Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_26.80012.530ON41341319040.0
KLTH0D06776g2.530ON40941712501e-171
SAKL0A09416g2.530ON38541410061e-134
CAGL0K02959g2.530ON4644178911e-116
YHR004C (NEM1)2.530ON4464598891e-116
Skud_8.492.530ON4474188861e-115
TDEL0A030502.530ON3554118771e-115
Suva_8.582.530ON4524238831e-115
NCAS0F009302.530ON4223728711e-113
Smik_8.532.530ON4464598621e-111
NDAI0H014202.530ON4483818411e-108
Kpol_348.82.530ON4224628361e-108
Ecym_72572.530ON3524148131e-105
KNAG0C058502.530ON4433698181e-105
TPHA0G035002.530ON3923578061e-104
KAFR0A018302.530ON4424668091e-104
AGL070W2.530ON3434107971e-103
ZYRO0B01958g2.530ON3363417302e-93
TBLA0I014602.530ON3933637013e-88
KLLA0E18613g2.530ON3744376315e-78
SAKL0G12870g5.202ON3991482392e-21
Kpol_2002.1005.202ON4771512403e-21
NCAS0D027405.202ON3981622366e-21
YLR019W (PSR2)5.202ON3971622341e-20
Smik_12.825.202ON3921622331e-20
NDAI0I021705.202ON3911502331e-20
Smik_12.535.202ON4141712332e-20
KAFR0J009905.202ON4831592324e-20
Skud_12.875.202ON3921602304e-20
CAGL0D05610g5.202ON4471532306e-20
Kwal_33.151405.202ON4101612287e-20
KLLA0F15620g5.202ON4141602288e-20
KLTH0B03388g5.202ON4091602289e-20
Suva_10.995.202ON3851682261e-19
TBLA0C060905.202ON4841602281e-19
Ecym_71045.202ON4921692262e-19
TDEL0E042705.202ON4531482262e-19
KNAG0M017405.202ON4811632253e-19
YLL010C (PSR1)5.202ON4271712243e-19
Skud_12.575.202ON4151602243e-19
CAGL0D03234g5.202ON4101652243e-19
TPHA0N006705.202ON4521492244e-19
AAL158W5.202ON4781622244e-19
NDAI0D018605.202ON5141662245e-19
TBLA0H019905.202ON6881702255e-19
Kpol_478.165.202ON3501592197e-19
ZYRO0B10428g5.202ON4821652201e-18
TPHA0E030705.202ON4941632182e-18
NCAS0A068005.202ON4731552183e-18
Suva_10.655.202ON4151602154e-18
YPL063W (TIM50)8.527ON4761041712e-12
Smik_16.1728.527ON4771041632e-11
Suva_16.2498.527ON4801491632e-11
SAKL0H10296g8.527ON4781041622e-11
TDEL0B031908.527ON4771041623e-11
NDAI0E029108.527ON4411491613e-11
NCAS0C022108.527ON4911491571e-10
TPHA0I020008.527ON4781491542e-10
Skud_16.2188.527ON4801041542e-10
CAGL0H05159g8.527ON4851491543e-10
KLLA0E23101g8.527ON4801041533e-10
Kpol_457.58.527ON4891001533e-10
ZYRO0F09130g8.527ON4891041533e-10
Kwal_27.119908.527ON4741041525e-10
TBLA0A005408.527ON4851041516e-10
KLTH0E12254g8.527ON4761041507e-10
Ecym_11778.527ON4901001373e-08
KNAG0A020608.527ON4501491373e-08
KAFR0E010208.527ON4481491346e-08
ADR045W8.527ON476991339e-08
KLTH0G17446gna 1ON420100741.2
Smik_15.4988.792ON445128703.6
ZYRO0A04950g3.188ON61840695.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8001
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   738   0.0  
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   486   e-171
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   392   e-134
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   347   e-116
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   347   e-116
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   345   e-115
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   342   e-115
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   344   e-115
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   340   e-113
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   336   e-111
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    328   e-108
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   326   e-108
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   317   e-105
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   319   e-105
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   315   e-104
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   316   e-104
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   311   e-103
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   285   2e-93
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   274   3e-88
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   247   5e-78
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    97   2e-21
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    97   3e-21
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    96   6e-21
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    95   1e-20
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    94   1e-20
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     94   1e-20
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    94   2e-20
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    94   4e-20
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    93   4e-20
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    93   6e-20
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    92   7e-20
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    92   8e-20
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    92   9e-20
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    92   1e-19
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    92   1e-19
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    92   2e-19
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    92   2e-19
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    91   3e-19
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    91   3e-19
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    91   3e-19
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    91   3e-19
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    91   4e-19
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    91   4e-19
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     91   5e-19
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    91   5e-19
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    89   7e-19
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    89   1e-18
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    89   2e-18
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    89   3e-18
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    87   4e-18
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    70   2e-12
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    67   2e-11
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    67   2e-11
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    67   2e-11
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    67   3e-11
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    67   3e-11
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     65   1e-10
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    64   2e-10
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   2e-10
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    64   3e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    64   3e-10
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    64   3e-10
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    64   3e-10
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    63   5e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    63   6e-10
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    62   7e-10
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    57   3e-08
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    57   3e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    56   6e-08
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    56   9e-08
KLTH0G17446g Chr7 complement(1511859..1513121) [1263 bp, 420 aa]...    33   1.2  
Smik_15.498 Chr15 complement(855989..857326) [1338 bp, 445 aa] {...    32   3.6  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...    31   5.3  

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/413 (88%), Positives = 367/413 (88%)

Query: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60
           MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW
Sbjct: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60

Query: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120
           SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT
Sbjct: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120

Query: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS 180
           SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS
Sbjct: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS 180

Query: 181 RQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHX 240
           RQSPK                    MGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIH 
Sbjct: 181 RQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHS 240

Query: 241 XXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY 300
                      QGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY
Sbjct: 241 MSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY 300

Query: 301 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYA 360
           ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYA
Sbjct: 301 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYA 360

Query: 361 MHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFSAT 413
           MHVDNAIQVEGWIS              EALRFTTDVRNILALKSGEHAFSAT
Sbjct: 361 MHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFSAT 413

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 262/417 (62%), Positives = 289/417 (69%), Gaps = 16/417 (3%)

Query: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60
           MNAISYLTNN L PK E  +++P  +E S   N   +     +  K+ +K +  RW  LW
Sbjct: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARID-----VAPKEAQKRKRARWTLLW 55

Query: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120
           S+L FLPNL+VVKP+LFVWFVITFPLSLIER+S+ E+ G    + +  G+  S+    T 
Sbjct: 56  SMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAE--GDSKSEASAGTI 113

Query: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHS--- 177
           S    S  RI+TI EE+DDL G+E+ LQ DTVKGSLT T+    E  QD  RRQ      
Sbjct: 114 SPKNSS--RISTITEEEDDLAGEEMILQADTVKGSLTVTSGAK-ERPQDKGRRQPLQPQQ 170

Query: 178 ---KGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLD 234
              K SRQS K                    MGRFLFPKKLIPQSVLNRRK RTLVLDLD
Sbjct: 171 QQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLD 230

Query: 235 ETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFT 294
           ETLIH            QGHMVEVKFA SGISTLYHVHKRPYCDLFLT IA WYELVVFT
Sbjct: 231 ETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFT 290

Query: 295 ASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDN 354
           ASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS V PN  LSDIFIIDN
Sbjct: 291 ASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDN 350

Query: 355 SPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFS 411
           SPVSYAMHVDNAIQVEGWIS              EALRFTTD+RN+LALKSGEHAF+
Sbjct: 351 SPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAFT 407

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  392 bits (1006), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/414 (52%), Positives = 264/414 (63%), Gaps = 33/414 (7%)

Query: 1   MNAISYLTNNALTPK-PEGPSSSPENIEGSADVNVSGNGKN-PQLKVKKTRKSRGIRWAF 58
           MNAISY+TN+   PK  E  S   +  +  A   VS + +N P+    K +  +  + + 
Sbjct: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60

Query: 59  LWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVS 118
           LWSI++FLPN  ++KP+LF W++ITFPL+LIE S     A   +      GN   DE+ +
Sbjct: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSP----ADDEDERNGEEGNSTGDEEKT 116

Query: 119 TTSDSVGSKPRINTIQEEDD-DLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHS 177
                    P IN I EED+ DL GDEI LQ D VKGSL+  +      SQ +   +  +
Sbjct: 117 ---------PSINIIVEEDEEDLAGDEIILQTDAVKGSLSTIS-----ESQQVKTIKAST 162

Query: 178 KGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETL 237
           + S +S                      MGRFLFPKKLIPQSVLN  K + LVLDLDETL
Sbjct: 163 RSSIRS-----------GSTGTALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETL 211

Query: 238 IHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASM 297
           IH            QGHMVEVKFA+SGIS+LY VHKRPYCDLFL+ +A WY LVVFTASM
Sbjct: 212 IHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASM 271

Query: 298 KEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPV 357
           KEYADPVIDWLESSF G FS+RLYRQDCILRDGVGYIKDLS ++  + L++I I+DNSP+
Sbjct: 272 KEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKS-LNEIIIVDNSPI 330

Query: 358 SYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFS 411
           SYAM+VDNAIQVEGWIS              EALRFTTD+RN+L+LKSGE AF+
Sbjct: 331 SYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAFN 384

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  347 bits (891), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 250/417 (59%), Gaps = 60/417 (14%)

Query: 7   LTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRW-AFLWSILVF 65
           ++NN +  KP       ++I+G                    + SRG+++   +WSI+ F
Sbjct: 92  VSNNKIEIKPVSDEDEEKDIDG--------------------QMSRGLKFFIVVWSIITF 131

Query: 66  LPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVS----TTS 121
            PN +++KP LFVWF++TFPLSLIE S            ++R G    +E +S    T  
Sbjct: 132 FPNYILIKPTLFVWFILTFPLSLIEHS------------VRRRGKATENEHLSQSPATNK 179

Query: 122 DSVGSKPRINTIQE--EDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKG 179
           D+  SK R+N I+E  EDD + G+ + LQ D +KGSL  TN    + SQ+ S++ +  K 
Sbjct: 180 DNSPSK-RLNVIEEAIEDDLISGEVMELQKDALKGSLLPTN---KDSSQNSSQKDR-GKK 234

Query: 180 SRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIH 239
           +  +P                     MGRF FPKKLIP+S+L   K +TLV+DLDETLIH
Sbjct: 235 TTSTP----------SHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIH 284

Query: 240 XXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKE 299
                       Q H++EV+FAISG+STLY+VHKRPYCDLFL+ +  WY L++FTASMKE
Sbjct: 285 SVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKE 344

Query: 300 YADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVA------PNTLLSDIFIID 353
           YADPVIDWLESSF G F++R+YR  CI RDGVGYIKDL  +           L+D+ IID
Sbjct: 345 YADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIID 404

Query: 354 NSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           NSPVSYAMHVDNAIQVEGWIS              EALR+TTDVRN+LALK+ E AF
Sbjct: 405 NSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAF 461

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  347 bits (889), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/459 (44%), Positives = 254/459 (55%), Gaps = 63/459 (13%)

Query: 1   MNAISYLTNNALTPKPE--------------GPSSSPENIEGSADVN------------- 33
           MNA+ Y +N+ +T K +              GPS    N   S   N             
Sbjct: 1   MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDHS 60

Query: 34  ---VSGNGKNPQLKVKKTRKSRGIR-------WAFLWSILVFLPNLLVVKPILFVWFVIT 83
              +  + +N + K    +K + +R        + LW++L+FLP  L++KP++ +WFV T
Sbjct: 61  SSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVFT 120

Query: 84  FPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKP-RINTIQE--EDDDL 140
           FPLS+IER           S+        S   ++ +S+    K   +NTI E  EDD  
Sbjct: 121 FPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDLN 180

Query: 141 GGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKXXXXXXXXXXXXXXX 200
             DEI LQ D VKGSL     V        SR + +SK                      
Sbjct: 181 ASDEIILQRDNVKGSLLRAQSVK-------SRPRSYSKSELSL--------SNHSSSNTV 225

Query: 201 XXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKF 260
                MGRFLFPKKLIP+SVLN +K + LV+DLDETLIH            QGH+VEVKF
Sbjct: 226 FGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKF 285

Query: 261 AISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRL 320
            +SGI TLY +HKRPYCDLFLT ++ WY+L++FTASMKEYADPVIDWLESSFP  FS+R 
Sbjct: 286 GLSGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRY 345

Query: 321 YRQDCILRDGVGYIKDLSAV--------APNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           YR DC+LRDGVGYIKDLS V          ++ L D+ IIDNSPVSYAM+VDNAIQVEGW
Sbjct: 346 YRSDCVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 405

Query: 373 ISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFS 411
           IS              EA+R++TDVRNILALK GE AF+
Sbjct: 406 ISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  345 bits (886), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 244/418 (58%), Gaps = 60/418 (14%)

Query: 22  SPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIR----WAFLWSILVFLPNLLVVKPILF 77
           S +N+EGS       N  N Q    K +  R I      + LW+IL+FLP  L++KP++ 
Sbjct: 60  STDNLEGSKQ-----NEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMS 114

Query: 78  VWFVITFPLSLIER--------SSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKP- 128
           +WFV TFPLS+IER           P ++G   S+    GN         +++  GSK  
Sbjct: 115 LWFVFTFPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGN--------DSNEKAGSKNG 166

Query: 129 RINTIQEE-DDDLGG-DEIFLQPDTVKGSLTATNCVPPEHSQ----DLSRRQQHSKGSRQ 182
            +NTI E  DDDL   DEI LQ D VKGSL     V          D+S     +  +  
Sbjct: 167 NLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVF 226

Query: 183 SPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXX 242
             K                    MGRFLFPKKLIP+S+LN +K + LV+DLDETLIH   
Sbjct: 227 GTKR-------------------MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSAS 267

Query: 243 XXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYAD 302
                    QGH+VEVKF ISGI TLY +HKRPYCD FLT ++ WY+L++FTASMKEYAD
Sbjct: 268 RSTTHSNSSQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYAD 327

Query: 303 PVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN---------TLLSDIFIID 353
           PVIDWLESSFP  FS+R YR DC+LRDGVGYIKDLS +  +         + L D+ IID
Sbjct: 328 PVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIID 387

Query: 354 NSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFS 411
           NSPVSYAM+VDNAIQVEGWIS              EA+R++TDVRNILALK GE AF+
Sbjct: 388 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 445

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  342 bits (877), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/411 (45%), Positives = 241/411 (58%), Gaps = 59/411 (14%)

Query: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60
           MNA+SY+++        G +   E++E    V           K +K  + R    ++ W
Sbjct: 1   MNAVSYISDQLSKRDKNGKT---EDVEDKVAVQ----------KREKIVRRRSKFTSYAW 47

Query: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120
           ++++F P  L++KP   +W++I+ PL LIE         G +S LQR           +T
Sbjct: 48  AVILFFPQWLIIKPTQLIWWIISLPLLLIEY--------GLKSRLQR----------KST 89

Query: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS 180
             S G+   I+ + EEDD  GGDEIFLQ D VKGSL                        
Sbjct: 90  KRSTGTLQSISEL-EEDDLAGGDEIFLQRDAVKGSL------------------------ 124

Query: 181 RQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHX 240
             +P                     MGRFLFPKKLIP+SVL+  K + LV+DLDETLIH 
Sbjct: 125 --APAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHS 182

Query: 241 XXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY 300
                      QGHMVE++FAISG+STLY+VHKRP+CDLFL+ ++ WY+LVVFTASM+EY
Sbjct: 183 ASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREY 242

Query: 301 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVA-PNTLLSDIFIIDNSPVSY 359
           ADPVIDWLE SF G+FS+RLYR +CILRDGVGYIKDLS V  P   L ++ ++DNSP+SY
Sbjct: 243 ADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISY 302

Query: 360 AMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           AM+VDNAIQVEGWIS              EALR+TTDVR+ILALK+ E AF
Sbjct: 303 AMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  344 bits (883), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/423 (47%), Positives = 249/423 (58%), Gaps = 47/423 (11%)

Query: 9   NNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLWSILVFLPN 68
           N+      EGP+   ++ E +  V+      +  LK K          + LW+IL+FLP 
Sbjct: 55  NHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEKIV--------SILWAILLFLPY 106

Query: 69  LLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVG--- 125
            L++KP++ +WFV TFPL++IER         T+   + +G+  S  + ST S   G   
Sbjct: 107 YLIIKPLMSLWFVFTFPLNVIERR-----VKHTDKRHKESGD--SGHEPSTDSSHSGDFN 159

Query: 126 ----SKPR-INTIQE--EDDDLGGDEIFLQPDTVKGSL-TATNCVPPEHSQDLSRRQQHS 177
               +K R +NTI E  EDD    DEI LQ D VKGSL  A + V    S+  SRR   S
Sbjct: 160 EKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSK--SRRYSKS 217

Query: 178 KGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETL 237
           + S                         MGRFLFPKKLIP+S+LN +K + LV+DLDETL
Sbjct: 218 EAS----------LTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETL 267

Query: 238 IHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASM 297
           IH            QGH+VEVKF ISGISTLY +HKRPYCDLFLT  + WY+L++FTASM
Sbjct: 268 IHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASM 327

Query: 298 KEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN---------TLLSD 348
           KEYADPVIDWLE SF   FS+R YR DC+LRDGVGYIKDLS +  +         + L D
Sbjct: 328 KEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSSLDD 387

Query: 349 IFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEH 408
           + IIDNSPVSYAM+VDNAIQVEGWIS              EA+R++TDVRNILALK GE 
Sbjct: 388 VIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEK 447

Query: 409 AFS 411
           AF+
Sbjct: 448 AFN 450

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  340 bits (871), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/372 (48%), Positives = 230/372 (61%), Gaps = 42/372 (11%)

Query: 52  RGIRWAFL-WSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGN 110
           R +R++ L W+ ++F P  L+VKP+LF+WF++TFPL L+ER     +    +       N
Sbjct: 77  RALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKN 136

Query: 111 LYSDEQVSTTSDSVGSKPRINTIQE--EDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQ 168
               E+V TTS      P +  I E  EDD  GGDEI+LQ DT+KGSL          S 
Sbjct: 137 A---ERVPTTS------PELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATSAKQLSSS 187

Query: 169 DLSRRQQHSKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRT 228
              +    +  S  S +                    MG+FLFPKKLIP+S++   + + 
Sbjct: 188 KTVKSISSNNTSFSSKR--------------------MGKFLFPKKLIPRSIVQTNRRKK 227

Query: 229 LVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWY 288
           LVLDLDETLIH            QGH+VEVKF++SG+STLY+VHKRPYCD FL+ ++ WY
Sbjct: 228 LVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287

Query: 289 ELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNT---- 344
           +L++FTASMKEYADPVIDWLE S P KFS+RLYR DCILRDGVGYIKDLS ++  +    
Sbjct: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347

Query: 345 ------LLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVR 398
                  L +I IIDNSP+SYAM+V+NAIQVEGWIS              EALRFTTDVR
Sbjct: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVR 407

Query: 399 NILALKSGEHAF 410
           N+LALK+GE AF
Sbjct: 408 NVLALKNGEKAF 419

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  336 bits (862), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/459 (44%), Positives = 258/459 (56%), Gaps = 63/459 (13%)

Query: 1   MNAISYLTNNALTPKP-------------------EGPSSSPENIEGSADVNVSGN---- 37
           MNA+ Y +N+ +T K                    E  ++   +IE +  + V+ +    
Sbjct: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60

Query: 38  -------GKNPQLKVKKTRKSRGIR-------WAFLWSILVFLPNLLVVKPILFVWFVIT 83
                   +N + K+  + K + +R        + LW++L+FLP  LV+KP++ +W+V T
Sbjct: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVFT 120

Query: 84  FPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKP-RINTIQE--EDDDL 140
           FPLS+IER          ESS    G+  S      +S+ + SK   +NTI E  EDD  
Sbjct: 121 FPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDLN 180

Query: 141 GGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKXXXXXXXXXXXXXXX 200
             DEI LQ D VKGSL                R Q  K   +S                 
Sbjct: 181 ASDEIILQRDNVKGSLL---------------RAQSVKLRSRSYSKSEVSLTNHSSTNTV 225

Query: 201 XXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKF 260
                MGRFLFPKKLIP+SVLN +K + LV+DLDETLIH            QGH+VEVKF
Sbjct: 226 FGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKF 285

Query: 261 AISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRL 320
            ISGI TLY +HKRPYCDLFLT ++ WYEL++FTASMKEYADPVIDWLESSFP  FSRR 
Sbjct: 286 GISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRY 345

Query: 321 YRQDCILRDGVGYIKDLSAV--------APNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           YR DC+LRDGVGYIKDLS +          ++ L D+ IIDNSPVSYAM+VDNAIQVEGW
Sbjct: 346 YRSDCVLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 405

Query: 373 ISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFS 411
           IS              EA+R++TDVRNILALK GE AF+
Sbjct: 406 ISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  328 bits (841), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/381 (46%), Positives = 234/381 (61%), Gaps = 34/381 (8%)

Query: 43  LKVKKTRKSRGIRWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTE 102
           L V   RK++    + LWS L+F P +L++KPILF+W+++TFPLSLIER +       ++
Sbjct: 89  LNVTDDRKTKNNVTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQ 148

Query: 103 SSLQRTGNLYSDEQVSTTSDSVGSKP-RINTIQE--EDDDLGGDEIFLQPDTVKGSLTAT 159
           S   +  +   DE +   +  +  +P +++ I E  EDD + GD I+LQ D VKGSL   
Sbjct: 149 S---KDSSPEKDETLVHNNSFLPEEPSKLDAINELTEDDLVSGDGIYLQRDNVKGSLLKA 205

Query: 160 NCVPPEHSQDLSRRQQHSKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQS 219
           + V       LSR  +    +  S                      MG+FLFPKKLIP+S
Sbjct: 206 SSV---RQPSLSRSMKTMVSNNTS-----------------FSSKRMGKFLFPKKLIPKS 245

Query: 220 VLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDL 279
           +    + + LVLDLDETLIH            QGH+VEVKF+ SG+S LY+VHKRPYCD 
Sbjct: 246 ITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLYYVHKRPYCDF 305

Query: 280 FLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS- 338
           FL+ +  WY+L++FTASMKEYADPVIDWLE+SF G F+ R YR DCI RDGVGYIKDL+ 
Sbjct: 306 FLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYIKDLTI 365

Query: 339 -------AVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEAL 391
                  +V   + LS++ I+DNSP+SYAM+ DNAIQVEGWIS              EAL
Sbjct: 366 IKDDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEAL 425

Query: 392 RFTTDVRNILALKSGEHAFSA 412
           R+TTDVR+ILALK+GE AF A
Sbjct: 426 RYTTDVRSILALKNGERAFYA 446

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  326 bits (836), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 253/462 (54%), Gaps = 92/462 (19%)

Query: 1   MNAISYLTNNALTP--KPEGPS-SSPENIEG-SADVNVSGNGKNPQL--KVKKTRKSRGI 54
           MNA+SY+++N +TP  + E PS S  E+++  + DV+ +      Q+  KV+        
Sbjct: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60

Query: 55  RWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSST--PESAGGTESSLQRTGNLY 112
           R   +  +L+F P  L+VKPI F+WF+ITFP++L E+ +   P+S+              
Sbjct: 61  RSTLVL-VLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANL----------- 108

Query: 113 SDEQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSR 172
                    D++     +N + EED   GG EI LQ DT+ GSL  +             
Sbjct: 109 ---------DTMSKSKNLNILVEEDLS-GGGEIILQRDTLNGSLLKSRA----------- 147

Query: 173 RQQHSKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLD 232
            QQHS  SR +                      +GRFLFPKKLIP+S+L+  + + LVLD
Sbjct: 148 NQQHSHQSRHAKSSSSSVGLISKK---------IGRFLFPKKLIPRSILHSGRKKKLVLD 198

Query: 233 LDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVV 292
           LDETLIH            Q H+VEVKF ISGISTLY+VHKRPYCDLFL+ +  WY+L++
Sbjct: 199 LDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLII 258

Query: 293 FTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAP---------- 342
           FTASMKEYADPVIDWLE+SF G FS+R YR DCILRDGVGYIKDLS V            
Sbjct: 259 FTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTT 318

Query: 343 --------------------------------NTLLSDIFIIDNSPVSYAMHVDNAIQVE 370
                                           N LLS++ +IDNSPVSYAM+VDNAIQV+
Sbjct: 319 SHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQ 378

Query: 371 GWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAFSA 412
           GWIS              E+LR TTDVRNIL+LK+GE AF+ 
Sbjct: 379 GWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNV 420

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  317 bits (813), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/414 (43%), Positives = 244/414 (58%), Gaps = 67/414 (16%)

Query: 1   MNAISYLTNNALTPKPEGPSSSPENIE----GSADVNVSGNGKNPQLKVKKTRKSRGIRW 56
           MN++SYLT ++     +  SSS E +      S+  NV+   +    +V  ++ S+G R 
Sbjct: 1   MNSLSYLTGSS-----QPTSSSKEELRFPFSESSLPNVTEEQEVENGEV--SQDSKGGRP 53

Query: 57  AFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQ 116
           +++W ++ FLP  L++KPI  +WFV+TFPL+LIE +S+            + G++  +E 
Sbjct: 54  SWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSS------------KDGSVEEEEV 101

Query: 117 VSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQH 176
           + T S   G    I     EDDDL G+ + L  D++K S  +T+                
Sbjct: 102 IPTNSQGSGGGEVI-----EDDDLVGESMVLHEDSIKSSRPSTS---------------- 140

Query: 177 SKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDET 236
                                        +G+FLFPKKLIPQS+L   + + LVLDLDET
Sbjct: 141 ---------------------RSSYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDET 179

Query: 237 LIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTAS 296
           LIH            QGHMVEV F++SG+S+LY+VHKRPYCDLFL+ +  WY+LV+FTAS
Sbjct: 180 LIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTAS 239

Query: 297 MKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSP 356
           M+EYADPVIDWLES    +F++R YR DCILRDG+GY+KDL+ ++ N  L D  I+DNSP
Sbjct: 240 MREYADPVIDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMISKN--LQDTIIVDNSP 297

Query: 357 VSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           VSYAM+VDNAIQVEGWIS              E LRFTTD RNIL+LK+GEHAF
Sbjct: 298 VSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  319 bits (818), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 232/369 (62%), Gaps = 41/369 (11%)

Query: 56  WAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDE 115
           W  L  ++ FLP  L+ KP+L +WF++T PL+L+ER             L+    + +++
Sbjct: 101 WNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVERGI----------KLRNRPKMKTEK 150

Query: 116 QVSTTSDSVGSKP-RINTIQEE-DDDLG-GDEIFLQPDTVKGSL---TATNCVPPEHSQD 169
                S+ V S P ++ +I EE ++DL  GDE +LQ D VKGSL   T      P  S+ 
Sbjct: 151 ----VSELVLSDPSKLGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKK 206

Query: 170 LSRRQQHSKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTL 229
            S + QH  G+   P                     MGRFLFPKKLIP+S+LNR K +TL
Sbjct: 207 NSAQNQH--GNETHPNSTVFGTKK------------MGRFLFPKKLIPKSILNREKKKTL 252

Query: 230 VLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYE 289
           V+DLDETLIH            QGH+VEVKF+ISG+STLY+V KRPYCDLFLT ++ WY+
Sbjct: 253 VMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYVFKRPYCDLFLTKVSKWYD 312

Query: 290 LVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNT----- 344
           +V+FTASMKEYADPVIDWLESSF GKFSRRLYR DCILRDGVGYIKDL  V   +     
Sbjct: 313 IVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGVGYIKDLKMVTRGSNLGTS 372

Query: 345 --LLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILA 402
              L D+ I+DNSPVSYA++VDNAIQVEGWI+              EAL  TTDVRNIL+
Sbjct: 373 PDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILS 432

Query: 403 LKSGEHAFS 411
           LK+GE AF+
Sbjct: 433 LKNGEKAFN 441

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  315 bits (806), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/357 (48%), Positives = 216/357 (60%), Gaps = 37/357 (10%)

Query: 73  KPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPRINT 132
           KP+LF W+++TFPL+L E+++   S  G     Q   +L     ++  +    +K R  T
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNN---SNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRT 107

Query: 133 IQEE------DDDLGGDEIFLQPDTVKGSL-TATNCVPPEHSQDLSRRQQHSKGSRQSPK 185
            Q +      +DD+ G E+ LQ DTVKGSL  A+N      +    +     K    S  
Sbjct: 108 EQLQNLDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSS-- 165

Query: 186 XXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXX 245
                               MGRFLFPKKLIP+S+L+  + + LVLDLDETLIH      
Sbjct: 166 -------------VAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSN 212

Query: 246 XXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVI 305
                 Q H+VEVKF ISGISTLY+VHKRPYCDLFL+ ++ WY+L++FTASMKEYADPVI
Sbjct: 213 SNSNNAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVI 272

Query: 306 DWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSA------------VAPNTLLSDIFIID 353
           DWLESSF G FS+R YR  CILRDGVGYIKDLS             V  N++L +I +ID
Sbjct: 273 DWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILID 332

Query: 354 NSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           NSPVSYAM+VDNAIQVEGWIS              E+LR+TTDVRNIL+LK+GE AF
Sbjct: 333 NSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  316 bits (809), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/466 (39%), Positives = 252/466 (54%), Gaps = 83/466 (17%)

Query: 1   MNAISYLTNNALTPKPEGPSSS-------PENIEGSADVNVSGNGKNPQLKVKKTRKSRG 53
           MNA+SY+TN+   P  +   ++       PENI G  D +   N +   +  +     +G
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 54  IR------------------------------------WAFLWSILVFLPNLLVVKPILF 77
           +                                     ++ L +I++F+P  L + P+++
Sbjct: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120

Query: 78  VWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPRINTIQEED 137
           VWF++T PL+L+ER          +   +  GN     ++S           I+ + EED
Sbjct: 121 VWFILTLPLTLVERGIKLRDR---KKKAELRGNFGESSELSPLRS-------ISEVGEED 170

Query: 138 DDLGGDEIFLQPDTVKGSLT-ATNCVPPEHSQDLSRRQQHSKGSRQSPKXXXXXXXXXXX 196
                DE FLQ DT+KGSL  A++  PP   +  S  +Q  +    +             
Sbjct: 171 LS-TSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTN------------- 216

Query: 197 XXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMV 256
                    MGRFLFPKKLIP+S+L   + +TLV+DLDETLIH            QGH+V
Sbjct: 217 ---IFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLV 273

Query: 257 EVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKF 316
           EVKF+I+GISTLY+VHKRP+CDLFL+ ++ WY +V+FTASMKEYADPVIDWLE SF G F
Sbjct: 274 EVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNF 333

Query: 317 SRRLYRQDCILRDGVGYIKDLSAVA------------PNTLLSDIFIIDNSPVSYAMHVD 364
           ++RLYR +C+LRDGVGYIKDLS +             P   L ++ IIDNSPVSYA++VD
Sbjct: 334 AKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVD 393

Query: 365 NAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           NAIQVEGWIS              EALR+TTDVRN+LALK+GE  F
Sbjct: 394 NAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  311 bits (797), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/410 (44%), Positives = 228/410 (55%), Gaps = 68/410 (16%)

Query: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60
           MN++SYLT        +G    P +  G A V    +     +             A++W
Sbjct: 1   MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQDAARAGVGAGA---------AWVW 51

Query: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120
            +L FLP  LVVKP++ VWFV+TFPLSLIE++S+ E+ G                     
Sbjct: 52  RVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGPEAAEE------------ 99

Query: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS 180
                          EDDDL G+ + LQ D+VK S  +T+      ++            
Sbjct: 100 --------EQLAEAVEDDDLAGESMVLQEDSVKSSRPSTSRSSYTSTR------------ 139

Query: 181 RQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHX 240
                                    +G+FLFPKKLIPQS+L   + + LVLDLDETLIH 
Sbjct: 140 -------------------------LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHS 174

Query: 241 XXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY 300
                      QGHMVEV FA SG+STLY+VHKRPYCDLFL+ ++ WY+LV+FTASMKEY
Sbjct: 175 MSRSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEY 234

Query: 301 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYA 360
           ADPVIDWLES    +FS+R YR DC+LRDGVGY+KDLS ++ N  L DI I+DNSP+SYA
Sbjct: 235 ADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKN--LQDIIIVDNSPISYA 292

Query: 361 MHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           M+VDNAIQVEGWIS              E LRFTTD RNIL+LK+GE AF
Sbjct: 293 MNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  285 bits (730), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 200/341 (58%), Gaps = 64/341 (18%)

Query: 70  LVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPR 129
           + +KP   +WFVIT PL LIE                    L S ++V +TS     K  
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYG------------------LKSKQKVESTS----RKGE 96

Query: 130 INTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKXXXX 189
           I   +E DDDL  DE+FLQ DTVKG L                    + G+++       
Sbjct: 97  IIRKKEVDDDLAEDEMFLQRDTVKGGLRGK-----------------AFGTKK------- 132

Query: 190 XXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXX 249
                           MGRFLFPKKL+PQS+L   + + LV+DLDETLIH          
Sbjct: 133 ----------------MGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN 176

Query: 250 XXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLE 309
             QGHMVEV+F  S ISTLY+VHKRP+CDLFL+ ++ WY+L++FTASMKEYADPVIDWLE
Sbjct: 177 SAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLE 236

Query: 310 SSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQV 369
           SSF GKF +RLYR +C++R+GVGYIKDLS V    +L ++ +IDNSP SYA + DNAIQV
Sbjct: 237 SSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTE--VLDEVVLIDNSPTSYARNEDNAIQV 294

Query: 370 EGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGEHAF 410
           EGWIS              EALR+ TDVR+IL LK+GE A 
Sbjct: 295 EGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  274 bits (701), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 155/363 (42%), Positives = 202/363 (55%), Gaps = 51/363 (14%)

Query: 70  LVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPR 129
           +++KP++F+W++ TFPL LIE               Q T   Y D     T   +  K  
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIE---------------QHTNRKYKD-----TPPLIDPKIA 96

Query: 130 INTIQEEDDDLGGDEIFLQPDTVKGSL--------TATNCVPPEHSQDLSRRQQHSKGSR 181
            ++  + DD    DEI LQ D++KGSL         AT    P  +       +  K   
Sbjct: 97  SSSATDLDDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQN 156

Query: 182 QSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXX 241
           +S                      MGRFLFPKKLIP S+L   K + L+LDLDETLIH  
Sbjct: 157 KS---------VYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSM 207

Query: 242 XXXXXXXXXXQGHMVEVKFAISG------------ISTLYHVHKRPYCDLFLTTIANWYE 289
                       H++EVKF                +S+LY+V+KRPYCD FL  +++WY+
Sbjct: 208 SRNISSSTISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYD 267

Query: 290 LVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN--TLLS 347
           L++FTASMKEYADPVIDWLE SF G F +RLYR  CILRDG+GYIKDLS +  +  + L+
Sbjct: 268 LIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLN 327

Query: 348 DIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDVRNILALKSGE 407
           ++ +IDNSP+S+AM+VDNAIQV+GWIS              E+LR TTDVRNILALK+GE
Sbjct: 328 ELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGE 387

Query: 408 HAF 410
            AF
Sbjct: 388 RAF 390

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  247 bits (631), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 157/437 (35%), Positives = 214/437 (48%), Gaps = 90/437 (20%)

Query: 1   MNAISYLTNNALTPK-------------PEGPSSSPENIEGSADVNVSGNGKNPQLKVKK 47
           MNAIS+L+N    P+             P   ++ P  ++       +            
Sbjct: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKTTTASTTTSTTTTSTATN 60

Query: 48  TRKSRGIRWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQR 107
            R    +RW  +W IL+FLPN L++KPI+ +W+VITFPL+L+E ++      G +  +Q 
Sbjct: 61  KRNRPFMRW--IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ-----GNKGLIQ- 112

Query: 108 TGNLYSDEQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHS 167
                    V + +DS   K  ++    E+D    DEI +  D +K              
Sbjct: 113 ---------VGSETDSRTEK--LSKYVVEEDLSPTDEIIINQDKMK-------------- 147

Query: 168 QDLSRRQQHSKGSRQSPKXXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKPR 227
                           P+                    +G+F FPKKL+PQS+L     +
Sbjct: 148 ----------------PRPITEY---------------LGKFHFPKKLVPQSMLLSTSRK 176

Query: 228 TLVLDLDETLIHXXXXXXXXXXXXQG---------HMVEVKFAISGISTLYHVHKRPYCD 278
            LVLDLDETLIH                       H+VEV+F  + ISTLY+V KRPYCD
Sbjct: 177 LLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCD 236

Query: 279 LFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS 338
           +FL   + WY++ +FTASMKEYADPVIDWL+ +   +F  R YR+DC LR GVGY+KD+ 
Sbjct: 237 MFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIG 296

Query: 339 AVAPNTL----LSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFT 394
            VA        LS + IIDNSP+SYAMH+DNAIQV GWI+              +A+R  
Sbjct: 297 TVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHV 356

Query: 395 TDVRNILALKSGEHAFS 411
           TD R ILALKSG  + S
Sbjct: 357 TDSRCILALKSGRASIS 373

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 79/148 (53%), Gaps = 11/148 (7%)

Query: 227 RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIAN 286
           + LVLDLDETL+H                VE+   +  +    +V KRP  D FL  +  
Sbjct: 230 KCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKRPGVDEFLERVGK 283

Query: 287 WYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLL 346
            YE+VVFTAS+  Y DP++D L+    G    RL+R  C   DG  YIK+LS +     L
Sbjct: 284 LYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYIKNLSQIG--RPL 338

Query: 347 SDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           SD+ I+DNSP SY +H  +AI +  W S
Sbjct: 339 SDLIILDNSPASYILHPQHAIPISSWFS 366

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 80/151 (52%), Gaps = 11/151 (7%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           +  + LVLDLDETL+H                  +   I   +   +V KRP  D FL  
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFV------LPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           +   +E+VVFTAS+  Y DP++D L+SS       RL+R+ C + DG  Y+K+LS +   
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQIG-- 413

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
             LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 414 RPLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 95.5 bits (236), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 16/162 (9%)

Query: 218 QSVLNRRKP-----RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH 272
           +++L+ RKP     + LVLDLDETL+H                VE++  I  +    +V 
Sbjct: 215 KTLLSPRKPEFSNKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVI 268

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL  +   YE+VVFTAS+  Y DP+++ L+ S       RL+R+ C   +G  
Sbjct: 269 KRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-N 325

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           YIK+L+ +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 326 YIKNLAQIG--RPLSDIIILDNSPASYMFHPQHAIPISSWFS 365

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 88/162 (54%), Gaps = 15/162 (9%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH-- 272
           L+P  +   ++ + L+LDLDETL+H              H  +    +     +++V+  
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYM--------HSADFVLPVEIDDQVHNVYVI 267

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL  ++  YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 324

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 325 YIKNLSQIG--RPLSETIILDNSPASYIFHPQHAVPISSWFS 364

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 88/162 (54%), Gaps = 15/162 (9%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH-- 272
           L+P  +   ++ + L+LDLDETL+H              H  +    +     +++V+  
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYM--------HTADFVLPVEIDDQVHNVYVI 262

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL+ +   YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  
Sbjct: 263 KRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 319

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 320 YIKNLSQIG--RPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 82/150 (54%), Gaps = 15/150 (10%)

Query: 227 RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH--KRPYCDLFLTTI 284
           + LVLDLDETL+H              H  +    +     +++V+  KRP  D FL  +
Sbjct: 222 KCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVIKRPGVDEFLRRV 273

Query: 285 ANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNT 344
           A  YE+VVFTAS+  Y DP++D L+SS       RL+R+ C   +G  Y+K+L+ +    
Sbjct: 274 AQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG-NYVKNLAQIG--R 328

Query: 345 LLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
            LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 329 PLSEIVILDNSPASYMFHPQHAIPISSWFS 358

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 89/171 (52%), Gaps = 13/171 (7%)

Query: 206 MGRFLFP--KKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAIS 263
            G++  P  K L+P    N +  + L+LDLDETL+H                VE+   + 
Sbjct: 222 QGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVH 279

Query: 264 GISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ 323
            +    +V KRP  + FL  +   +E+VVFTAS+  Y DP++D L++        RL+R+
Sbjct: 280 NV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD--KVIHHRLFRE 333

Query: 324 DCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
            C   +G  YIK+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 334 ACYNYEG-NYIKNLSQIG--RPLSDIIILDNSPASYIFHPQHAIPISSWFS 381

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 86/159 (54%), Gaps = 15/159 (9%)

Query: 217 PQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPY 276
           P+  L+R+K   LVLDLDETL+H                V++   I  +    +V KRP 
Sbjct: 306 PEKSLSRKK--CLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKRPG 357

Query: 277 CDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCILRDGVGYIK 335
            D FL  +   +E+VVFTAS+  Y DP++D L+    GK    RL+R+ C   +G  YIK
Sbjct: 358 VDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDK---GKSIHHRLFREACYNYEG-NYIK 413

Query: 336 DLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           +LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 414 NLSQLG--RPLSDIIILDNSPASYIFHPQHAIPISSWFS 450

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 87/160 (54%), Gaps = 11/160 (6%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P  +   ++ + L+LDLDETL+H                VE+   +  +    +V KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  D FL  ++  YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 322 KNLSQIG--RPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 80/153 (52%), Gaps = 15/153 (9%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH--KRPYCDLFL 281
           +  + LVLDLDETL+H              H  +    +     +++V+  KRP  D FL
Sbjct: 275 KHKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVIKRPGVDEFL 326

Query: 282 TTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVA 341
             +   YE+VVFTAS+  Y DP++D L+ S       RL+R  C   +G  YIK+LS + 
Sbjct: 327 QRVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQIG 383

Query: 342 PNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
               LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 384 --RPLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 85/161 (52%), Gaps = 16/161 (9%)

Query: 219 SVLNRRKP-----RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHK 273
           ++L+ ++P     + LVLDLDETL+H                VE+   I  +    +V K
Sbjct: 228 TLLSAKRPEFNGKKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIK 281

Query: 274 RPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGY 333
           RP  D FL  +   YE+VVFTAS+  Y DP++D L+ +       RL+R  C   DG  Y
Sbjct: 282 RPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NY 338

Query: 334 IKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           IK+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 339 IKNLSQIG--RPLSDLIILDNSPASYIFHPQHAIPISSWFS 377

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 85/160 (53%), Gaps = 12/160 (7%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P++ + + K + LVLDLDETL+H                VE+   +  +    +V KR
Sbjct: 234 LLPKADMFKGK-KCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKR 286

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  D FL  I   YE+VVFTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NYI 343

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 344 KNLSQIG--RPLSDMIILDNSPASYIFHPQHAIPISSWFS 381

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 92.4 bits (228), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 81/160 (50%), Gaps = 11/160 (6%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P         + LVLDLDETL+H                VE+   +  +    +V KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQVHNV----YVIKR 281

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  D FL  +   YE+VVFTAS+  Y DP++D L+ +       RL+R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYI 338

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 339 KNLSQIG--RPLSDLIILDNSPASYIFHPQHAIPISSWFS 376

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 90/168 (53%), Gaps = 22/168 (13%)

Query: 210 LFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLY 269
           L P KL+P      ++ + L+LDLDETL+H              H  +    +     ++
Sbjct: 204 LLPPKLLP-----FQQKKCLILDLDETLVHSSFKYL--------HTADFVLPVEIDDQVH 250

Query: 270 HVH--KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCI 326
           +V+  KRP  D FL  ++  YE+VVFTAS+  YA+P++D L+   P +    RL+R+ C 
Sbjct: 251 NVYVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLD---PNRTIHHRLFREACY 307

Query: 327 LRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
             +G  YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 308 NYEG-NYIKNLSQIG--RPLSETIILDNSPASYIFHPQHAVPISSWFS 352

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 83/160 (51%), Gaps = 9/160 (5%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P      +  + L+LDLDETL+H               ++ ++     I  +Y V KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPDF----ILPIEIEDGQIHNVY-VIKR 355

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  D FL  +  WYE+V+FTAS+  YA+P++D L+       + RL+R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDH-NLINHRLFRDACYNYEN-NFI 413

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     L DI I+DNSP SY  H  +AI +  W S
Sbjct: 414 KNLSQIG--RPLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 87/169 (51%), Gaps = 20/169 (11%)

Query: 208 RFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGIST 267
           R L P +  PQ    RRK   LVLDLDETL+H              H  +    +   + 
Sbjct: 309 RTLLPPQF-PQ--FYRRK--CLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQ 355

Query: 268 LYHVH--KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDC 325
           +++V+  KRP  D FL  +   YE+VVFTAS+  Y DP++D L+         RL+R  C
Sbjct: 356 VHNVYVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKH--NVVHHRLFRDSC 413

Query: 326 ILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
              +G  YIK+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 414 YNYEG-NYIKNLSQIG--RPLSDLIILDNSPASYIFHPHHAIPISSWFS 459

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 78/148 (52%), Gaps = 11/148 (7%)

Query: 227 RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIAN 286
           + LVLDLDETL+H                V++   I  +    +V KRP  D FL  +  
Sbjct: 284 KCLVLDLDETLVHSSFKYLRTADFVL--PVDIDDQIHNV----YVIKRPGVDEFLKRVGA 337

Query: 287 WYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLL 346
            YE+VVFTAS+  Y DP++D L+         RL+R+ C   +G  YIK+LS +     L
Sbjct: 338 LYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYEG-NYIKNLSQIG--RPL 392

Query: 347 SDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           SDI I+DNSP SY  H  +AI +  W S
Sbjct: 393 SDIIILDNSPASYIFHPQHAIPISSWFS 420

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 83/163 (50%), Gaps = 23/163 (14%)

Query: 217 PQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGISTLYHV 271
           P   ++ RK   LVLDLDETL+H              ++    F +       I  +Y V
Sbjct: 304 PSKAVSHRK--CLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY-V 350

Query: 272 HKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGV 331
            KRP  D FL  +   YE+VVFTAS+  Y DP++D L+         RL+R+ C   +G 
Sbjct: 351 IKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYEG- 407

Query: 332 GYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
            YIK+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 408 NYIKNLSQIG--RPLSNIIILDNSPASYIFHPQHAIPISSWFS 448

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 88/171 (51%), Gaps = 13/171 (7%)

Query: 206 MGRFLFP--KKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAIS 263
            G++  P    L+P    + +  + L+LDLDETL+H                VE+   + 
Sbjct: 235 QGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQVH 292

Query: 264 GISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ 323
            +    +V KRP  + FL  +   +E+VVFTAS+  Y DP++D L++        RL+R+
Sbjct: 293 NV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFRE 346

Query: 324 DCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
            C   +G  YIK+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 347 ACYNYEG-NYIKNLSQIG--RPLSDIIILDNSPASYIFHPQHAIPISSWFS 394

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 85/160 (53%), Gaps = 11/160 (6%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P    + +  + L+LDLDETL+H                VE+   +  +    +V KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  + FL  +   +E+VVFTAS+  Y DP++D L+++       RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 345 KNLSQIG--RPLSDIIILDNSPASYIFHPQHAIPISSWFS 382

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 83/165 (50%), Gaps = 21/165 (12%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGISTLY 269
           L+P      +  + LVLDLDETL+H              ++    F +       +  +Y
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVNIDDQVHNVY 278

Query: 270 HVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRD 329
            V KRP  D FL  +   YE+VVFTAS+  Y DP++D L+         RL+R+ C   +
Sbjct: 279 -VIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYE 335

Query: 330 GVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           G  YIK+LS +     LS+I I+DNSP SY  H  +AI V  W S
Sbjct: 336 G-NYIKNLSQIG--RPLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 81/149 (54%), Gaps = 13/149 (8%)

Query: 227 RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIAN 286
           + LVLDLDETL+H                V++   +  +    +V KRP  D FL  + +
Sbjct: 283 KCLVLDLDETLVHSSFKYLNIADFVLP--VDIDNQVQNV----YVSKRPGVDEFLKIVGD 336

Query: 287 WYELVVFTASMKEYADPVIDWLESSFPGKF-SRRLYRQDCILRDGVGYIKDLSAVAPNTL 345
            YE++VFTAS+  Y +P++D L+   P K+   RL+R  C + +G  Y+K+LS +     
Sbjct: 337 LYEVIVFTASVSRYGNPLMDILD---PHKYIHHRLFRDSCYVYEG-NYVKNLSQIG--RP 390

Query: 346 LSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           L DI I+DNSP SY  H  +AI +  W S
Sbjct: 391 LGDIIILDNSPASYIFHPQHAIPISSWFS 419

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 83/162 (51%), Gaps = 15/162 (9%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVH-- 272
           L+P      R  + LVLDLDETL+H              H  +    +   + +++V+  
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVYVI 348

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL  +   +E+VVFTAS+  Y DP++D L+         RL+R  C   +G  
Sbjct: 349 KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQY--KAVHHRLFRDSCYNYEG-N 405

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           YIK+LS +     LSD+ I+DNSP SY  H  +A+ +  W S
Sbjct: 406 YIKNLSQIG--RPLSDLIILDNSPASYIFHPQHAVPISSWFS 445

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 86/166 (51%), Gaps = 22/166 (13%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGISTLY 269
           L P+  +  +  + LVLDLDETL+H              ++    F +       I  +Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 270 HVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCILR 328
            V KRP  D FL  +   +E+V+FTAS+  Y DP++D L+    GK    RL+R+ C   
Sbjct: 382 -VIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK--GKSIHHRLFREACYNY 438

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           +G  YIK+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 439 EG-NYIKNLSQMG--RPLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 89/170 (52%), Gaps = 24/170 (14%)

Query: 211 FPKKLIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGI 265
           F   L PQ+ +   K + L+LDLDETL+H              ++    F I       I
Sbjct: 504 FNTLLPPQNQIFSGK-KCLILDLDETLVHSSFK----------YLTSADFVIPVDIDEQI 552

Query: 266 STLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDC 325
             +Y V KRP  D FL T++  +E+VVFTAS+  Y DP++D L+         RL+R+ C
Sbjct: 553 HNVY-VIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKHRC--IHHRLFREAC 609

Query: 326 ILRDGVGYIKDLSAVA-PNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
              +G  YIK+LS +  P   LS++ I+DNSP SY  H  +AI +  W S
Sbjct: 610 YDYEG-NYIKNLSQIGRP---LSELIILDNSPASYIFHPQHAIPISSWFS 655

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 88/159 (55%), Gaps = 13/159 (8%)

Query: 216 IPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRP 275
           I QS+ NR+    LVLDLDETL+H                ++ +F       +Y V KRP
Sbjct: 172 IQQSLQNRK---CLVLDLDETLVHSSFKYVSTADFVLPVDIDDQF-----QNVY-VIKRP 222

Query: 276 YCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIK 335
             D FL   +  +E+V+FTAS+++Y +P++D L+S+       RL+R  C   +G  YIK
Sbjct: 223 GVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYIK 280

Query: 336 DLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           +L+ +     LSDI I+DNSP SY  H ++AI +  W S
Sbjct: 281 NLAQLG--RPLSDIIILDNSPTSYLFHPNHAIPISSWFS 317

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 84/165 (50%), Gaps = 21/165 (12%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGISTLY 269
           L+P    +    + LVLDLDETL+H              ++    F +       I  +Y
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFK----------YLKGADFVLPVDIDDQIHNVY 350

Query: 270 HVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRD 329
            V KRP  D FL  + + +E+V+FTAS+  Y DP++D L+         RL+R+ C   +
Sbjct: 351 -VMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYE 407

Query: 330 GVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           G  YIK+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 408 G-NYIKNLSQIG--RPLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 84/163 (51%), Gaps = 16/163 (9%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L P+ +    + + L+LDLDETL+H                  +   I   +   +V KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFV------IPVTIDNQTHHVYVIKR 365

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGK--FSRRLYRQDCILRDGVG 332
           P  D FL  ++  YE+VVFTAS+  Y DP+++ L+   P       RL+R+ C   +G  
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILD---PANTIIHHRLFRESCYTYEG-N 421

Query: 333 YIKDLSAVA-PNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           Y+K+LS +  P   L++I I+DNSP SY  H  +AI +  W S
Sbjct: 422 YVKNLSQLGRP---LNEIIILDNSPASYIFHPQHAIPISSWFS 461

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (52%), Gaps = 24/155 (15%)

Query: 227 RTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAI-----SGISTLYHVHKRPYCDLFL 281
           + LVLDLDETL+H              ++    F +       I  +Y V KRP  + FL
Sbjct: 303 KCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVY-VIKRPGVEEFL 351

Query: 282 TTIANWYELVVFTASMKEYADPVIDWLESSFPGK--FSRRLYRQDCILRDGVGYIKDLSA 339
             +   +E+VVFTAS+  Y DP++D L+   PG+     RL+R+ C   +G  YIK+LS 
Sbjct: 352 KRVGELFEVVVFTASVARYGDPLLDILD---PGRQLIHHRLFREACYNYEG-NYIKNLSQ 407

Query: 340 VAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 408 MG--RPLSEIIILDNSPASYIFHPQHAIPISSWFS 440

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (52%), Gaps = 11/160 (6%)

Query: 215 LIPQSVLNRRKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKR 274
           L+P    + +  + L+LDLDETL+H                VE+   +  +    +V KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 275 PYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 334
           P  + FL  +   +E+VVFTAS+  Y DP++D L++        RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREACYNYEG-NYI 344

Query: 335 KDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 374
           K+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 345 KNLSQIG--RPLSEIIILDNSPASYIFHPQHAIPISSWFS 382

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 62/104 (59%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   Y+D + + L+       S  L+++ C+ +
Sbjct: 213 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYK 271

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  LS + IID  P SY +  +NAI +E W
Sbjct: 272 DGV-HIKDLSKL--NRDLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 62/104 (59%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ ++E+V+F+++   Y+D + + L+       S  L+++ C+ +
Sbjct: 213 WRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYK 271

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  LS + IID  P SY +  +NAI ++ W
Sbjct: 272 DGV-HIKDLSKL--NRDLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 77/149 (51%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLV+ L++ L+H                   K+        +   KRP  D FL  
Sbjct: 194 QRPLTLVITLEDFLVHSEWSQ--------------KYG-------WRTAKRPGADYFLGY 232

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ ++E+V+F+++   Y++ + + L+       S  L+++ C+ +DGV +IKDLS +  N
Sbjct: 233 LSQYFEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV-HIKDLSKL--N 288

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             LS + IID  P SY +  +NAI +E W
Sbjct: 289 RDLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   YA+ V + ++       +  LY++ C+ +
Sbjct: 212 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYK 270

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  L    IID  P SY +  +NAI V+ W
Sbjct: 271 DGV-HIKDLSKL--NRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP CD FL  ++ +YE+V+F+++   YA+ + + L+       S  L+++ C+ +
Sbjct: 204 WRTAKRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYK 262

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKD+S +  N  L  +  ID  P +Y +  +NAI ++ W
Sbjct: 263 DGV-HIKDISKL--NRDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLVL L++ L+H                   K+        +   KRP  D FL  
Sbjct: 208 QRPLTLVLTLEDLLVHSEWSQ--------------KYG-------WRTAKRPGVDYFLGY 246

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   Y + + + L+       S  L+++ C+ +DGV +IKDLS +  N
Sbjct: 247 LSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV-HIKDLSKL--N 302

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             ++ + IID  P +Y +  +NAI +E W
Sbjct: 303 RDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLV+ L++ L+H                   K+        +   KRP  D FL  
Sbjct: 200 QRPLTLVITLEDFLVHSEWSQ--------------KYG-------WRTAKRPGVDYFLGY 238

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   Y + + + L+       S  L+++ C+ +DGV +IKDLS +  N
Sbjct: 239 LSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV-HIKDLSKL--N 294

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             ++ + IID  P +Y +  +NAI V+ W
Sbjct: 295 RDVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 74/149 (49%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLVL L++ L+H            Q H              +   KRP  D FL  
Sbjct: 189 QRPLTLVLTLEDFLVHSEWD--------QKHG-------------WRTAKRPGTDYFLGY 227

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   Y++ + + L+       S  LY++ C+ ++G  +IKDLS +  N
Sbjct: 228 LSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT-HIKDLSKL--N 283

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             L  + IID  P +Y    +NAI V+ W
Sbjct: 284 RDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  + FL  ++ +YE+V+F+++   Y++   + L+       S  L+++ C+ +
Sbjct: 216 WRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYK 274

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  +  LS + IID  P SY +  +NAI ++ W
Sbjct: 275 DGV-HIKDLSKLKRD--LSKVIIIDTDPNSYKLQPENAIPMDPW 315

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 75/149 (50%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLV+ L++ L+H            Q H              +   KRP  D FL  
Sbjct: 195 QRPLTLVITLEDFLVHSEWD--------QKHG-------------WRTAKRPGADYFLGY 233

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   YA+ + + ++       S  L+++ C+ +DGV +IKDLS +  N
Sbjct: 234 LSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV-HIKDLSKL--N 289

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             L  + IID    SY +  +NAI ++ W
Sbjct: 290 RDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   YA+ + + L+       +  L+++ C+ +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYK 274

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  L  + IID    S+ +  +NAI +E W
Sbjct: 275 DGV-HIKDLSKL--NRDLGKVLIIDTDENSFKLQPENAIYLEPW 315

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL  ++ +YE+V+F+++   Y++ + + L+       S  LY++ C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-D 283

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           +IKDLS +  N  L  + I+D  P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKL--NRDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP CD FL  ++ +YE+V+F+++   Y+D + + L+       S  L+++ C+ +
Sbjct: 217 WRTAKRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYK 275

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DG+ +IKD+S +  N  +  + +ID  P  Y    +NAI  + W
Sbjct: 276 DGI-HIKDISKM--NRDVGKVVMIDTDPNCYKSQPENAIPAKPW 316

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   Y+D V + L+       +  L+++ C+ +
Sbjct: 208 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYK 266

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  L    IID  P +Y +  +NAI ++ W
Sbjct: 267 DGV-HIKDLSKL--NRDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   Y+D + + L+       S  L+++ C+ +
Sbjct: 217 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYK 275

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N     + IID  P SY +  +NAI ++ W
Sbjct: 276 DGV-HIKDLSKL--NRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 269 YHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 328
           +   KRP  D FL  ++ +YE+V+F+++   Y+D V + L+       +  L+++ C+ +
Sbjct: 209 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYK 267

Query: 329 DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           DGV +IKDLS +  N  L    I+D  P +Y +  +NAI +  W
Sbjct: 268 DGV-HIKDLSKL--NRDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 57/100 (57%), Gaps = 4/100 (4%)

Query: 273 KRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 332
           KRP  D FL  ++ +YE+V+F+++   +++ + + L+       +  L+++ C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 333 YIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           +IKDLS +  N  L    IID    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHL--NRDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 72/149 (48%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLVL L++ L+H                           T +   KRP  D FL  
Sbjct: 183 QRPLTLVLTLEDLLVHSEWSQ---------------------KTGWRTAKRPGVDYFLGY 221

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   Y++ + + L+       S  L+++ C+ +D V +IKDLS +  N
Sbjct: 222 LSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV-HIKDLSKL--N 277

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             +  + I+D    SY +  +NA+ +  W
Sbjct: 278 RDVRKVVIMDTDANSYKLQPENALPMAPW 306

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 72/149 (48%), Gaps = 25/149 (16%)

Query: 224 RKPRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAISGISTLYHVHKRPYCDLFLTT 283
           ++P TLVL L++ L+H                             +   KRP  D FL  
Sbjct: 163 QRPLTLVLSLEDLLVHSEWTQKNG---------------------WRTAKRPGVDYFLGY 201

Query: 284 IANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN 343
           ++ +YE+V+F+++   Y++ + + L+       S  L+++ C+ + G  +IKDLS +  N
Sbjct: 202 LSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-KHIKDLSKL--N 257

Query: 344 TLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
             ++ + IID    +Y +  +NAI ++ W
Sbjct: 258 RDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 274 RPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGY 333
           RP  D  L  ++++YE V+F ++   Y+  V++ L+       +  L++  C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 334 IKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGW 372
           IKDLS +  N  L    IID  P S  + ++NAI  E W
Sbjct: 275 IKDLSHL--NRDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KLTH0G17446g Chr7 complement(1511859..1513121) [1263 bp, 420 aa]
           {ON} conserved hypothetical protein
          Length = 420

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 5/100 (5%)

Query: 265 ISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGK---FSRRLY 321
           IS    V     CDL L  +  +YEL V   ++    D       SS P +   F    Y
Sbjct: 128 ISVTLGVEGLHQCDLSLAVVRMYYELGVRYITLTHNCDNPFAMAASSIPYRDKDFGLTSY 187

Query: 322 RQDCILR-DGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYA 360
             DC+   + +G + DLS V+  T++ D+  +  +PV ++
Sbjct: 188 GVDCVKEMNRLGMMVDLSHVSYQTMV-DVLNVSEAPVIFS 226

>Smik_15.498 Chr15 complement(855989..857326) [1338 bp, 445 aa] {ON}
           YOR316C (REAL)
          Length = 445

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 52/128 (40%), Gaps = 22/128 (17%)

Query: 5   SYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLWSILV 64
           +++  N     PE  S +P     S  +   GN +    + KK+++S  +   FL  +  
Sbjct: 196 NFMNENTRLLTPEDTSKTPTYSASSHTITSGGNNE----QYKKSKRSLNMHGVFLHVLGD 251

Query: 65  FLPNLLVVKPILFVW---------------FVITFPLSLIERSSTPESAGGTESSLQRTG 109
            L N+ VV    F+W                VIT    +I  S+ P S   ++  LQ T 
Sbjct: 252 ALGNIGVVLSAFFIWKTDYSWKYYTDPLVSLVIT---GIIFSSALPLSCRASKILLQATP 308

Query: 110 NLYSDEQV 117
           +  S +QV
Sbjct: 309 STLSGDQV 316

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 294 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGY 333
           TA +K + + V   L++  P   S+R+Y++DC L   +G+
Sbjct: 101 TAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGF 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,714,944
Number of extensions: 1567032
Number of successful extensions: 5699
Number of sequences better than 10.0: 80
Number of HSP's gapped: 5739
Number of HSP's successfully gapped: 87
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)