46
           D  + HV D FP  +T  S         ++QR V  +  D              +RS+  
Sbjct: 13  DSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHI 72

Query: 47  IPDPCLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVY-RAVD 105
                +L  LL L+D NLG  Y   +K +YG++   WKE K +EM T G++YV Y   VD
Sbjct: 73  KESKNILSSLLELLDQNLGQKYEISSKEMYGNK-KPWKENKIEEMNTEGMIYVSYWTKVD 131

Query: 106 EETGKEGLPLAFLSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRXXXXXXXXXREGVAG 163
           +E     +PL FLS +LT+E  L      ++V++L EI ++  +R            +  
Sbjct: 132 DE---HTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQ 188

Query: 164 TVR------GARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIE------ 211
             +            PF  G ELTVF DN  A+ LY +LGM     SP+D   +      
Sbjct: 189 CAKRLLDNDSLNLEFPF-AGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRR 247

Query: 212 ------VHRRTRATRYESRKVTRPTYYLLFWP 237
                 ++ +  + R     + +P YY+ + P
Sbjct: 248 TRNSRKINNKNESPRI---LIKKPLYYMYWKP 276

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 95.1 bits (235), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/194 (34%), Positives = 95/194 (48%), Gaps = 23/194 (11%)

Query: 53  LEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEG 112
           L   L ++D+NLGPVYA+ ++ +YG+    W+E K  EM++  LVYV Y   D E     
Sbjct: 83  LRIFLEILDNNLGPVYARLSRKIYGNS-KHWRENKWLEMLSAQLVYVSYWVSDSE----- 136

Query: 113 LPLAFLSLLLTDEPELGPAPAA--VVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGARR 170
            P+ + S +LT+E  +    +   VVYL EI + + IR          + +   +     
Sbjct: 137 -PVLYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLG-----QAIVSYLTECAL 190

Query: 171 AHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRY-------ES 223
             P +    LTVF+DNE AL+ Y RL       SP+D   E  RR  A R          
Sbjct: 191 ESPEVAAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAARTALDPARDSD 250

Query: 224 RKVT--RPTYYLLF 235
            KVT  +PTYYLL+
Sbjct: 251 VKVTIKKPTYYLLY 264

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 92.4 bits (228), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 110/222 (49%), Gaps = 27/222 (12%)

Query: 9   LVPHVTDSFPTTLTLASGQRIQRAVYGV-----PMDTVRSRAEIPDP----CLLEQLLAL 59
           +V +   +FPTT+  A+G ++ R +  +     P++T +  + +  P     LL QLL +
Sbjct: 9   VVKYANQNFPTTIN-AAGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKLLWQLLEI 67

Query: 60  VDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVD-----EETGKEGLP 114
           +D NLG  YA  ++ALY +    W+  K +EM+TPGLVYV+Y         +       P
Sbjct: 68  LDENLGQKYAGSSRALYHN-TRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFSP 126

Query: 115 LAFLSLLLTDEPEL---GPAPA-AVVYLMEIHVADIIRXXXXXXXXXREGVAGT------ 164
           L FLS +LT+E  L    P     V+YL E+ +   +R          + +A        
Sbjct: 127 LLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLCT 186

Query: 165 -VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSP 205
             R  R +     G ELTVF DN  A+RLY  LGMQ+AA SP
Sbjct: 187 RSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 126/275 (45%), Gaps = 49/275 (17%)

Query: 6   ADYLVPHVTDSFPTTLTLASGQRI-QRAVYGVPMDT-----VRSRAEI----PDPC---- 51
           +D L+  V + FPT L  A G    +R ++  P        +   +E+     DP     
Sbjct: 6   SDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRSD 65

Query: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111
           +L + L ++D NLG  Y + +K +Y +   SWK  K +EM++PGL+YV Y    +E  +E
Sbjct: 66  VLNKFLNILDVNLGAKYTKVSKTIYEND-KSWKSNKLEEMLSPGLIYVSYW---DEKYQE 121

Query: 112 GLPLAFLSLLLT-------------DEPELGPAPAAVVYLMEIHVADIIR----XXXXXX 154
             PL FLS +LT             DE E      +V+YL EI +   +R          
Sbjct: 122 --PLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLS 179

Query: 155 XXXREGVAGTV-RGARRAHPF-IQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEV 212
               +  +  V +  +   P+ + G ELTVF+DN  A+  Y  +GM++   SP D   ++
Sbjct: 180 VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQI 239

Query: 213 HRRT-----RATRYESRKVT-----RPTYYLLFWP 237
            +R      R     +R+VT     +P YYL + P
Sbjct: 240 EKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLP 274

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 79.3 bits (194), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 103/241 (42%), Gaps = 60/241 (24%)

Query: 3   DYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDPCLLEQLLALVDS 62
           +YPA+ L  ++ D+FP  L   +G  + R +      +V +R +       +QL A+++ 
Sbjct: 2   EYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVAARQK-----FAKQLTAIIER 56

Query: 63  NLGPVYAQHAKALYGDQCGS--WKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSL 120
            LG  Y  HA  LY     S  W+  KR E+   G  +V+YR   E  G  G    F+SL
Sbjct: 57  TLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYR--KENPG--GAIAGFVSL 112

Query: 121 LLTDEP-----------------ELGPA---------------PAAVVYLMEIHVADIIR 148
           L  DEP                 E GP+               P  VVY+MEIHV+   +
Sbjct: 113 LFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQ 172

Query: 149 XXXXXXXXXREGVAGT--------VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQI 200
                     +G+           V+  + + P ++G ELTVFT N  AL LY R G + 
Sbjct: 173 ---------NQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKT 223

Query: 201 A 201
           A
Sbjct: 224 A 224

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 76.6 bits (187), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 84/185 (45%), Gaps = 19/185 (10%)

Query: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111
           +L+  + L+D +LG  Y + ++ +YG++   WK  K  EM +P LVYV Y          
Sbjct: 70  ILDSCVQLIDEHLGAKYRRASRTMYGNR-KPWKANKLAEMKSPNLVYVSY-------WDN 121

Query: 112 GLPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRXXXXXXXXXREGVA-GT 164
           G   AF S +LT+E  L    AA      V+YL E+HVA + R            +  G 
Sbjct: 122 GALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEGV 181

Query: 165 VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESR 224
            R  R  +    G  LTVF+DN  A RLY  LG   A  SP          TR TR+   
Sbjct: 182 ARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAPT----TRPTRHGGE 237

Query: 225 KVTRP 229
           +V  P
Sbjct: 238 RVVVP 242

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 75/161 (46%), Gaps = 15/161 (9%)

Query: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111
           +L+  + L+D +LG  Y + ++ +YG++   WK  K  EM + GLVYV Y          
Sbjct: 100 VLDACVQLIDKHLGAKYRRASRIMYGNR-KPWKANKLAEMKSAGLVYVCY-------WDN 151

Query: 112 GLPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRXXXXXXXXXREGVA-GT 164
           G+  AF S +LT+E  L    A       V+YL E+HVA   R            +  G 
Sbjct: 152 GVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGV 211

Query: 165 VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSP 205
            R  RR      G  LTVF+DN  A RLY  LG   A  SP
Sbjct: 212 ARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 11/156 (7%)

Query: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111
           +LE+ L L++ NLG  Y ++ K +Y +    W+  K QEM +  L +V Y  V+      
Sbjct: 20  ILEKQLQLIEINLGSYYNKYNKTIYKNN-KRWQSNKWQEMCSENLFHVSYWNVESNE--- 75

Query: 112 GLPLAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGARRA 171
              + F S++  +E  +    + ++YL EIHVA   R             A   +   +A
Sbjct: 76  --LVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILN---ALKEKLCPKA 130

Query: 172 HPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQD 207
           H  + G ELTVF+ NE A+  Y   G  ++  SP D
Sbjct: 131 H--LSGIELTVFSSNERAINFYRNNGFTLSYDSPSD 164

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 115/279 (41%), Gaps = 57/279 (20%)

Query: 9   LVPHVTDSFPTTLTLASGQRIQRAVYGV----------PMDTVRSRAEI----------- 47
           LV  V ++FP +++   G  ++R +Y +            +   +  EI           
Sbjct: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPT 65

Query: 48  PDPCLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEE 107
            +  +  Q+  L+D NLG +Y + +K +Y +    W   KR+EM T  ++Y+ Y      
Sbjct: 66  VENIIKTQIFQLIDENLGKLYKKKSKKIYENDL-DWSINKREEMFTSNMIYITYWDC--- 121

Query: 108 TGKEGLPLAFLSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRXXXXXXXXXR----EGV 161
             K+     FLS+L  +E  +        V+YL EIH+    +         +    E +
Sbjct: 122 --KQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL 179

Query: 162 AGTVRGARRAHPFIQGTELTVFTDNEGALRLYL-RLGMQIAAWSPQDTCIEVHRRTRATR 220
              ++  R+ + FI G ELTVF++N  A   Y  ++ MQ    SP+D  I V +R   + 
Sbjct: 180 IKPLKIERQDNNFI-GLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSF 238

Query: 221 YES----------------------RKVTRPTYYLLFWP 237
            E                       + + +P YY+L +P
Sbjct: 239 DEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFP 277

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 71/149 (47%), Gaps = 14/149 (9%)

Query: 53  LEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEG 112
           L   + LVD +LG  Y + ++ +YG++   WK  K  EM + GLVYV Y   D + G+  
Sbjct: 70  LHSCVQLVDEHLGAKYRRASRTMYGNRL-PWKANKLAEMKSAGLVYVCYWGNDAQ-GERA 127

Query: 113 LPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRXXXXXXXXXR--EGVAGT 164
           L  AF S +LT+E  L     A      V+YL E+H     R            EGVA  
Sbjct: 128 LG-AFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGLGRRLLAKALCEGVAAR 186

Query: 165 VRGARRAHPFIQGTELTVFTDNEGALRLY 193
           V   RR    + G  LTVF DN  A RLY
Sbjct: 187 V---RRTCDDLFGVALTVFGDNTRARRLY 212

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 71/154 (46%), Gaps = 15/154 (9%)

Query: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111
           +L+  + LVD +LG  Y + ++ +YG++   WK  K  EM + GL+YV Y          
Sbjct: 69  VLDSCVQLVDEHLGDKYRRASRTMYGNRI-PWKANKLAEMKSAGLLYVSYWG-------N 120

Query: 112 GLPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRXXXXXXXXXREGVA-GT 164
           G   AF S +LT+E  L    AA      V+YL EIHVA   R            +  G 
Sbjct: 121 GALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGV 180

Query: 165 VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGM 198
            R  RR      G  LTVF DN  A RLY  +G 
Sbjct: 181 ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (47%), Gaps = 28/151 (18%)

Query: 55  QLLALVDSNLGPVYAQHAKALYGD--QCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEG 112
            L ALV + L P+Y  HA+ LY       +W   KR E++ P  ++++YR   +  G+  
Sbjct: 43  DLTALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYR---DPAGRLA 99

Query: 113 LPLAFLSLLLTDEPELGPAPA-AVVYLMEIHVADIIRXXXXXXXXXREGVAGTVRGARRA 171
               F+SLLL       P PA  V+Y++E+HVA   R         R G+A  +  A   
Sbjct: 100 ---CFISLLL-------PGPADPVLYILELHVAAPFR---------RRGLAAALLDAATR 140

Query: 172 HPFIQGT---ELTVFTDNEGALRLYLRLGMQ 199
                G    ELTVFT N  AL LY R G +
Sbjct: 141 TARAAGLTRLELTVFTANRPALALYARAGFR 171

>Kwal_56.23870 s56 (751380..753005) [1626 bp, 541 aa] {ON} YLR116W
           (MSL5) - Branchpoint bridging protein [contig 171] FULL
          Length = 541

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 6/56 (10%)

Query: 1   MADYPADYLVPHVTDSF------PTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDP 50
           + DY ADY  P    S+       +T T A+G ++Q    G+  D+   +  IP P
Sbjct: 365 LEDYSADYERPSPVTSYRSRQFRDSTSTSATGSQVQNGPPGLENDSAHYKRNIPQP 420

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,654,976
Number of extensions: 815704
Number of successful extensions: 1345
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1320
Number of HSP's successfully gapped: 21
Length of query: 240
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 134
Effective length of database: 41,326,803
Effective search space: 5537791602
Effective search space used: 5537791602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)