Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_26.7996na 1ON78278237690.0
KLTH0D06754gna 1ON82779632990.0
SAKL0A09394gna 1ON79772930220.0
ZYRO0D00330gna 2ON79872829120.0
TDEL0C00130singletonON79272929040.0
Smik_10.20na 3ON79976529020.0
YJL212C (OPT1)na 3ON79976528980.0
Skud_10.5na 3ON79976528800.0
Suva_6.290na 3ON80176528720.0
KLLA0E00397gsingletonON79372928570.0
KNAG0G02310singletonON79072527350.0
SAKL0G15224gsingletonON80572912941e-166
KLLA0E00419gna 2ON79472312911e-166
SAKL0F14674gna 2ON80573212841e-165
KLTH0E01496gna 2ON81473012841e-165
Kwal_55.19788na 2ON81073012771e-164
ABR156Wna 2ON79673312231e-156
Ecym_7185na 2ON80072111581e-146
SAKL0D09350gna 4ON8877917549e-87
ZYRO0C18568gsingletonON8216617448e-86
TPHA0C05020singletonON8967357471e-85
Kwal_55.19561singletonON8827287408e-85
ZYRO0G22484gsingletonON8216647325e-84
YPR194C (OPT2)na 5ON8777237293e-83
Skud_16.498na 5ON8777227251e-82
ZYRO0D13332gsingletonON8897367199e-82
Kpol_455.13na 5ON8927257191e-81
KLLA0D15378gsingletonON8697217153e-81
ZYRO0D09922gsingletonON9227347094e-80
Suva_16.526na 5ON8777297041e-79
Smik_16.458na 5ON8556376802e-76
Ecym_2739na 4ON8677416784e-76
ADL399CsingletonON8857396592e-73
ACL205CsingletonON8907426558e-73
AGL027WsingletonON8777306039e-66
ZYRO0D17974gsingletonON7767244037e-40
ZYRO0C14630g6.137ON71795771.5
NDAI0H022002.473ON571100771.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7996
         (782 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {O...  1456   0.0  
KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {...  1275   0.0  
SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {...  1168   0.0  
ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON...  1126   0.0  
TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON}      1123   0.0  
Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}...  1122   0.0  
YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}  O...  1120   0.0  
Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}  ...  1113   0.0  
Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C ...  1110   0.0  
KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly s...  1105   0.0  
KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {O...  1058   0.0  
SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]...   503   e-166
KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar ...   501   e-166
SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]...   499   e-165
KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {...   499   e-165
Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {...   496   e-164
ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-synteni...   475   e-156
Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar t...   450   e-146
SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} simila...   295   9e-87
ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} simi...   291   8e-86
TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON}            292   1e-85
Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON...   289   8e-85
ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} simi...   286   5e-84
YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON} ...   285   3e-83
Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {...   283   1e-82
ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]...   281   9e-82
Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON} (24582..2...   281   1e-81
KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]...   280   3e-81
ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} simila...   277   4e-80
Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {...   275   1e-79
Smik_16.458 Chr16 complement(787205..789133,789181..789306,78932...   266   2e-76
Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {O...   265   4e-76
ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON} Non-s...   258   2e-73
ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON} Non-s...   256   8e-73
AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-synteni...   236   9e-66
ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]...   159   7e-40
ZYRO0C14630g Chr3 (1139589..1141742) [2154 bp, 717 aa] {ON} simi...    34   1.5  
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    34   1.6  

>Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 55] FULL
          Length = 782

 Score = 1456 bits (3769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/782 (92%), Positives = 726/782 (92%)

Query: 1   MSKEVKKVETLQVWEKVENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEG 60
           MSKEVKKVETLQVWEKVENSSESSSQEHVPHVINKDG               TDQTIWEG
Sbjct: 1   MSKEVKKVETLQVWEKVENSSESSSQEHVPHVINKDGAGIVVEEEESEAEGITDQTIWEG 60

Query: 61  DVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSIN 120
           DVTALPNSPFPEVRATVPATDDPTIVVNHWR                   SLRYPSLSIN
Sbjct: 61  DVTALPNSPFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLSIN 120

Query: 121 FLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNI 180
           FLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNI
Sbjct: 121 FLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNI 180

Query: 181 LIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSL 240
           LIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSL
Sbjct: 181 LIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSL 240

Query: 241 HNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIA 300
           HNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIA
Sbjct: 241 HNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIA 300

Query: 301 NTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTN 360
           NTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASV             TN
Sbjct: 301 NTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVFIFFILILPILYFTN 360

Query: 361 TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXX 420
           TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALN  
Sbjct: 361 TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNFA 420

Query: 421 XXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGF 480
                  HCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGF
Sbjct: 421 AVVAVFVHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGF 480

Query: 481 ATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMA 540
           ATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMA
Sbjct: 481 ATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMA 540

Query: 541 NVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSN 600
           NVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSN
Sbjct: 541 NVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSN 600

Query: 601 IKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFA 660
           IKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFA
Sbjct: 601 IKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFA 660

Query: 661 LQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNY 720
           LQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNY
Sbjct: 661 LQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNY 720

Query: 721 VMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDK 780
           VMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDK
Sbjct: 721 VMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDK 780

Query: 781 WW 782
           WW
Sbjct: 781 WW 782

>KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 827

 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/796 (78%), Positives = 678/796 (85%), Gaps = 14/796 (1%)

Query: 1   MSKEVKKVETLQVWEKVENSSESSS--QEHVP-----------HVINKD-GXXXXXXXXX 46
           M KEVK V+TLQV E  ENSS+SSS  QE  P           H+ N+  G         
Sbjct: 32  MGKEVKIVDTLQVVEHGENSSDSSSLGQELSPGGSHVTYLSRGHLANEGAGAEGKTEQEI 91

Query: 47  XXXXXXTDQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXX 106
                 T+QT+WEG+V+ L NSPFPEVRATVP TDDPTIV+NHWR               
Sbjct: 92  IEEEELTEQTVWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGV 151

Query: 107 XXXXSLRYPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTI 166
               SLRYPSLSINFLVAQVVCYP+GKILALLP+ DC RCPWFNLNPGPFTKKEHAVVTI
Sbjct: 152 NQFFSLRYPSLSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTI 211

Query: 167 AVALTSSTAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACI 226
           AVALTSSTAYAMNILIAQTNFYNMKL AGYM+LLVWTSQML YGAAGLTRRWVV PAACI
Sbjct: 212 AVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACI 271

Query: 227 WPQTLISVSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFN 286
           WPQTLISVSLFDSLHNR++D + VNGW MSRYRFF+ V S SF+WYWVPGFLFKGLSYFN
Sbjct: 272 WPQTLISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFN 331

Query: 287 VVLWGSKTRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVX 346
           VVLWG KTRHNFIANTIFGVESGIGALPI+FDYTQ+SQA++GSVFATPYWVSANSCAS  
Sbjct: 332 VVLWGPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAV 391

Query: 347 XXXXXXXXXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLF 406
                       TNTWYAKYMPVISG+T+DNTQQKYNVS+ILN D+S+N EKYK+YSPLF
Sbjct: 392 LFFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLF 451

Query: 407 VPFSYLLSYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDW 466
           VPFSYLLSYALN         HC LYNGK+IKNKFRNKN+GGQDIHMRLY+QNYKDCPDW
Sbjct: 452 VPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDW 511

Query: 467 WYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIIT 526
           WY+VLQV+M+ LGF  +C F+SHLPAWAF VAL ISF+NFIPQGILEAVTNQHVGLNIIT
Sbjct: 512 WYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIIT 571

Query: 527 ELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIIS 586
           ELICGYMLPF+PMAN+LFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFA+QIYAT+IS
Sbjct: 572 ELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVIS 631

Query: 587 GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMW 646
           GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMP++LFSPGRIYNPIMW
Sbjct: 632 GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMW 691

Query: 647 FFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNR 706
           FFLIGL VP+IVF LQ+ FK N+ +KF H+PVFFAGP +IPPSTPYNY+L+FA+S+ LN 
Sbjct: 692 FFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNT 751

Query: 707 IRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRK 766
           IRKR+P WFSKYN+VMGAGVETGVALAVVIIFLCVQYPGG LNWWGN+VYKNTYDH YRK
Sbjct: 752 IRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRK 811

Query: 767 YYVLKKGETFGYDKWW 782
           +Y LKKGE FGYDKWW
Sbjct: 812 FYNLKKGEKFGYDKWW 827

>SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 797

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/729 (75%), Positives = 617/729 (84%)

Query: 54  DQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLR 113
           D  IWEGD T LPNSP+PEVRATVP TDDPTI +NHWR                   SLR
Sbjct: 69  DDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLR 128

Query: 114 YPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSS 173
           YPSLSINF+VAQV+CYPIGKILA LP   C R P+F+LNPGPFTKKEHAVVTIAVALTSS
Sbjct: 129 YPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSS 188

Query: 174 TAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLIS 233
           TAYAMNILIAQTNFYNMKLGAGY VLLVWTSQMLGYGAAGL+RRWVV PA+C+WPQTLIS
Sbjct: 189 TAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLIS 248

Query: 234 VSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSK 293
           VSLFD+LH+  +D ++VNGW M+RY+FF+ V   SF+WYW+PGFLF GLSYFN +LWG K
Sbjct: 249 VSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPK 308

Query: 294 TRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXX 353
           TRHNFIAN IFGVESG+GA+PI+FDYTQ+SQAM+GSVFATP+WVSAN+ ASV        
Sbjct: 309 TRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASVLLFFVVIL 368

Query: 354 XXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLL 413
                TNTWYAKYMP+IS +T+DN Q  YNV+KILNPDFS+NLEKYK YSPL+VPFSYLL
Sbjct: 369 PILYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLL 428

Query: 414 SYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQV 473
           SYALN         HCALY+GKDI +K RN NHGG DIHMRLY++NYKDCPDWWY  LQV
Sbjct: 429 SYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQV 488

Query: 474 VMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYM 533
           V LGLGFAT+CG+D+H PAWAF +AL+ISF N +PQGILEA+TNQHVGLNIITEL+CGYM
Sbjct: 489 VTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYM 548

Query: 534 LPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGI 593
           LP KPMANVLFKLYGFIVMR GL+LSRDLKLALYMKV PRLIFA+QIYA++ISGLVNVGI
Sbjct: 549 LPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGI 608

Query: 594 QEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLA 653
           QEWMR NI  +CS TQ DGF C+NGRTIFNASIIWS+PQ+LFSPGRIYNP+MWFFLIGL 
Sbjct: 609 QEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLV 668

Query: 654 VPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPL 713
           VP IVF LQ+ F  NQ +K+ H+PVFF GP +IPPSTPYNYSLFFA S++LN IRKRWP 
Sbjct: 669 VPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPR 728

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKG 773
           WF KYN+VMG+GVE GVAL+V IIFLCVQYPGGK+NWWGNSV+KNTYDH Y+K+Y L KG
Sbjct: 729 WFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKG 788

Query: 774 ETFGYDKWW 782
           ETFGYDKWW
Sbjct: 789 ETFGYDKWW 797

>ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 798

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/728 (72%), Positives = 606/728 (83%)

Query: 55  QTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRY 114
             IWEGD + +P+SP+PEVRA +  TDDP+IV+NHWR                   SLRY
Sbjct: 71  DDIWEGDPSEMPDSPYPEVRAVLSPTDDPSIVLNHWRTWFLVTVFVVVFAGVNQFFSLRY 130

Query: 115 PSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSST 174
           PSL+I+FLVAQV+CYP+GK LA LP   C   P+FNLNPGPFTKKEHAVVTIAVALTSST
Sbjct: 131 PSLTIDFLVAQVICYPLGKTLACLPDWKCKLVPFFNLNPGPFTKKEHAVVTIAVALTSST 190

Query: 175 AYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISV 234
           AYAM IL AQ +FYNM + +GY +LLVW+SQMLGYGAAGLTRRWVV PA+CIWPQTLISV
Sbjct: 191 AYAMYILNAQVSFYNMSVNSGYQLLLVWSSQMLGYGAAGLTRRWVVNPASCIWPQTLISV 250

Query: 235 SLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKT 294
           SLFDSLH+RT++ S VNGWK+ RY+FF+ VL GSF+WYWVPGFLF GLSYFN+VLWG KT
Sbjct: 251 SLFDSLHSRTIEKSSVNGWKVPRYKFFLFVLIGSFVWYWVPGFLFTGLSYFNIVLWGPKT 310

Query: 295 RHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXX 354
           RHNF+ NTIFGV SGIGALPISFDYTQ+SQAM+GSVFATP+WVSAN+ ASV         
Sbjct: 311 RHNFVLNTIFGVSSGIGALPISFDYTQISQAMTGSVFATPFWVSANTYASVLIFFVFLLP 370

Query: 355 XXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLS 414
               TNTWYAKYMPVIS +TFDNTQ+KYNV++ILNPDF+VNLEKYK+YSPLFVPFSYLLS
Sbjct: 371 ILYFTNTWYAKYMPVISTSTFDNTQKKYNVTRILNPDFTVNLEKYKSYSPLFVPFSYLLS 430

Query: 415 YALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVV 474
           YALN         HC LY+GKDI  K ++ N GG DIH RLY QNYKDCPDWWYLVLQV+
Sbjct: 431 YALNFAAVIAVFVHCGLYHGKDIYGKLKDANFGGSDIHRRLYQQNYKDCPDWWYLVLQVI 490

Query: 475 MLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYML 534
           MLGLGFA +CGFD+H PAWAF VAL+I+F NFIPQGILEA+TNQHVGLN+ITEL+CGYML
Sbjct: 491 MLGLGFAAVCGFDTHFPAWAFVVALLIAFANFIPQGILEAITNQHVGLNVITELVCGYML 550

Query: 535 PFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQ 594
           PF+PMAN+LFKLYGFIVMRQGL LSRDLKLALYMK+PPRLIF IQIYATI+SGLVNVG+Q
Sbjct: 551 PFRPMANLLFKLYGFIVMRQGLSLSRDLKLALYMKIPPRLIFCIQIYATIVSGLVNVGVQ 610

Query: 595 EWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAV 654
           EWMR NIK+ CS  Q +GF C NGRT+FNASIIWSMP++LFS GRIYNP+MWFFLIGL +
Sbjct: 611 EWMRHNIKDFCSPDQSNGFICANGRTVFNASIIWSMPKYLFSSGRIYNPLMWFFLIGLGL 670

Query: 655 PLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLW 714
           PL +F LQ +      +K++H P+FFAGP +IPPSTPYNYSLFFAMS+ L  IR+RWPLW
Sbjct: 671 PLAIFGLQLLLPKVNFLKYIHTPIFFAGPGNIPPSTPYNYSLFFAMSFWLYIIRRRWPLW 730

Query: 715 FSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGE 774
           F KYN+VMGAGVE GVA++V++IFLCVQYPGG L WWGN V+KNTYD+  +KYY +K G+
Sbjct: 731 FKKYNFVMGAGVEAGVAISVLVIFLCVQYPGGTLKWWGNDVWKNTYDYQSKKYYTVKAGD 790

Query: 775 TFGYDKWW 782
            FGYDKWW
Sbjct: 791 KFGYDKWW 798

>TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON} 
          Length = 792

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/729 (72%), Positives = 603/729 (82%)

Query: 54  DQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLR 113
           D  +WEGDV+ LPNSP+P+VRA VP  DDP I++NHWR                   SLR
Sbjct: 64  DDGVWEGDVSLLPNSPYPDVRAVVPIDDDPGIILNHWRTWFLTTVFVVVFAGVNQFFSLR 123

Query: 114 YPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSS 173
           YPSL INFLVAQVVC+P+GK LALLP   C R  +F+LNPGPFTKKEHAV+TIAVALTSS
Sbjct: 124 YPSLEINFLVAQVVCFPVGKALALLPDWKCKRFSFFDLNPGPFTKKEHAVITIAVALTSS 183

Query: 174 TAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLIS 233
           TAYAM IL AQ +FY+MKL AGY +LLVWTSQMLGYGAAGLTRRWVV+P +CIWPQTLIS
Sbjct: 184 TAYAMYILNAQVSFYHMKLNAGYQLLLVWTSQMLGYGAAGLTRRWVVDPPSCIWPQTLIS 243

Query: 234 VSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSK 293
           VSLFDSLH+R VD ++VNGW + RY+ F  VL GSF+W+WVPGFLFKGLSYFNVVLWG K
Sbjct: 244 VSLFDSLHSRKVDKTIVNGWSLDRYKMFYFVLIGSFVWHWVPGFLFKGLSYFNVVLWGPK 303

Query: 294 TRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXX 353
           TR NF+AN +FGV SGIG LPISFDYTQVSQAMSGSVFATP+WVSAN+ ASV        
Sbjct: 304 TRQNFVANALFGVSSGIGLLPISFDYTQVSQAMSGSVFATPFWVSANTYASVLIFFVIVL 363

Query: 354 XXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLL 413
                TNTWYAKYMPVISG+TFDNTQ  YNV KILN D+S+NLEKYK YSP+FVPFSYLL
Sbjct: 364 PILYFTNTWYAKYMPVISGSTFDNTQSSYNVKKILNADYSINLEKYKEYSPVFVPFSYLL 423

Query: 414 SYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQV 473
           +Y LN         HCALY+GKDI NK R+ N GG DIH R+YT+NYK+CPDWWY VLQ+
Sbjct: 424 NYGLNFAAVVAVFVHCALYHGKDIYNKLRDSNFGGMDIHRRIYTKNYKECPDWWYGVLQI 483

Query: 474 VMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYM 533
           + L LGF T+C F +H P WAF +AL+I++ NF+PQGILEA+TNQHVGLNIITELICGYM
Sbjct: 484 ITLALGFVTVCAFPTHFPPWAFVIALIIAYANFLPQGILEAITNQHVGLNIITELICGYM 543

Query: 534 LPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGI 593
           LP KPMAN+LFKLYGFIVMRQGL LSRDLKLALYMKV PRLIFAIQIYATIISGLVNVGI
Sbjct: 544 LPLKPMANLLFKLYGFIVMRQGLNLSRDLKLALYMKVSPRLIFAIQIYATIISGLVNVGI 603

Query: 594 QEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLA 653
           QEWMR+NIK++C++TQ DGFTC NGRTIFNASIIWS+P++LFSPGRIYNP+MWFFLIGL 
Sbjct: 604 QEWMRTNIKDICTTTQADGFTCANGRTIFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLL 663

Query: 654 VPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPL 713
            P++VF +Q+ F      K++H PVFF G N+IPPSTPYNYSLFF MS++L  IRK WPL
Sbjct: 664 APIVVFLIQKKFPKVSFFKYLHTPVFFTGTNNIPPSTPYNYSLFFGMSFMLFLIRKNWPL 723

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKG 773
           WFSKYN+V GAGVETGVA+AVVIIFLCVQ+PGG L+WWGN+VYKNT D   +K+YVLK+G
Sbjct: 724 WFSKYNFVTGAGVETGVAIAVVIIFLCVQFPGGHLDWWGNTVYKNTGDLKSQKFYVLKEG 783

Query: 774 ETFGYDKWW 782
           ETFGYDKWW
Sbjct: 784 ETFGYDKWW 792

>Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/765 (70%), Positives = 618/765 (80%), Gaps = 18/765 (2%)

Query: 18  ENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEGDVTALPNSPFPEVRATV 77
           E   +  SQ+   H I ++G                   +W+GD T LPNSP+PEVRA V
Sbjct: 53  EEDRDPESQKFDRHSIQEEGL------------------VWKGDPTYLPNSPYPEVRAAV 94

Query: 78  PATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVVCYPIGKILAL 137
              DDPTI +NHWR                   SLRYPSL INFLVAQVVCYPIGK+LAL
Sbjct: 95  SIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLEINFLVAQVVCYPIGKVLAL 154

Query: 138 LPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYM 197
           LP   CAR P+F+LNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +FYNMKL  GY 
Sbjct: 155 LPDWKCARVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQ 214

Query: 198 VLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVVNGWKMSR 257
            LLVWTSQM+GYGAAGLTRRWVV PA+ IWPQTLISVSLFDSLH+R ++ +V NGW M R
Sbjct: 215 FLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLHSRKIEKTVANGWTMPR 274

Query: 258 YRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVESGIGALPISF 317
           Y+FF+IVL GSF+WYWVPGFLF GLSYFNV+LWGSKTRHNFIANTIFG +SG+GALPI+F
Sbjct: 275 YKFFLIVLIGSFVWYWVPGFLFTGLSYFNVILWGSKTRHNFIANTIFGTQSGLGALPITF 334

Query: 318 DYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTWYAKYMPVISGNTFDN 377
           DYTQVSQAMSGSVFATP++VSAN+ ASV             TNTWYAKYMPVISG+T+DN
Sbjct: 335 DYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDN 394

Query: 378 TQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDI 437
           TQ KYNV+KILN DFS+NLEKYK YSP+FVPFSYLLSYALN         HC LY+GKDI
Sbjct: 395 TQHKYNVTKILNEDFSINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFVHCFLYHGKDI 454

Query: 438 KNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFV 497
             KF+++ +GG DIHMR+Y++NYKDCPDWWYL LQ+VM+GLGF  +C FD+  PAWAF +
Sbjct: 455 VAKFKDRKNGGTDIHMRIYSKNYKDCPDWWYLALQLVMIGLGFVAVCCFDTKFPAWAFVI 514

Query: 498 ALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLE 557
           A++IS +NFIPQGILEA+TNQHVGLNIITELICGYMLP +PMAN+LFKLYGFIVMRQGL 
Sbjct: 515 AILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLN 574

Query: 558 LSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNN 617
           LSRDLKLA+YMKV PRLIFA+QIYATIISG+VNVG+QEWM  NI  LC+S QP+GFTC N
Sbjct: 575 LSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTSDQPNGFTCAN 634

Query: 618 GRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAP 677
           GRT+FNASIIWS+P++LFS GRIY+P+MWFFLIGL  PL+V+A+Q  F + +  K +H P
Sbjct: 635 GRTVFNASIIWSLPKYLFSSGRIYSPLMWFFLIGLLFPLVVYAVQWKFPNFKFAKHIHTP 694

Query: 678 VFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVII 737
           VFF GP +IPPSTPYNYSLFFAMS+ LN IRKRW  WF+KYN+VMGAGVE GVA++VVII
Sbjct: 695 VFFTGPGNIPPSTPYNYSLFFAMSFCLNIIRKRWRAWFNKYNFVMGAGVEAGVAISVVII 754

Query: 738 FLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW 782
           FLCVQYPG KL+WWGN+V+K TYD+ Y+K+Y LKKGETFGYDKWW
Sbjct: 755 FLCVQYPGAKLSWWGNNVWKRTYDNDYKKFYTLKKGETFGYDKWW 799

>YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}
           OPT1Proton-coupled oligopeptide transporter of the
           plasma membrane; also transports glutathione and
           phytochelatin; member of the OPT family
          Length = 799

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/765 (70%), Positives = 618/765 (80%), Gaps = 18/765 (2%)

Query: 18  ENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEGDVTALPNSPFPEVRATV 77
           E   +  SQ+   H I ++G                   +W+GD T LPNSP+PEVR+ V
Sbjct: 53  EEDRDPESQKFDRHSIQEEGL------------------VWKGDPTYLPNSPYPEVRSAV 94

Query: 78  PATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVVCYPIGKILAL 137
              DDPTI +NHWR                   SLRYPSL INFLVAQVVCYPIG+ILAL
Sbjct: 95  SIEDDPTIRLNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLEINFLVAQVVCYPIGRILAL 154

Query: 138 LPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYM 197
           LP   C++ P+F+LNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +FYNMKL  GY 
Sbjct: 155 LPDWKCSKVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQ 214

Query: 198 VLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVVNGWKMSR 257
            LLVWTSQM+GYGAAGLTRRWVV PA+ IWPQTLISVSLFDSLH+R V+ +V NGW M R
Sbjct: 215 FLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLHSRKVEKTVANGWTMPR 274

Query: 258 YRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVESGIGALPISF 317
           YRFF+IVL GSFIWYWVPGFLF GLSYFNV+LWGSKTRHNFIANTIFG +SG+GALPI+F
Sbjct: 275 YRFFLIVLIGSFIWYWVPGFLFTGLSYFNVILWGSKTRHNFIANTIFGTQSGLGALPITF 334

Query: 318 DYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTWYAKYMPVISGNTFDN 377
           DYTQVSQAMSGSVFATP++VSAN+ ASV             TNTWYAKYMPVISG+T+DN
Sbjct: 335 DYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDN 394

Query: 378 TQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDI 437
           TQ KYNV+KILN D+S+NLEKYK YSP+FVPFSYLLSYALN         HC LY+GKDI
Sbjct: 395 TQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDI 454

Query: 438 KNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFV 497
             KF+++ +GG DIHMR+Y++NYKDCPDWWYL+LQ+VM+GLGF  +C FD+  PAWAF +
Sbjct: 455 VAKFKDRKNGGTDIHMRIYSKNYKDCPDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVI 514

Query: 498 ALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLE 557
           A++IS +NFIPQGILEA+TNQHVGLNIITELICGYMLP +PMAN+LFKLYGFIVMRQGL 
Sbjct: 515 AILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLN 574

Query: 558 LSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNN 617
           LSRDLKLA+YMKV PRLIFA+QIYATIISG+VNVG+QEWM  NI  LC++ QP+GFTC N
Sbjct: 575 LSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCAN 634

Query: 618 GRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAP 677
           GRT+FNASIIWS+P++LFS GRIYNP+MWFFLIGL  PL V+A+Q  F   +  K +H P
Sbjct: 635 GRTVFNASIIWSLPKYLFSSGRIYNPLMWFFLIGLLFPLAVYAVQWKFPKFKFAKHIHTP 694

Query: 678 VFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVII 737
           VFF GP +IPPSTPYNYSLFFAMS+ LN IRKRW  WF+KYN+VMGAGVE GVA++VVII
Sbjct: 695 VFFTGPGNIPPSTPYNYSLFFAMSFCLNLIRKRWRAWFNKYNFVMGAGVEAGVAISVVII 754

Query: 738 FLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW 782
           FLCVQYPGGKL+WWGN+V+K TYD+ Y+K+Y LKKGETFGYDKWW
Sbjct: 755 FLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLKKGETFGYDKWW 799

>Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/765 (69%), Positives = 617/765 (80%), Gaps = 18/765 (2%)

Query: 18  ENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEGDVTALPNSPFPEVRATV 77
           E   +  SQ+   H I ++G                   +W+GD T LPNSP+PEVRA V
Sbjct: 53  EEDRDPESQKFDRHSIQEEGL------------------VWKGDPTYLPNSPYPEVRAAV 94

Query: 78  PATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVVCYPIGKILAL 137
              DDPTI +NHWR                   SLRYPSL INF+VAQVVC+PIG++LAL
Sbjct: 95  SIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLEINFIVAQVVCFPIGRVLAL 154

Query: 138 LPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYM 197
           LP   C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +FYNMKL  GY 
Sbjct: 155 LPDWKCRRAPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQ 214

Query: 198 VLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVVNGWKMSR 257
            LLVWTSQM+GYGAAGLTRRWVV PA+ IWPQTLISVSLFDSLH+R ++ +V NGW M R
Sbjct: 215 FLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLHSRKIEKTVANGWTMPR 274

Query: 258 YRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVESGIGALPISF 317
           YRFF+IVL GSF+WYWVPGFLF GLSYFNVVLWGSKTRHNFIANTIFG +SG+GALPI+F
Sbjct: 275 YRFFLIVLIGSFLWYWVPGFLFTGLSYFNVVLWGSKTRHNFIANTIFGTQSGLGALPITF 334

Query: 318 DYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTWYAKYMPVISGNTFDN 377
           DYTQ+SQAMSGSVFATP++VSAN+ ASV             TNTWYAKYMPVISG+T+DN
Sbjct: 335 DYTQISQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDN 394

Query: 378 TQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDI 437
           TQ KYNV+KILN D+S+NLEKYK YSP+FVPFSYLLSYALN         HC LY+GK+I
Sbjct: 395 TQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFVHCFLYHGKEI 454

Query: 438 KNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFV 497
             KF+++ +GG DIHMR+YT+NYKDCPDWWYL+LQ+VM+GLGF  +C FD+  PAWAF +
Sbjct: 455 LAKFKDRKNGGTDIHMRIYTKNYKDCPDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVI 514

Query: 498 ALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLE 557
           A++IS +NFIPQGILEA+TNQHVGLNIITELICGYMLP +PMAN+LFKLYGFIVMRQGL 
Sbjct: 515 AILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLN 574

Query: 558 LSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNN 617
           LSRDLKLA+YMKV PRLIFA+QIYATIISG+VNVG+QEWM  NI  LC++ QP+GFTC N
Sbjct: 575 LSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCAN 634

Query: 618 GRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAP 677
           GRT+FNASIIWS+P++LFS GRIYNP+MWFFLIGL  PL+V+A+Q  F + +  K +H P
Sbjct: 635 GRTVFNASIIWSLPKYLFSTGRIYNPLMWFFLIGLLFPLVVYAVQWKFPNFKFAKHIHTP 694

Query: 678 VFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVII 737
           VFF GP +IPPSTPYNYSLFFAMS+ LN IRKRW  WF+KYN+VMGAGVE GVA+AVVII
Sbjct: 695 VFFTGPGNIPPSTPYNYSLFFAMSFCLNVIRKRWRAWFNKYNFVMGAGVEAGVAIAVVII 754

Query: 738 FLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW 782
           FLCVQYPGGKL+WWGN+V+K TYD+ Y+K+Y L KGETFGYD WW
Sbjct: 755 FLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLNKGETFGYDNWW 799

>Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C
           (REAL)
          Length = 801

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/765 (69%), Positives = 618/765 (80%), Gaps = 18/765 (2%)

Query: 18  ENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEGDVTALPNSPFPEVRATV 77
           +   +  SQ++  H I ++G                   +W+GD T LPNSP+PEVR+ V
Sbjct: 55  DEDHDPESQKYDRHSIQEEGL------------------VWKGDPTYLPNSPYPEVRSAV 96

Query: 78  PATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVVCYPIGKILAL 137
              DDPTI +NHWR                   SLRYPSL INFLVAQVVC+PIG++LAL
Sbjct: 97  SIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLEINFLVAQVVCFPIGRMLAL 156

Query: 138 LPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYM 197
           LP   CAR P+F+LNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +FYNMKL  GY 
Sbjct: 157 LPDWKCARVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQ 216

Query: 198 VLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVVNGWKMSR 257
            LLVWTSQM+GYGAAGLTRRWVV PA+ IWPQTLISVSLFDSLH+R V+ SV NGWKM R
Sbjct: 217 FLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLHSRDVEKSVANGWKMPR 276

Query: 258 YRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVESGIGALPISF 317
           YRFF+ +L GSFIWYWVPGFLF GLSYFNVVLWG KTR+NFIANTIFG +SG+GALPI+F
Sbjct: 277 YRFFLFILIGSFIWYWVPGFLFTGLSYFNVVLWGPKTRYNFIANTIFGTQSGLGALPITF 336

Query: 318 DYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTWYAKYMPVISGNTFDN 377
           DYTQ+SQAMSGSVFATP++VSAN+ ASV             TNTWYAK+MPVIS +T+DN
Sbjct: 337 DYTQISQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKFMPVISSSTYDN 396

Query: 378 TQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDI 437
           TQ KYNV+KILN D+S+NLEKYK YSP+FVPFSYLLSYALN         HC LY+GKDI
Sbjct: 397 TQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDI 456

Query: 438 KNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFV 497
             KF+++ +GG DIHMR+Y++NYKDCPDWWYL LQ+VM+GLGF  +C FD+  PAWAF +
Sbjct: 457 VAKFKDRKNGGVDIHMRIYSKNYKDCPDWWYLTLQIVMIGLGFVAVCCFDTKFPAWAFVI 516

Query: 498 ALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLE 557
           A++IS +NFIPQGILEA+TNQHVGLNIITELICGYMLP +PMAN+LFKLYGFIVMRQGL 
Sbjct: 517 AILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQGLN 576

Query: 558 LSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNN 617
           LSRDLKLA+YMKV PRLIFAIQIYATIISGLVNVG+QEWM  NI  LC++ QP+GFTC N
Sbjct: 577 LSRDLKLAMYMKVSPRLIFAIQIYATIISGLVNVGVQEWMMHNIDGLCTTDQPNGFTCAN 636

Query: 618 GRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAP 677
           GRT+FN+SIIWS+P++LFSPGRIYNP+MWFFLIGL  P++V+A+Q  F + +  K +H P
Sbjct: 637 GRTVFNSSIIWSLPKYLFSPGRIYNPLMWFFLIGLLFPIVVYAIQWKFPNFKFAKHIHTP 696

Query: 678 VFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVII 737
           VFF GP +IPPSTPYNYSLFFA S+ L+ IRKRW  W++KYN+VMGAGVE GVA+AVVII
Sbjct: 697 VFFTGPGNIPPSTPYNYSLFFATSFCLHIIRKRWRAWYNKYNFVMGAGVEAGVAIAVVII 756

Query: 738 FLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW 782
           FLCVQYPGGKL+WWGN+V+K TYD+ Y+K+Y LKKGETFGYDKWW
Sbjct: 757 FLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLKKGETFGYDKWW 801

>KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 793

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/729 (71%), Positives = 604/729 (82%)

Query: 54  DQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLR 113
           D  +W+GD T LPNSP+P+VR  V   DDPTI +NHWR                   SLR
Sbjct: 65  DGLVWKGDPTYLPNSPYPDVRFAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLR 124

Query: 114 YPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSS 173
           YPSLSI+F+VAQV+CYPIGK+LA LP   C R P+F+LNPGPFTKKEHAVVTIAVALTSS
Sbjct: 125 YPSLSIDFIVAQVICYPIGKVLAKLPDWKCRRVPFFDLNPGPFTKKEHAVVTIAVALTSS 184

Query: 174 TAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLIS 233
           TAYAM IL AQ +FYNMKL  GY  LLVWTSQM+GYGAAGLTRRWVV PA+ IWPQTLIS
Sbjct: 185 TAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASAIWPQTLIS 244

Query: 234 VSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSK 293
           VSLFDSLH+R ++ +VVNGW M RY+FF+IV   SF+WYWVPGFLF GLSYFNV+LWG K
Sbjct: 245 VSLFDSLHSRKIERAVVNGWSMPRYKFFVIVFIASFVWYWVPGFLFTGLSYFNVILWGPK 304

Query: 294 TRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXX 353
           TR NF+ANTIFGVESG+GA PISFDYTQ+SQAMSGSVFATP++VSAN+ ASV        
Sbjct: 305 TRDNFVANTIFGVESGLGAFPISFDYTQISQAMSGSVFATPFYVSANTYASVLLFFVIIL 364

Query: 354 XXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLL 413
                +NTWYAKYMPVISG+T+DNTQ KYNV+KILN D+S+NLEKYK YSP+FVPFSYLL
Sbjct: 365 PCLYFSNTWYAKYMPVISGSTYDNTQSKYNVTKILNEDYSINLEKYKNYSPIFVPFSYLL 424

Query: 414 SYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQV 473
           SYALN         HC LY+GKDI  K +++ +GG DIH R+Y++NY DCPDWWYLVLQV
Sbjct: 425 SYALNFAAVIAVFVHCILYHGKDILAKLKDRRNGGTDIHARIYSKNYADCPDWWYLVLQV 484

Query: 474 VMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYM 533
           VM+GLGF T+C FDS  PAWAF +A++IS +NFIPQGILEA+TNQHVGLNIITELICGYM
Sbjct: 485 VMIGLGFVTVCAFDSKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYM 544

Query: 534 LPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGI 593
           LP +PMAN+LFKLYGFIVMRQGL LSRDLKLA+YMKVPPRLIF IQIYATI+SG+VNVG+
Sbjct: 545 LPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVPPRLIFFIQIYATILSGMVNVGV 604

Query: 594 QEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLA 653
           QEWM  NI+ +CS+ Q +GFTC NGRT+FNASIIWS+P++LFSPGRIYNP+MWFFLIGL 
Sbjct: 605 QEWMTHNIEGICSTDQSNGFTCANGRTVFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLV 664

Query: 654 VPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPL 713
           VPLIV+A+QR F   Q  K++H PVFF GP +IPPSTPYNYSLFF+ S+ L+ IRKRW  
Sbjct: 665 VPLIVYAIQRKFPKIQFAKYIHTPVFFTGPGNIPPSTPYNYSLFFSASFCLHIIRKRWGP 724

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKG 773
           WF KYNYVMGA VE+GVA+AVVIIFLCVQ+PG +LNWWGN+V+KNTYDH Y+K+Y L++G
Sbjct: 725 WFKKYNYVMGAAVESGVAIAVVIIFLCVQFPGAELNWWGNNVWKNTYDHNYKKFYTLEEG 784

Query: 774 ETFGYDKWW 782
           +TFG+ KWW
Sbjct: 785 QTFGHTKWW 793

>KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {ON} 
          Length = 790

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/725 (68%), Positives = 587/725 (80%)

Query: 58  WEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSL 117
           WEGD T + NSP+ +VRA VP  DDPTI +NHWR                   SLRYPSL
Sbjct: 66  WEGDPTDMKNSPYAQVRAVVPVGDDPTIEINHWRTWFLTTVFVILFAGVNQFFSLRYPSL 125

Query: 118 SINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYA 177
           +INFLVAQV CYPIGK+L+ LP   C RC +F+LNPGPFTKKEHA+VTI+VALTSSTAYA
Sbjct: 126 TINFLVAQVCCYPIGKLLSWLPDWKCKRCHFFDLNPGPFTKKEHAIVTISVALTSSTAYA 185

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
           M +L AQT FY  K   GY  LLVWTSQMLGYGAAGLTRRW+V PAAC+WPQTLI+VSLF
Sbjct: 186 MYVLNAQTAFYKKKQSVGYQFLLVWTSQMLGYGAAGLTRRWIVYPAACVWPQTLIAVSLF 245

Query: 238 DSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHN 297
           DSLHN  +D ++VNGW+++RYRFF  VL GSF+WYWVPG+LF GLS FNV+LWG KTR+N
Sbjct: 246 DSLHNTAIDKTIVNGWRITRYRFFFFVLLGSFVWYWVPGYLFTGLSNFNVILWGPKTRNN 305

Query: 298 FIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
           FI NTIFGV+SG+G +P++FDYTQ+SQA++GSVFATP++V AN+ ASV            
Sbjct: 306 FIVNTIFGVKSGMGLMPVTFDYTQISQALTGSVFATPFYVVANTYASVFIFFMIVLPFLY 365

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
             N WYAKYMPVISG T+DNT + +NV+K++NPDF++NLEKYK YSP+ VPFSYLL+YAL
Sbjct: 366 FYNVWYAKYMPVISGTTYDNTGKSFNVTKVINPDFTINLEKYKKYSPIMVPFSYLLAYAL 425

Query: 418 NXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLG 477
           N         HC LY+GKDI   F N+ HGG+DIH R Y +NY DCPDWWY ++QVV+ G
Sbjct: 426 NFAAVVAVFVHCGLYHGKDIMKGFTNRFHGGRDIHTRTYLKNYNDCPDWWYGIVQVVVAG 485

Query: 478 LGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFK 537
           LGFAT+CGFDS LP WAF +A+++S +NFIPQGILEA+TNQHVGLNIITELICGYMLP +
Sbjct: 486 LGFATVCGFDSGLPVWAFIIAIMLSLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLR 545

Query: 538 PMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWM 597
           PM+N+LFKLYGFIVMRQGLELSRDLKL +YMKVPPRL+F IQ+YATIISG+V VGIQEWM
Sbjct: 546 PMSNLLFKLYGFIVMRQGLELSRDLKLGVYMKVPPRLLFFIQMYATIISGMVTVGIQEWM 605

Query: 598 RSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLI 657
             +I ++CS+TQ DGF C NGRT+FNASIIWS+P++LFSP R+Y+P+MWFFLIGL VPL 
Sbjct: 606 YVHIDDVCSTTQKDGFICANGRTMFNASIIWSLPKYLFSPHRLYSPLMWFFLIGLLVPLG 665

Query: 658 VFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSK 717
           V+A QRVFK NQ +K ++ PVFF GP +IPPSTPYNY+L+FAM Y+L  IRKR+P WF+K
Sbjct: 666 VYAAQRVFKKNQFLKHINTPVFFTGPGNIPPSTPYNYTLYFAMGYMLFTIRKRFPRWFNK 725

Query: 718 YNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFG 777
           YN+VMGA VETGVA+AVVIIFLCVQYP G + WWGN+V+KNTYD  Y+ YY LKK ETFG
Sbjct: 726 YNFVMGAAVETGVAIAVVIIFLCVQYPAGNIKWWGNTVWKNTYDGKYKTYYTLKKNETFG 785

Query: 778 YDKWW 782
             KWW
Sbjct: 786 PQKWW 790

>SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  503 bits (1294), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 269/729 (36%), Positives = 421/729 (57%), Gaps = 17/729 (2%)

Query: 62  VTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINF 121
           +T   +SP+PEVRA VP+TDDP +  N  R                   SL  PS+ +  
Sbjct: 85  ITIEDDSPYPEVRAAVPSTDDPLLPQNTVRMWTLGLIMTTIGCALNMLFSLHSPSIVLTT 144

Query: 122 LVAQVVCYPIGKILA-LLPQ-RDCARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAYA 177
            V  ++ +P+GK     +P  R   +    +LNPGPF  KEHA++TI   V+     AYA
Sbjct: 145 FVTSILAWPLGKAWERFIPDVRVFGKYGGPSLNPGPFNLKEHALITIMGNVSFGGGNAYA 204

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
            +IL+A  NFY+   G G+ +L +W++Q +G+  AGL +  +V PA+ +WP  L++ +  
Sbjct: 205 TDILLAMNNFYHKNFGWGFNLLAIWSTQCIGFAMAGLAKDVLVTPASMVWPSNLVTCTFL 264

Query: 238 DSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHN 297
            +LH    +    NGW +SR +FF ++    F++YW PGF+F+ LSYF  V W     +N
Sbjct: 265 TNLHVN--ENHKANGWTISRLKFFFLIFVIGFVYYWFPGFIFQALSYFAWVTW--IKPNN 320

Query: 298 FIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
            I N +FG  +G+G +P++FD+ Q++  + GS    P  V      S+            
Sbjct: 321 VIVNQVFGASTGLGIIPLTFDWNQIAGYV-GSPLIPPAGVIFTILLSMVSIFWVVVPAIH 379

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
            +N WY KY+P+    ++D  Q  YNVS+I+  + + +   Y  YSPL++  ++ +SY +
Sbjct: 380 YSNVWYGKYLPISDSGSYDRFQGSYNVSRIVGDNLTFDKAAYNKYSPLYLSATFAISYGM 439

Query: 418 NXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLG 477
           +         H AL++GKDI N+ R      +D+H RL  Q YKD P WWY ++ VV  G
Sbjct: 440 SFASTTATVVHAALFHGKDIWNQVRRVKTEEKDVHARL-MQQYKDTPQWWYAIVFVVFFG 498

Query: 478 LGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFK 537
           L  ATI G+++ +P +A  +AL+I+    +P GI+ A+TN  VGLN+ITE I GYMLP K
Sbjct: 499 LSIATIRGWNTEMPVFALVIALLIAAFFLLPIGIIYALTNISVGLNVITEFIIGYMLPGK 558

Query: 538 PMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWM 597
           P+A + FK +G+I   Q +  ++D+KL  YMKV PR++F+ Q  ATI   LV + + +W 
Sbjct: 559 PIAMMFFKTFGYITNNQAITFAQDMKLGHYMKVAPRIMFSAQFVATIWGSLVQICVLKWA 618

Query: 598 RSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAVP 655
           + NIK++C   Q   FTC   R  FNAS+IW +  PQ +FS G++YN +M+FFL+G  +P
Sbjct: 619 QGNIKDICEPHQKSHFTCPGSRVFFNASVIWGVIGPQRMFSSGQMYNKVMYFFLLGALLP 678

Query: 656 LIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLN-RIRKRWPLW 714
           ++ + + + +  N  ++ ++ PVFF+G   IPP+TPYNY  +  +       ++++W  W
Sbjct: 679 IVNWLILKKWP-NSLVRHLNWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYYVKQKWFHW 737

Query: 715 FSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKL-NWWGNSVYKNTYDHAYRKYYV-LKK 772
           +SKYNY + AG++  +A + ++IFLC+        +WWGN+V  NT D+      V L++
Sbjct: 738 WSKYNYSLSAGLDISLAWSSLMIFLCLSLTNTDAPSWWGNNVI-NTSDYEGTAIQVQLEE 796

Query: 773 GETFGYDKW 781
            ++FG  KW
Sbjct: 797 DQSFGLTKW 805

>KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar to
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 794

 Score =  501 bits (1291), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 263/723 (36%), Positives = 418/723 (57%), Gaps = 15/723 (2%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +S +PEVRA VP++DDPT+  N  R                   SL  PS+ ++  V  +
Sbjct: 79  DSAYPEVRAAVPSSDDPTLPQNTVRMWVIGMLMATVGSGLNLLFSLHSPSIVLSAFVTSI 138

Query: 127 VCYPIGKIL-ALLPQ-RDCARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILI 182
           + +PIGK    ++P  +   R    +LNP PF  KEH ++ I   V+     AYA +I +
Sbjct: 139 LAWPIGKAWDKVMPDVKLFGRFGGPSLNPSPFNLKEHCLIQIMANVSFGGGEAYATDIFL 198

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
           A  N++    G G+ ++ +  +Q +G+  AGL +  ++ PA+ IWP  L++ +   +LH 
Sbjct: 199 AMNNYFEADFGWGFDIVTILATQCIGFALAGLVKDILITPASMIWPSNLVTCTFLTNLHI 258

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
              +  + NGWK+SR +FF +V    F++YW PGF+F+ LSYF  V W      N I N 
Sbjct: 259 N--ENHMANGWKISRLKFFFMVFIIGFVYYWFPGFIFQALSYFAWVTW--IRPDNVIINQ 314

Query: 303 IFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTW 362
           IFG  +G+G +P++FD+ Q++  + GS    P     +   S+             +N W
Sbjct: 315 IFGASTGLGIIPLTFDWNQIAGYV-GSPLVPPVSTIFSILLSMIMIFWVTVPAIHYSNVW 373

Query: 363 YAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXX 422
           + KY+P+    ++D  QQ YNVSKI+ P+ S +++ YK+YSPL++P ++++SY ++    
Sbjct: 374 FGKYLPISDSGSYDRFQQSYNVSKIVTPNLSFDIDAYKSYSPLYLPATFVISYGMSFASN 433

Query: 423 XXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFAT 482
                H  L++GK+I   FRN     +DIH RL  +NY+D P WWY ++ +V  GL  A 
Sbjct: 434 TATLVHAGLFHGKEITGAFRNVKKEQEDIHNRL-MKNYRDVPHWWYGIVFLVFFGLAIAG 492

Query: 483 ICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANV 542
           I  +++ +P WA   ALVI+ +  +P GI+ AVT+  VGLN++TE I GY+LP KP+A +
Sbjct: 493 IRAWNTEMPVWALIFALVIAGVFLVPIGIICAVTSISVGLNVLTEFIIGYILPGKPIAMM 552

Query: 543 LFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIK 602
            FK +G+I   Q +  ++D+KL  YMK+ PRL+F+ Q  AT+ S +V V + +W + NI 
Sbjct: 553 FFKTFGYITNHQAVTYAQDMKLGHYMKIAPRLMFSAQFIATVWSSVVQVCVLKWAQGNIT 612

Query: 603 ELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAVPLIVFA 660
           ++C + Q   FTC N R  FNA+IIW +  PQ +FS G++Y+ ++WFFLIG ++PLI + 
Sbjct: 613 DVCDAHQKSHFTCPNARVFFNAAIIWGVIGPQRMFSSGQLYSKVLWFFLIGASLPLINWL 672

Query: 661 LQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNR-IRKRWPLWFSKYN 719
           + + +  +  IK+++ PVFF+G   IPP+TPYNY  +  +       I+++W  W++KYN
Sbjct: 673 VLKKWPKS-PIKYLNWPVFFSGTGLIPPATPYNYGSYCMVGITFGYFIKRKWFHWWTKYN 731

Query: 720 YVMGAGVETGVALAVVIIFLCVQYPGGKL-NWWGNSVYKNTYDHAYRKYYVLKKGETFGY 778
           Y + A ++  +A + ++IF C+        NWWGN+V             +L  GE+FG 
Sbjct: 732 YSLSAALDISLAWSSLMIFFCLTLTNTNAPNWWGNTVIDTIDYEGTAIQSILNDGESFGL 791

Query: 779 DKW 781
            KW
Sbjct: 792 TKW 794

>SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  499 bits (1284), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 272/732 (37%), Positives = 418/732 (57%), Gaps = 22/732 (3%)

Query: 62  VTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINF 121
           +T   +SP+ EVRA VP+TD+P I  N  R                   S+  PS+ +  
Sbjct: 84  ITVDDDSPYAEVRAAVPSTDNPVIPQNTIRMWTLGFIMTTIGSAINMLFSMHSPSIILTT 143

Query: 122 LVAQVVCYPIGKILA-LLPQ-RDCARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAYA 177
            V  ++ +P+GK  A  LP  R   +    +LNPGPF  KEH ++T+   V+     AYA
Sbjct: 144 FVTSILAWPLGKAWARFLPDVRIFGKYGGPSLNPGPFNLKEHTLITVMGNVSFGGGNAYA 203

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
            +IL++  NFY    G G+ +L +W++Q +G+  AGL ++ +V P+  IWP  L++ +  
Sbjct: 204 TDILLSMNNFYGTDFGWGFGLLAIWSTQCIGFSLAGLAKKILVTPSTMIWPSNLVTCTFL 263

Query: 238 DSLH-NRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRH 296
            +LH N    AS   GW +SR RFF +V    F++YW PGF+F+GLSYF  V W     +
Sbjct: 264 TNLHINENHSAS---GWTISRLRFFFLVFLIGFLYYWFPGFIFEGLSYFAWVTW--IKPN 318

Query: 297 NFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXX 356
           N + N +FG  +G+G +PI+FD+ Q++   +GS    P  V      S+           
Sbjct: 319 NVVINQVFGASTGLGLIPITFDWNQIA-GYTGSPLIPPVGVLVTILLSMVIIFWIVVPII 377

Query: 357 XXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYA 416
             +N WY KY+P+    ++D  QQ YNVSKI++   + +   YK YSPL++  S+ ++Y 
Sbjct: 378 HYSNVWYGKYLPISDSESYDRFQQPYNVSKIVDDSLTFDPAGYKKYSPLYLSASFAIAYG 437

Query: 417 LNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVML 476
           ++         H  L++GKD+ ++ R+     +D+H RL  + YK+ P WWY ++ +V  
Sbjct: 438 MSFASTTATIVHAVLFHGKDVWDQARSLKVEEEDVHARL-MREYKETPCWWYAIVFLVFF 496

Query: 477 GLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPF 536
           GL   T+  +++ +P +A  +ALVI+    +P GI+ A+TN  VGLN+ TE I GYMLP 
Sbjct: 497 GLAVVTVRVWNTEMPVYALIIALVIAAFFLLPIGIIYALTNIPVGLNVFTEFIVGYMLPG 556

Query: 537 KPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEW 596
           KP+A + FK +G+I   Q +  ++D+KL  YMKV PRL+F  Q  ATI   LV + + +W
Sbjct: 557 KPIAMMFFKTFGYITNNQAIIFAQDMKLGHYMKVAPRLLFTAQFLATIWGSLVQICVLKW 616

Query: 597 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAV 654
            +  I  LCS  Q D +TC   R  FNAS+IW +  P  +FS G+IYN +++FFL+G  +
Sbjct: 617 AQDTIPGLCSDDQKDNYTCPGSRVFFNASVIWGVIGPDKMFSSGKIYNGLLYFFLLGAIL 676

Query: 655 PLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLN-RIRKRWPL 713
           P+I + + R +  N  I++M+ PVFF+G   IPP+TP+NY  +  +       +R++W  
Sbjct: 677 PVINWLILRKWP-NSLIQYMNWPVFFSGTAMIPPATPFNYGAYCMVGIFFGYYVRRKWFH 735

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKL-NWWGNSVYKNTYDH---AYRKYYV 769
           W+SKYNY + AG++ G+A + +IIFLC+        +WWGNSV  +T D    A ++   
Sbjct: 736 WWSKYNYSLSAGLDIGLAWSSLIIFLCLYLTNASFPDWWGNSVVDSTMDSWGTAIQRQ-- 793

Query: 770 LKKGETFGYDKW 781
           L  GE+FG   W
Sbjct: 794 LSDGESFGLTSW 805

>KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {ON}
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 814

 Score =  499 bits (1284), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 263/730 (36%), Positives = 430/730 (58%), Gaps = 18/730 (2%)

Query: 62  VTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINF 121
           +T   +SP+PEVRA+VP+TDDP++V N  R                   S+  P++ +  
Sbjct: 93  ITVEDDSPYPEVRASVPSTDDPSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTT 152

Query: 122 LVAQVVCYPIGKILAL-LPQRDC-ARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAYA 177
            V  ++ +P+G+   + +P +    R    +LNPGPF  KEHA++T    VA  S  AYA
Sbjct: 153 FVTSILAWPLGRAWDMVMPDKPVFGRFGGPSLNPGPFNVKEHALITAMGNVAFGSGNAYA 212

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
            +I+++  NFYN   G G+ +L VW++Q +G+  AGL+R+ +V PA+ IWP  L++ +  
Sbjct: 213 TDIILSMNNFYNKDFGWGFDLLAVWSTQCIGFAMAGLSRKVLVTPASMIWPANLVTCTFL 272

Query: 238 DSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHN 297
            ++H    +  V NGWK+SR +FF+IV    F++YW PGF+F+ LSYF  V W      +
Sbjct: 273 TNMHIN--ENHVANGWKISRLKFFMIVFIVGFVYYWFPGFIFQALSYFAWVTW--IKPKD 328

Query: 298 FIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
            I N +FG  +G+G +P++FD+ Q++  + GS    P  V A    S+            
Sbjct: 329 VIVNQVFGASTGLGLIPLTFDWNQIAGYV-GSPLVPPLGVIATILLSMVIIFWIVVPAVH 387

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
            +N WY KY+P+    ++D  Q  YNVSKI++   + N + Y+ YSPL++  ++ +SY L
Sbjct: 388 YSNIWYGKYLPISDSGSYDRFQNTYNVSKIVSESLTFNKDAYREYSPLYLSATFAISYGL 447

Query: 418 NXXXXXXXXXHCALYNGKDIKNKFRN-KNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVML 476
           +         H   ++GK I    RN  +   +D+H +L  +NY+D P WW++V+ ++  
Sbjct: 448 SFAGTMATITHAICFHGKQIWGAIRNITSSEEEDVHAKL-MRNYRDVPQWWFIVVFLIFF 506

Query: 477 GLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPF 536
           GL  AT+  + + +P +   +AL+I+F   +P GI+ A+TN  VGLN+ITE I GYM P 
Sbjct: 507 GLSIATVRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTNIAVGLNVITEFIIGYMTPG 566

Query: 537 KPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEW 596
           KP+A + FK +G+I   Q +  ++D+K+  YMKV PR++F+ Q+ AT+  GLV + + +W
Sbjct: 567 KPIAMMFFKTFGYITNNQAITFAQDMKIGHYMKVAPRVLFSAQLVATVWGGLVQMCVMKW 626

Query: 597 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAV 654
            + NI+++C+S Q   FTC   +  FNASIIW +  PQ +FS G++Y+ +M+FF++G  +
Sbjct: 627 AQGNIEDICTSKQKSHFTCPGSKVFFNASIIWGVIGPQRMFSAGQMYDKLMYFFILGAGL 686

Query: 655 PLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNR-IRKRWPL 713
           P++ + + + +  +  +++++ PVFF+G   IPP+TPYNY  +  +       I+K +  
Sbjct: 687 PVVNWLVLKKWPRS-LVRYLNWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYFIKKNYFN 745

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKL-NWWGNSVYKNTYDH-AYRKYYVLK 771
           W++KYNY + AG++  +A + +IIFL +        +WWGN+V  NT D+      + L 
Sbjct: 746 WWAKYNYSLSAGLDISLAWSSLIIFLALGLTNTDAPSWWGNNVI-NTIDYDGTAIQHQLT 804

Query: 772 KGETFGYDKW 781
            GE+FG  KW
Sbjct: 805 DGESFGLKKW 814

>Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 159] FULL
          Length = 810

 Score =  496 bits (1277), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 265/730 (36%), Positives = 418/730 (57%), Gaps = 17/730 (2%)

Query: 62  VTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINF 121
           +T   +SP+PEVRA VP++DD ++V N  R                   S+  PS+ +  
Sbjct: 88  ITVEDDSPYPEVRAAVPSSDDTSLVQNTVRMWTLGMIMSTIGCGLNMLFSMHSPSIVLTT 147

Query: 122 LVAQVVCYPIGKILAL-LPQRDC-ARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAYA 177
            V  ++ +P+G+   L +P +    R    + NPGPF  KEHA++T    V+    +AYA
Sbjct: 148 FVTSILAWPLGRGWDLIMPDKPMFGRFGGPSWNPGPFNVKEHALITAMGNVSFGGGSAYA 207

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
            +I+++  NFYN   G G+ +L  W++Q +G+  AGL R  +V PA+ IWP  L++ +  
Sbjct: 208 TDIILSMNNFYNKDFGWGFDLLATWSTQCIGFAMAGLVRNVLVTPASMIWPANLVTTTFL 267

Query: 238 DSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHN 297
            ++H    +  V NGW +SR +FF+I+    FI+YW PGF+F+ LSYF  V W     ++
Sbjct: 268 TNMHVN--ENHVANGWTISRLKFFLIIFLAGFIYYWFPGFIFQALSYFAWVTW--IKPND 323

Query: 298 FIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
            I N +FG  SG+G +P++FD+ Q++  + GS    P  V      S+            
Sbjct: 324 VIVNQVFGASSGLGLIPLTFDWNQIAGYV-GSPLVPPLGVIVTILLSMILIFWVVVPAVH 382

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
            +N WY KY+P+   +++D  Q  YNVSKI++ + S +   Y+ YSPL++  ++ +SY L
Sbjct: 383 YSNVWYGKYLPISDSSSYDRYQGTYNVSKIVSENLSFDKAAYEEYSPLYLSATFAISYGL 442

Query: 418 NXXXXXXXXXHCALYNGKDIKNKFRN-KNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVML 476
           +         H   ++GK I +  RN K    +D+H RL  Q Y+D P WWYL++ V+  
Sbjct: 443 SFAGITSTIMHAICFHGKLIWDHMRNIKRAEDEDVHARLMRQ-YRDVPQWWYLIVFVIFF 501

Query: 477 GLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPF 536
           G+  ATI  + + +P +   +AL+I+F   +P GI+ A+TN  VGLN+ITE I GYM P 
Sbjct: 502 GMSVATIRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTNISVGLNVITEFIIGYMTPG 561

Query: 537 KPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEW 596
           KP+A + FK YG+I   Q +  ++D+KL  Y+K+ PR++FA Q+ ATI   LV + + +W
Sbjct: 562 KPIAMMFFKTYGYITNNQAITFAQDMKLGHYLKLAPRVLFAAQLIATIWGSLVQICVMKW 621

Query: 597 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAV 654
            + NI+++C+  Q   FTC   R  FNASIIW +  PQ +FS G++YN +M+FF++G  +
Sbjct: 622 AQGNIEDVCTRKQASHFTCPGARVFFNASIIWGVIGPQRMFSAGQMYNKLMYFFILGAGL 681

Query: 655 PLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLN-RIRKRWPL 713
           P++ + + + +     IK+++ PVFF+G   IPP+TPYNY  +  +  +    I+ R+  
Sbjct: 682 PVVNWLILKKWP-GSYIKYLNWPVFFSGTGLIPPATPYNYGAYCMVGIIFGYYIKTRFFN 740

Query: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKL-NWWGNSVYKNTYDHAYRKYY-VLK 771
           W++KYNY + AG++  +A + +IIFL +         WWGN V   T D  Y      L+
Sbjct: 741 WWAKYNYTLSAGLDISLAWSSLIIFLALGLTNTDAPKWWGNDVMNGTMDTNYTAVQRTLQ 800

Query: 772 KGETFGYDKW 781
           +GE FG   W
Sbjct: 801 EGEFFGLKSW 810

>ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJL212C (OPT1)
          Length = 796

 Score =  475 bits (1223), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/733 (36%), Positives = 405/733 (55%), Gaps = 23/733 (3%)

Query: 61  DVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSIN 120
           DV    +SP+PEVRA VP+ DD T++ N  R                   S+  PS++++
Sbjct: 65  DVLVEDDSPYPEVRAAVPSFDDTTMLQNTVRMWTIGLLMTTIGSAVNMLFSMHAPSMAVS 124

Query: 121 FLVAQVVCYPIGKILAL-LPQ-RDCARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTAY 176
             V  ++ +P+G+  A  +P  R   R     LNPGPF+ KEHA++T+   ++     AY
Sbjct: 125 TFVTSMLAWPLGRFWARWVPNVRIFGRFGGPFLNPGPFSLKEHALITVMGNISFGGGAAY 184

Query: 177 AMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSL 236
           A +IL++   FY    G  + +L +W++Q +G+  AGL  + ++ P   IWP TL+  + 
Sbjct: 185 ATDILLSMNMFYKRDYGWLFDLLAIWSTQCIGFSLAGLCYKILITPPLMIWPSTLVQCTF 244

Query: 237 FDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRH 296
             ++H    +  V NGWK+SR +FF+I+    FI+YW+PG+LF+ LS F  V W +    
Sbjct: 245 LSNIHIH--NNKVANGWKVSRLKFFMIIFIAGFIYYWLPGYLFQALSSFAWVTWIAP--K 300

Query: 297 NFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXX 356
           N + N IFG  +G+G LPI+FD+ Q++  + GS    P         S+           
Sbjct: 301 NVVVNQIFGSSTGLGLLPITFDWNQIAGYV-GSPLVPPISAIFTILCSMVTIFWIVVPIV 359

Query: 357 XXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYA 416
             +NTWY  Y+P+    + D  QQ+YNV+K++N   S++LE Y +YS L++P ++ +SY 
Sbjct: 360 HYSNTWYGNYVPISDSTSMDRFQQRYNVTKVVNQRLSLDLEAYHSYSRLYLPTTFAISYG 419

Query: 417 LNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVML 476
           ++         H A ++ + I N  RN N   +D+H RL  + YK  P WWYLV   V L
Sbjct: 420 MSFASVMATISHTACFHWRTIYNGVRNINTQDRDVHARL-MERYKAPPYWWYLVTFFVFL 478

Query: 477 GLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPF 536
            L  AT+  +D+ LP WA F+AL I+    +P GI+ A+TN  VGLN+ITE I GYMLP 
Sbjct: 479 ALSIATVRAWDTQLPVWALFLALAIAGFFLLPVGIIYALTNMAVGLNVITEFIIGYMLPG 538

Query: 537 KPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEW 596
           +P+A + FK +G+I   Q +  ++D+KL  Y+KV P+L+F  Q  ATI    V + +  W
Sbjct: 539 RPIAMMFFKTFGYITNSQAITFAQDMKLGHYLKVAPKLMFTAQFIATIWGSTVQIAVLRW 598

Query: 597 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIGLAV 654
             +NIK LC+  QP  FTC      F ASIIW +  PQ +FS G++Y+ + +FF++G  +
Sbjct: 599 SEANIKGLCTKAQPGHFTCPGATVFFTASIIWGVIGPQRMFSAGQMYSSLNYFFVLGFFL 658

Query: 655 PLIVFAL-----QRVFKHNQAIKFMHA----PVFFAGPNSIPPSTPYNYSLFFAMSYVLN 705
           P++ + +     +R  K  + +KF+      PVFF+G   IPP+TPYNY  +  +     
Sbjct: 659 PIVNWLILSKWSKRFEKSGRGLKFVAKYLSWPVFFSGTGLIPPATPYNYGSYCIVGIFFG 718

Query: 706 RIRKRWPL-WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLN-WWGNSVYKNTYDHA 763
              KR+   W+ KYNY + A ++ G+A   +IIF        K   WWGN+V      + 
Sbjct: 719 YFIKRYYFQWWCKYNYSLSAALDIGLAWGALIIFFSTGIAVRKAPVWWGNTVIDTLDTNG 778

Query: 764 YRKYYVLKKGETF 776
               Y+L++GE F
Sbjct: 779 QAIKYILQEGEYF 791

>Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii ABR156W
          Length = 800

 Score =  450 bits (1158), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 253/721 (35%), Positives = 398/721 (55%), Gaps = 27/721 (3%)

Query: 60  GDVTALPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSI 119
             +T   +SP+PEVRA VP+ DD +++ N  R                   S+  P +++
Sbjct: 66  ASLTVEGDSPYPEVRAAVPSYDDSSLLQNTVRMWAIGLFMTTVGSALNMLFSMHTPPIAL 125

Query: 120 NFLVAQVVCYPIGKILA-LLPQ-RDCARCPWFNLNPGPFTKKEHAVVTIA--VALTSSTA 175
              V  ++ +P+GK     +P  R         LNP PF  KEHA++TI   VA     A
Sbjct: 126 TAFVTSLMGWPMGKAWEYFVPNWRLFGPLGGPYLNPTPFNLKEHALITIMGNVAFGGGNA 185

Query: 176 YAMNILIAQ--TNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLIS 233
           YA +IL++    +FYN   G  + +L VW++Q +G+  AG+  + +V+PA  IWP  L++
Sbjct: 186 YATDILLSMHIKDFYNRNYGWAFDLLAVWSTQCIGFSLAGMCHQILVKPAVMIWPSALVT 245

Query: 234 VSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSK 293
            +   ++H    +  V NGWK+SR +FF+IV    F+WYW+PG+LF+ L  F   LW + 
Sbjct: 246 CTFLTNIHIN--ENHVANGWKISRLKFFLIVFIIGFVWYWIPGYLFQALGTFVWPLWIAP 303

Query: 294 TRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXX 353
              N I N +FG ++G+G LP++FD+ Q+S   +GS    P         SV        
Sbjct: 304 --KNVIVNQLFGPQTGMGLLPLTFDWNQIS-GFTGSPLVPPVSAIITIAISVVSIFWILL 360

Query: 354 XXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLL 413
                +N WY KY+P+    ++D  Q  YNVS I++   S++ ++Y+ YSPL++P S+ +
Sbjct: 361 PIIHYSNIWYGKYLPMSRSKSYDRYQNTYNVSAIVDETLSLDKQEYQNYSPLYLPTSFAI 420

Query: 414 SYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQV 473
           SY ++         H  L++GKDI  + R+     +D+H RL  ++YK  P WWY  + +
Sbjct: 421 SYGMSFASITATVMHTILFHGKDIVARMRSLKTEEEDVHARL-MKSYKTVPWWWYACVFL 479

Query: 474 VMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYM 533
           V L +  A I G+D+ +P WA   AL I+ +  +P GI+ A+TN  VGLN+ITE + GY+
Sbjct: 480 VFLAMSIAVIAGWDTQMPIWALIFALGIATVFLLPVGIIYALTNISVGLNVITEFLIGYV 539

Query: 534 LPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGI 593
           LP +P+A + FK +G+I   Q +  ++D+K+  Y+K+ PRL+F  Q  ATI  G V V +
Sbjct: 540 LPGRPIAMMFFKTFGYITNNQAITFAQDMKIGHYLKLAPRLMFTAQFLATIWGGTVQVAV 599

Query: 594 QEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSPGRIYNPIMWFFLIG 651
             W   NI +LC  T+   F C +    FNASIIW +  PQ +FS G++Y+ + +FF+ G
Sbjct: 600 MRWAEGNIPDLC--TKDGSFNCPHATVFFNASIIWGVIGPQRMFSSGQLYSKLNYFFIAG 657

Query: 652 LAVPLIVFAL-----QRVFKHNQ----AIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSY 702
             +P+I + +     +R  K+ +      K++  PVFF+G   IPP+T YNY  +  +  
Sbjct: 658 AILPVINWLILNKWPKRFEKYGRIPKICAKYLSWPVFFSGTGMIPPATAYNYGAYCILGI 717

Query: 703 VLNRIRKR-WPLWFSKYNYVMGAGVETGVALAVVIIFLCVQ-YPGGKLNWWGNSVYKNTY 760
                 KR W  W++KYNY + A ++ G+A + +I+F     +     +WWGN+V  NT 
Sbjct: 718 FFGYFVKRYWFHWWTKYNYSLSAALDIGLAWSALIVFFSTSIHTVNPPSWWGNNVVSNTL 777

Query: 761 D 761
           D
Sbjct: 778 D 778

>SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 887

 Score =  295 bits (754), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 232/791 (29%), Positives = 361/791 (45%), Gaps = 64/791 (8%)

Query: 7   KVETLQVWEKVENSSESSSQEHVPHVINKDGXXXXXXXXXXXXXXXTDQTIWEGDVTA-- 64
           K+E L V E VE   E          I  +                 ++ I+E    A  
Sbjct: 88  KIEKLSVEEAVEILKEGVEYHEDDPNIPSNEYAEYVRFANGDYDHENEKEIFELKALAGL 147

Query: 65  -LPNSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLV 123
              +SP+ EVRA V  +D+PTI V  +R                   S R  S+SI+  V
Sbjct: 148 LKFHSPYAEVRAVVEPSDNPTIPVETFRAYFLALVWGIVGSGFNEFFSHRLVSISISTSV 207

Query: 124 AQVVCYPIGKILALLPQRDC----ARCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAM 178
            Q+  Y  G + A      C     +   F LN   P+T KE    T+  A+ +   Y  
Sbjct: 208 VQMFLYLCGTLWA--KHLPCWGFTVKGKRFALNIETPWTDKEQMFATLLFAICNGVFYTH 265

Query: 179 NILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFD 238
             ++ Q  +Y  K+  GY   L    Q +G+G AG+ RR+VV PA  +WP ++ +++L +
Sbjct: 266 YNILTQKIYYGDKISFGYQFWLSICIQFIGFGFAGILRRFVVYPARTLWPTSMSTIALNN 325

Query: 239 SLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNF 298
           +L +R  D S      +SRY FF I  +  F++ W P +L   L+ FN + W +   +NF
Sbjct: 326 ALLSREKDVSK----GLSRYSFFFIATTFMFLYTWFPTYLINILNTFNWMTWIAP--NNF 379

Query: 299 IANTIFGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
               I G  SG+G  PIS FD+  ++         TP++  +   A              
Sbjct: 380 DLAAITGGVSGLGINPISSFDWNVINFLYP---LVTPFFSYSVQFAG-SFFAALVVIAVY 435

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
            TN    +Y+P+ S + F NT   Y++ KILN D+ V+ EKY+ YSP F     L+SY  
Sbjct: 436 YTNYKDCQYLPIFSNSLFTNTGTPYSIKKILNSDYKVDEEKYQQYSPPFYSAGNLVSYGS 495

Query: 418 NXXXXXXXXXHCALYNGKDIKNKFRN--------------KNHGGQDIHM--------RL 455
                     +  +   K +    ++               N   Q+ H           
Sbjct: 496 FIAVYPMLIIYAFITESKVLLGACKDWAKGIWSLRKWQSWTNMAKQEYHALDSFNDPHSN 555

Query: 456 YTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAV 515
             + YK+ PDWWY ++ ++ + +    +  ++++ P WA F++L  +F+  IP  IL+A 
Sbjct: 556 MMKKYKEVPDWWYFMILLISIVISIIVLEKYETNTPIWALFMSLGFNFVFLIPITILQAT 615

Query: 516 TNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLI 575
           T   +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +
Sbjct: 616 TGFSIGLNLLIEMIIGYALPGNPYALMIVKAFGYNIDGQADNYVSNLKMAHYCKIPPVAL 675

Query: 576 FAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLF 635
           F  Q++   +  LVN+G+  W  SNIK+ C   Q   FTC + RT +NAS++W       
Sbjct: 676 FRGQLFMVFVQVLVNLGVLNWQISNIKDFCQPNQASKFTCPDARTYYNASVMWGA----M 731

Query: 636 SPGRIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGP--NSIPP- 688
            P +I+N   PI+ W +LIG  +  + F L +V+       + + P+ F G   N  PP 
Sbjct: 732 GPKKIFNDVYPILRWCWLIGACLG-VFFGLWKVYGRRYYPTWFN-PILFVGGMINMGPPY 789

Query: 689 ----STPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYP 744
                 P  +  FF+  Y+     + W     KYNYV  A    G+  + ++IF  VQY 
Sbjct: 790 GLMYVVPGFFVSFFSQFYLKKYHLRLW----EKYNYVCDAAFSAGLVFSSIVIFFAVQYK 845

Query: 745 GGKLNWWGNSV 755
              LNWWGN+V
Sbjct: 846 QKDLNWWGNTV 856

>ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  291 bits (744), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 186/661 (28%), Positives = 324/661 (49%), Gaps = 20/661 (3%)

Query: 111 SLRYPSLSINFLVAQVVCYPIGKI-LALLP--QRDCARCPWFNLNPGPFTKKEHAVVTIA 167
           + R+PS++I+ +V Q++ YP G +   ++P  +        F LNPG F+ +E A+V + 
Sbjct: 152 AFRFPSIAISPIVGQLISYPFGILWYRIMPNWKFSIGSRYTFELNPGKFSPQEQALVYLF 211

Query: 168 VALTSSTAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIW 227
                 T    N  + QT F+N+ +G G  +L      +L +G AGL    +V+    IW
Sbjct: 212 CNTVYGTGVLKNTQVEQTRFFNVDVGIGRFILFNIVGYLLAWGMAGLAIPILVDREELIW 271

Query: 228 PQTLISVSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNV 287
           P  L   +L ++ H+ T      +  K  ++ FF+I  +GSF+WYW    +   ++  N+
Sbjct: 272 PSVLGPSALINAFHSDT--KGKFSDLKKPKFSFFMIAFAGSFVWYWFSDLILPFIA--NL 327

Query: 288 VLWGSKTR-HNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVX 346
             + S  R  N +   +FGV++G+G LPISFD+  VS     +   TP W      AS  
Sbjct: 328 GAFPSWIRPKNKVLGQVFGVKNGLGLLPISFDWPTVSNI--SNPLTTPVWAGVMIFASFF 385

Query: 347 XXXXXXXXXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLF 406
                        + W   +MP++S   FD   + Y V K++N  + ++ EKYK YSP++
Sbjct: 386 FWAWVVIPGLYYQDHWQTAHMPLMSNKIFDKNGESYQVKKVVNKKWELDFEKYKKYSPVY 445

Query: 407 VPFSYLLSYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDW 466
           +P  +L+  AL                  D+ + F   +      +   YT+ +      
Sbjct: 446 LPIGFLIQLALGLGGFSSVMTFFFWKFKSDVWDPFMQHSTKKTAHYKPAYTKPFVAA--- 502

Query: 467 WYLVLQVVMLGLGFATICGFD--SHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNI 524
            Y+   V+ LGLGF  +  +D  + + +  F V+++I  + F+P  ++E+ ++  + +N 
Sbjct: 503 -YIASMVLGLGLGFVFVEAWDRDTQIDSGGFVVSIIIGIVLFLPVALVESRSSFLLNMNG 561

Query: 525 ITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATI 584
           I  +I  +    KPMA + F  +GF + + G+  ++  KL  YMK PPRL   + + + I
Sbjct: 562 ILNVIGAFWYKGKPMATLYFLNFGFSLFQHGMHFTQGAKLGYYMKTPPRLTILVLLVSGI 621

Query: 585 ISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM-PQFLFSPGRIYNP 643
            + L+   +  ++  ++  +C+    +  TC + +T FN  I+W +    LFS G  Y  
Sbjct: 622 WTSLIIPSVTGYVLYHVGNVCTPNAHNNMTCKSQQTAFNTQIVWGLFGSHLFSNGGRYQF 681

Query: 644 IMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYV 703
           IM+FFL+G  V LIV  +Q    +++    +   +  +G   +P ST  +Y  +F +  V
Sbjct: 682 IMYFFLVGAGVSLIVILMQWRRPNSRFWSKVSPTLLLSGAEDMPTSTGLHYGTWFFLVLV 741

Query: 704 LNR-IRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGK--LNWWGNSVYKNTY 760
            N  I K+ P W+ KYN ++   ++ GVA+A +I++  V Y GG     WW   V  ++ 
Sbjct: 742 FNGFIHKKRPHWWRKYNLILATALDCGVAIAAIIVYFAVSYTGGSSHYKWWATEVTSSSC 801

Query: 761 D 761
           D
Sbjct: 802 D 802

>TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON} 
          Length = 896

 Score =  292 bits (747), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 222/735 (30%), Positives = 343/735 (46%), Gaps = 63/735 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRA V ATDDP I V  +R                   S R  ++S+N  V Q+
Sbjct: 160 HSPYKEVRAVVEATDDPNIPVETFRSYFLALLCAIVGSGFNEFFSHRVVTISVNTSVIQM 219

Query: 127 VCYPIGKILALLPQRDC------ARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNI 180
             Y  GK  A      C       R    N++  P+T KE    T+  A+ S T Y    
Sbjct: 220 FLYFFGK--AWERYIPCWGISVKGRKYAINIDK-PWTAKEQMFATLLFAICSGTFYTHYN 276

Query: 181 LIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSL 240
           ++ Q  +Y   +  GY   L  + Q LG+G AG+ RR+VV     +WP  + +++L  +L
Sbjct: 277 ILTQKVYYKEDVPFGYQFWLSLSVQFLGFGFAGILRRYVVYNPRALWPTVMTTLALNKAL 336

Query: 241 HNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIA 300
            +   D    NG  MSRY+FF I  S  FI+ W P ++   L+ FN + W S    N   
Sbjct: 337 LDNKQDKG--NG--MSRYKFFFITFSAMFIYNWFPTYIINILNTFNWMTWISP--QNLKL 390

Query: 301 NTIFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANS-CASVXXXXXXXXXXXXX 358
             I G  SG+G  P  SFD+  VS     S    P++ +    C +              
Sbjct: 391 ALITGGVSGLGFNPFPSFDWNVVSNV---SPLIIPFYSNMTQFCGAFFAALVIIAVYF-- 445

Query: 359 TNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYS--------------- 403
           TN    +Y+P+ +   F N    Y ++ ILN DF ++ +KY+ YS               
Sbjct: 446 TNYKDCQYLPMFTNPLFTNKATVYEITNILNSDFKIDEKKYQEYSAPYYTAGNLVAYGSF 505

Query: 404 ----PLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYT-- 457
               PL + +S++  + L              +   +   K  +K +   D +   ++  
Sbjct: 506 IALYPLLIVYSFITDWELLSGAFGLWINSLWSFRSWNQWKKTFSKQYSAMDSYDDAHSNM 565

Query: 458 -QNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVT 516
            +NY + PDWWY ++ +  + +       + ++ P WA FV++  +F   IP  ILEA T
Sbjct: 566 MKNYAEVPDWWYFIILICSIIVAICVCEKYQTNTPIWALFVSIGFNFAFLIPLTILEATT 625

Query: 517 NQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIF 576
               GLN++ E+I GY LP  P+A +L K +G+ +  Q      +LK+  Y K+PP  +F
Sbjct: 626 GFSFGLNLLIEMIIGYALPGNPLALMLVKAFGYNIDGQADNYVSNLKMGHYSKIPPVALF 685

Query: 577 AIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFS 636
             Q+    I   VN+G+  W  SNIK  C+ TQ   FTC + +T +NAS++W        
Sbjct: 686 RGQLIMVFIQIFVNLGVLNWSISNIKGFCTRTQSAKFTCPDAQTYYNASVVWGA----LG 741

Query: 637 PGRIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPY 692
           P +I+N   PI+ W +LIG  + L  F + R F       + +  +F  G +++ P  PY
Sbjct: 742 PKKIFNEVYPILRWCWLIGALIGLF-FGIWRRFGSKYYPNWFNPVLFVGGMSNLSP--PY 798

Query: 693 NYSLFFAMSYVLN------RIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGG 746
              ++F    V+N        R    LW SKYNY++ +G  +G+ L+ +IIF  VQ+   
Sbjct: 799 GL-MYFIPGIVVNWFSQYYMKRNHLRLW-SKYNYILDSGFTSGLVLSAIIIFFAVQFKDT 856

Query: 747 KLNWWGNSVYKNTYD 761
           +L+WWGN+V  N  D
Sbjct: 857 ELSWWGNNVPYNGVD 871

>Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON}
           YPR194C (OPT2) - oligopeptide transporter [contig 159]
           FULL
          Length = 882

 Score =  289 bits (740), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 219/728 (30%), Positives = 346/728 (47%), Gaps = 60/728 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRATV   DDP I V  +R                   S R  S+S++  V Q+
Sbjct: 145 HSPYKEVRATVDPRDDPNIPVETFRSYFLALVWAIIGSGFNEFFSHRLVSISLSTSVIQM 204

Query: 127 VCYPIGKI-LALLPQRDCA--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 182
              P GK     +P+      +    NLN   P++ KE    T+  A+   T Y    ++
Sbjct: 205 FLLPCGKFWEKYVPKVGFPIWKGKRINLNIDSPWSAKEQMFSTLLFAICMGTFYTHYNIL 264

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
               +YN  +  GY   L    Q +G+G AGL R++VV PA  IWP +L +++L  +L  
Sbjct: 265 TLKVYYNDDVDFGYQFWLSMGVQFMGFGFAGLLRKYVVYPARAIWPGSLQTLALNKALFK 324

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
              D+    G  ++   FF + ++  F + W+P +L   LS FN + W +    NF    
Sbjct: 325 ---DSGSKKGKGLASQTFFFLSVAFMFFYTWIPTYLMNFLSMFNWMTWIAP--DNFNLAM 379

Query: 303 IFGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNT 361
           + G  SG+G  PIS FD+  +          TP++      A               +N 
Sbjct: 380 VTGSVSGLGFNPISSFDWNVIDFL---GALTTPFFSYFTQLAG-GILSALIVIAIYWSNY 435

Query: 362 WYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXX 421
           +  +Y+P+ S + F NT +++ ++KILN ++ ++ +KY+ YSP +     +++Y      
Sbjct: 436 YDCQYLPIFSNSLFTNTGERFKITKILNSEWKLDPQKYQEYSPPYFSAGNIVTYGTFIAI 495

Query: 422 XXXXXXHCALYNGKDI-----------------KNKFRNKNHGG------QDIHMRLYTQ 458
                 + AL++  ++                 K+ +RN N          D H R+  Q
Sbjct: 496 YPLLIVY-ALFSETNVLFGAVKGWFSDIFSLFKKDTWRNWNAETNKLDEFDDAHSRMMKQ 554

Query: 459 NYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQ 518
            YK+ PDWWY V+ +V L +G   I  + ++ P WA  +++  +F+  IP   L++VT  
Sbjct: 555 -YKEVPDWWYFVIFLVSLIIGICFIERYHTNTPVWALLMSIGFNFVFLIPLTTLQSVTTF 613

Query: 519 HVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAI 578
            +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+  Y KVPP  +F  
Sbjct: 614 SLGLNVLIEMIVGYALPGNPQALMIIKAFGYNIDGQADNYVSNLKMGHYAKVPPVALFRG 673

Query: 579 QIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPG 638
           Q+    +   VN+G+  W  SNIK+ C  TQ   FTC +  T +N+S++W        P 
Sbjct: 674 QLIMVFVQIFVNLGVLNWSISNIKDFCMPTQSAKFTCPDATTYYNSSVMWGA----LGPK 729

Query: 639 RIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGP--NSIPP---- 688
           +I+N   PIM W +LIG  + L  F + R F       +++ PV  AG   N  PP    
Sbjct: 730 KIFNDVYPIMRWSWLIGACIGLF-FGVWRKFFRRYYPTWLN-PVLIAGGMLNVSPPYGLT 787

Query: 689 -STPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGK 747
              P   + FF+  Y   R  + W    SK+NYV+ AG   G+  + ++IF  VQY    
Sbjct: 788 YVIPGAIANFFSQFYYKRRHVRLW----SKFNYVLSAGFSAGLVFSSIVIFFAVQYKNYD 843

Query: 748 LNWWGNSV 755
           LNWWGN+V
Sbjct: 844 LNWWGNTV 851

>ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  286 bits (732), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 181/664 (27%), Positives = 324/664 (48%), Gaps = 26/664 (3%)

Query: 111 SLRYPSLSINFLVAQVVCYPIGKILA-LLP--QRDCARCPWFNLNPGPFTKKEHAVVTIA 167
           + R+PS+SI  +VAQ++ YP G I A ++P  +        F LNPG F+ +E A+V + 
Sbjct: 152 AFRFPSISIGPIVAQLISYPCGIIWARIMPNWKFSIGSKYTFELNPGNFSPQEQALVYLF 211

Query: 168 VALTSSTAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIW 227
                +T    N  + Q  F+ + +G G  +L      ++ +G AGL+   +V+    IW
Sbjct: 212 CNTVIATGLLRNTQVEQIKFFKVDVGIGRFILFDMVGYLIAWGMAGLSIPMLVDREELIW 271

Query: 228 PQTLISVSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNV 287
           P  L   +L ++LH+ T  +  ++ +K  ++ FF+I  +GSF+WYW    +F  ++    
Sbjct: 272 PSVLSPSALINALHSGTKGS--ISDFKKPKFSFFMIAFAGSFVWYWFSDLIFPFIASLGA 329

Query: 288 VLWGSKTRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXX 347
                + + N +   +FGV++G+G LPISFD+  +S     +   TP W      AS   
Sbjct: 330 FPSWIRPK-NKVLGQVFGVKNGLGLLPISFDWPTISNI--NNPLTTPVWAGVMIFASFFF 386

Query: 348 XXXXXXXXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFV 407
                       N W   ++P++S   FD   Q Y V  ++N  + ++L+KYK YSP+++
Sbjct: 387 WAWIVIPGLYYQNHWETAHLPLMSNKIFDKNGQSYQVKNVVNSKWELDLDKYKQYSPVYL 446

Query: 408 PFSYLLSYALNXXXXXXXXXHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWW 467
           P  +L+  AL                  D+ + F+         H    T +YK   + +
Sbjct: 447 PIGFLIQLALGLGGFSSMMIFFFWKFKSDVWDPFKQ--------HSTKKTAHYKSAYNKF 498

Query: 468 YLVL----QVVMLGLGFATICGF--DSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVG 521
           ++       V+ L LGF  +  +  D+ + +  F V+++I  + ++P  ++E+ ++  + 
Sbjct: 499 FVAAFIGSMVLGLALGFVFVEAWNRDTQIDSGGFIVSIIIGIVLYLPVALVESKSSFTLN 558

Query: 522 LNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIY 581
           +N    ++  +    KPMA + F  +G+ + +  +  ++  KL  YMK PPRL   +   
Sbjct: 559 MNGFFNVVGAFWYKGKPMATLYFLNFGYSIFQHAMHFTQGAKLGYYMKTPPRLTLFVLFV 618

Query: 582 ATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM-PQFLFSPGRI 640
           A + + LV   +  ++  ++  +C+S   +   C + +T FN  IIW +    LFS G  
Sbjct: 619 AGVWASLVTPSVTGYVLYHVGNVCTSNAHNNMVCRSQQTAFNTQIIWGLFGSHLFSTGGR 678

Query: 641 YNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAM 700
           Y  IM+FFL+G  V LIV  +Q     ++    +   +  +G   +P ST  +Y  +F  
Sbjct: 679 YQFIMYFFLVGAGVALIVILMQWWRPRSRVWSHVSPTLLLSGAEDMPTSTGLHYGTWFMS 738

Query: 701 SYVLN-RIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGK--LNWWGNSVYK 757
             V N  I ++ P W+ KYN ++ + ++ GVA+A +I++  V Y GG     WW   V  
Sbjct: 739 ILVFNFFIHRKRPQWWRKYNLILASALDCGVAIAAIIVYFAVTYTGGSSHYKWWATEVTS 798

Query: 758 NTYD 761
           ++ D
Sbjct: 799 SSCD 802

>YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON}
           OPT2Oligopeptide transporter; member of the OPT family,
           with potential orthologs in S. pombe and C. albicans;
           also plays a role in formation of mature vacuoles
          Length = 877

 Score =  285 bits (729), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 215/723 (29%), Positives = 343/723 (47%), Gaps = 53/723 (7%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRA V   DDPTI V  +R                   S R  S+S+N  + Q+
Sbjct: 143 HSPYQEVRAVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQM 202

Query: 127 VCYPIGKILA-LLPQRDCA-RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 183
             Y  GK  A  +P      R   + +N   P+T+KE    T+  A+     Y    ++ 
Sbjct: 203 FLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAICQGAFYTHYNILT 262

Query: 184 QTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNR 243
           Q  FY+     GY  LL  + Q +G+G AG+ R++VV PA  +WP  + ++++  +L  +
Sbjct: 263 QKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGK 322

Query: 244 TVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTI 303
               S      MSRY+FF +     FI+ W P ++   L+ FN + W   +  N +AN  
Sbjct: 323 EKHES-----GMSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANIT 376

Query: 304 FGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTW 362
            GV +G+G  PIS FD+  +S     S    P+W                      +N  
Sbjct: 377 GGV-TGLGINPISSFDWNVIS---FNSPLVYPFWSYLTQYLGCILAALIVIAVYY-SNYM 431

Query: 363 YAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXX 422
             +Y+P+ + + + NT   + V+++L+ D  ++++KY++YSP +     L+SY       
Sbjct: 432 SCQYLPIFTNSLYTNTGHSFKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAY 491

Query: 423 XXXXXHCALYNGKDIKNKFRN-------------------KNHGGQDIHMRLYT---QNY 460
                   + + K + N F++                    ++   D +   ++   +NY
Sbjct: 492 PLMITWSFIVHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKNY 551

Query: 461 KDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHV 520
           K+ PDWWY  + +  L +G A +  + ++ P W  FV L  +F+  IP  IL+A T    
Sbjct: 552 KEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPTTILQATTGYSF 611

Query: 521 GLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQI 580
           GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q 
Sbjct: 612 GLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQC 671

Query: 581 YATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRI 640
               I   VN+G+  W  SNIK+ C+  Q   FTC +  T +NAS++W        P RI
Sbjct: 672 VIVFIQIFVNLGVLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGA----IGPKRI 727

Query: 641 YN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYN--- 693
           +N   PI  W +LIG  + +     +R  K     ++    +F  G  ++ P  PYN   
Sbjct: 728 FNYIYPIFKWCWLIGACIGIFFGVWKRWGKFYP--RYFDPMLFVGGMLNMSP--PYNLMY 783

Query: 694 YSLFFAMSYVLNRIRKRWPL-WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWG 752
           Y+    +SY+     KR  L  + KYNYV+ AG  TG+ L+ +IIF  VQY     NWWG
Sbjct: 784 YTSGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWG 843

Query: 753 NSV 755
           N+V
Sbjct: 844 NTV 846

>Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {ON}
           YPR194C (REAL)
          Length = 877

 Score =  283 bits (725), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 213/722 (29%), Positives = 339/722 (46%), Gaps = 51/722 (7%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRA V   DDPTI V  +R                   S R  ++S+   + Q+
Sbjct: 143 HSPYQEVRAVVDPDDDPTIPVETFRAYFLAVIWSIIGSGFNEFFSHRVVTISLETPIIQM 202

Query: 127 VCYPIGKILA-LLPQRD-CARCPWFNLNPG-PFTKKEHAVVTIAVALTSSTAYAMNILIA 183
             Y  GK  A  +P      R   + +N   P+T+KE    T+  A+   T Y    ++ 
Sbjct: 203 FLYLCGKAWAKTVPCYGITVRGTKYGININRPWTQKEQMFATLLYAICQGTFYTHYNILT 262

Query: 184 QTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNR 243
           Q  FY+     GY  LL  + Q +G+G AG+ R++VV PA  +WP  + ++++  +L  +
Sbjct: 263 QKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGK 322

Query: 244 TVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTI 303
             + S      MSRY+FF +     FI+ W P ++   L+ FN + W   +  N +AN  
Sbjct: 323 EKNES-----GMSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANIT 376

Query: 304 FGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTW 362
            GV +G+G  PIS FD+  +S   S S    P+W                      +N  
Sbjct: 377 GGV-TGLGINPISSFDWNVIS---SNSPLVYPFWSYLTQYLG-SVLAALIVVAIYYSNYM 431

Query: 363 YAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXX 422
             +Y+P+ + + + NT   + V+ IL+    ++L+KY++YSP +     L++Y       
Sbjct: 432 NCQYLPMFTNSLYTNTGDSFKVTNILDSSNKLDLKKYQSYSPPYYSAGNLVTYGAFICAY 491

Query: 423 XXXXXHCALYNGKDIKNKFRN----------------------KNHGGQDIHMRLYTQNY 460
                   + + K + + F++                      K     D    +  +NY
Sbjct: 492 PLMIAWSFIVHSKILFSAFKDWALSLWALRKLKAWVIMYKSDYKALDDYDDPHSIAMRNY 551

Query: 461 KDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHV 520
           K+ P+WWY  + +  L +G A +  + ++ P W  FV+L  +F+  IP  IL+A T    
Sbjct: 552 KEVPEWWYFAILIASLIVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGFSF 611

Query: 521 GLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQI 580
           GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q 
Sbjct: 612 GLNLLIEMVMGYALPGNPVAIMILKAFGYNIDGQADSYVSNLKIAHYCKIPPMALFRGQC 671

Query: 581 YATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRI 640
              +I   VN+G+  W  SNIK  C+  Q   FTC +  T +NAS++W        P RI
Sbjct: 672 VIVLIQIFVNLGVLNWQISNIKNFCTPHQDAKFTCPDAVTYYNASVVWGA----IGPKRI 727

Query: 641 YNPI----MWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGP--NSIPPSTPYNY 694
           +N I     W +LIG  +  ++F + + +       F   P+ F G   N  PP     Y
Sbjct: 728 FNHIYPIFKWCWLIGACIG-VLFGVWKRWGRFYPRNF--DPMLFVGGMLNMSPPYNLMYY 784

Query: 695 SLFFAMSYVLNRIRKRWPL-WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGN 753
           +    +SY+     KR  L  + KYNYV+ AG  TG+ L+ +IIF  VQY     NWWGN
Sbjct: 785 TPGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYRDTSFNWWGN 844

Query: 754 SV 755
           +V
Sbjct: 845 TV 846

>ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 889

 Score =  281 bits (719), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 213/736 (28%), Positives = 346/736 (47%), Gaps = 59/736 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+  VRA V   DDP   +  +R                   + R  +++IN  + Q+
Sbjct: 151 HSPYRSVRACVDPRDDPDAPIETFRSYTLALIWAIIGSGFNEFFAHRLLTITINSAMVQM 210

Query: 127 VCYPIGKILA-LLPQRDCA--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 182
           + +P+G + A  +P       +    ++N P P+ +KE    TI  A+ S+T Y    ++
Sbjct: 211 LLFPMGNLWAKFMPYWSFPIWKGKRIHINYPQPWNQKEQMFSTILFAICSTTFYTHYNIL 270

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
            Q  +Y+  +  GY   L    Q LG G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 271 TQKMYYHEAVSFGYQFFLSIGVQYLGLGFAGSLRRFVIYPSKAIWPSQLQTMALNKALFS 330

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
           R  +    N   ++R  FF I     F + W+P +LF+ LS FN + W      NF    
Sbjct: 331 RREEK---NSKGLTRQTFFFICTGFIFFYQWIPTYLFQALSTFNWMTWIKPD--NFDLAM 385

Query: 303 IFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXX-XXXXXXTN 360
           + G   G+G  PI SFD+  ++         TP  + +  C  +              +N
Sbjct: 386 VTGSVGGVGFNPIASFDWNVINNYF---CLVTP--LFSYMCQMIGALIAAICVLAMYYSN 440

Query: 361 TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSP-------LFVPFSYLL 413
            +  +++P+ S   F NT   + ++ ILN  + V+++KY+ YSP       +F   +++ 
Sbjct: 441 QYDCQFLPMFSNALFTNTGDSFEINAILNKKYEVDVKKYQNYSPPYYSAGNIFCYGAFIA 500

Query: 414 SYALNXXXXXXXXXHC-------------ALYNGKDIKNKFRNKNHGGQ---DIHMRLYT 457
           SY L                         AL         +++  H  +   D H R+  
Sbjct: 501 SYPLLFAYYFISEWKIMYGAFKEWALAIWALTKKHTWLQAWKDDAHALEEFHDPHSRM-M 559

Query: 458 QNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTN 517
           + YK+ PDWWY ++ +  +G+G  TI G+ ++ P W+ F+++ ++    IP  ILEA + 
Sbjct: 560 RRYKEVPDWWYYMVLICAVGVGIGTIEGYHTNTPVWSLFMSIGLNAAFLIPITILEATSA 619

Query: 518 QHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFA 577
             +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LKL  Y K+PP+ +F 
Sbjct: 620 LQMGLNVLIEVIMGYALPGNPHALMIIKAFGYNIDGQADSFVGNLKLGHYAKIPPKALFR 679

Query: 578 IQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSP 637
            Q+   ++   V +G+  W  SNIK+ C   Q   FTC +  T +N+S++W        P
Sbjct: 680 GQMLMILVQTFVCLGVLNWSMSNIKDYCKPHQASKFTCPDAVTYYNSSVLWGA----IGP 735

Query: 638 GRIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGP-NSIPP---- 688
            RI+    PIM W +LIG A+  + F L ++        + +  +   G  N  PP    
Sbjct: 736 KRIFEGVYPIMKWCWLIG-ALIGVGFGLYKLLLPRFYPTWFNPVIVIGGMLNMAPPYNLT 794

Query: 689 -STPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGK 747
             TP   + FF+  Y + R R R  LW  KYNYV+ AG   G+ ++ +IIF  VQY    
Sbjct: 795 YMTPGAIANFFSQFY-MRRYRVR--LW-EKYNYVLSAGFSAGLVVSSIIIFFSVQYKNKP 850

Query: 748 LNWWGNSVYKNTYDHA 763
           +NWWGN V     D A
Sbjct: 851 INWWGNDVINAGLDAA 866

>Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON}
           (24582..27260) [2679 nt, 893 aa]
          Length = 892

 Score =  281 bits (719), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 217/725 (29%), Positives = 349/725 (48%), Gaps = 56/725 (7%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRA V  TDDPTI V  +R                   S R  ++SIN  V Q+
Sbjct: 157 HSPYKEVRAVVDPTDDPTIPVETFRSYLFALFWAIVGSGFNEFFSHRQVTISINTSVVQM 216

Query: 127 VCYPIGKILA-LLPQRDCA---RCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILI 182
             YP G + A  +P    +   R    N++  P+++KE    T+  ++ S T Y    ++
Sbjct: 217 FLYPSGLLWAKYVPCWGISIKGRKYAINIDK-PWSQKEQMFSTLLFSICSGTFYTHYNIL 275

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
            Q  +Y+  +  GY  LL  + Q LG+G AG+ R++VV P   +WP +  +++L  +L +
Sbjct: 276 TQKVYYHDNVSFGYQFLLSLSIQFLGFGFAGILRKFVVYPTKALWPTSFPTIALNKALLS 335

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
           R  + +  NG  M+RY+FF +     FI+ W P ++    + FN + W S   +NF    
Sbjct: 336 RKEENT--NG--MTRYKFFFLTFFAMFIYNWFPTYIINIFNTFNWMTWISP--NNFNLAM 389

Query: 303 IFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANS-CASVXXXXXXXXXXXXXTN 360
           I G  SGIG  PI SFD+   S     +    P++ +    C +V             TN
Sbjct: 390 ITGGVSGIGFNPIASFDWNVASYI---NPLRIPFFSNMTQYCGAVFAALVVIAVYW--TN 444

Query: 361 TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXX 420
               +Y+P+ S   + N   +Y V+++L+ D+ ++  KY+ YS  +     L++Y     
Sbjct: 445 YMDCQYLPLFSNTLYTNRATRYQVTEVLDSDWKLDNAKYQEYSAPYYSAGNLVAYGSFIA 504

Query: 421 XXXXXXXHCALYNGKDIKNKFRN---------KNHG--------------GQDIHMRLYT 457
                  +  L   K + +  +          K H                 D H R+  
Sbjct: 505 TYPMLIVYSMLTETKLLWSAMKQWTLSLWSLTKKHTWTNLLTQESCALDEFDDPHSRM-M 563

Query: 458 QNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTN 517
           +NYK+ PDWWY V+ +  +G+G A I  + ++ P W+ FV++  +    IP  +L+A   
Sbjct: 564 KNYKEVPDWWYFVVLLAAIGVGIAVIEAYHTNTPVWSLFVSIGFNVAFLIPLTMLQATAG 623

Query: 518 QHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFA 577
             +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +F 
Sbjct: 624 FSLGLNLLIEMIVGYALPGNPFALMIIKAFGYNIDGQADNYVSNLKMAHYTKIPPIALFR 683

Query: 578 IQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSP 637
            Q+    +   VN+G+  W  SNIK  C+  Q   FTC +  T +NAS++W        P
Sbjct: 684 GQMIMVFLQIFVNLGVLNWQISNIKGFCTHDQKAKFTCPDATTYYNASVVWGA----LGP 739

Query: 638 GRIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGP--NSIPPSTP 691
            +I+N   PI+ W +LIG  + L  F + + F       F   P+ F G   N  PP   
Sbjct: 740 KKIFNDVYPILRWCWLIGACIGLF-FGVWKRFGKFYPTWF--NPILFVGGMINMAPPYGL 796

Query: 692 YNYSLFFAMSYVLNRIRKRWPL-WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNW 750
             ++    +SY+     K++ L  + KYNY++ AG  +G+ L+ +IIF  VQY G   +W
Sbjct: 797 MYFTPGIIVSYLSQYHFKKYHLRLWEKYNYILDAGFTSGLVLSAIIIFFAVQYEGTNFSW 856

Query: 751 WGNSV 755
           WGN+V
Sbjct: 857 WGNNV 861

>KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 869

 Score =  280 bits (715), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 215/721 (29%), Positives = 344/721 (47%), Gaps = 51/721 (7%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+PEVR      DD TI +  +R                     R P +S+   V Q+
Sbjct: 135 HSPYPEVRTVTSPIDDETIPIETFRAYFLGFFWTILGAGVNEFFVHRKPKISLTAPVMQI 194

Query: 127 VCYPIGKILALLPQRDCARCPWF--NLNPGPFTKKEHAVVTIAVALTSSTAY-AMNILIA 183
           + YP GK+   +      +      N NPGP++ KE    TI   + +S  Y + NI + 
Sbjct: 195 LLYPCGKLFERVMPNHTFKLGKISVNFNPGPWSFKEQMFSTIIFNVATSYTYVSHNIYVQ 254

Query: 184 QTN-FYNMK-LGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLH 241
           +   FYN K L  GY VLL+  SQ+LG+G AG+ R++V+    CIWP    +++L  +L 
Sbjct: 255 RLEIFYNNKWLDFGYEVLLMLCSQLLGFGYAGILRKFVIYNEKCIWPTLFPTLALNGALL 314

Query: 242 NRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIAN 301
                 ++ NGW+M+RY+FF+      FI+ W+P +LF+GLS F+ + W S    NF   
Sbjct: 315 KPDSKENI-NGWRMTRYKFFLTFFVIMFIYNWIPTYLFEGLSTFSWLTWCSP--KNFDLA 371

Query: 302 TIFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTN 360
            + G + G+G  P+ +FD+  +    + ++   P++   N                    
Sbjct: 372 VVTGSQYGLGLNPVPTFDWNIIDYNYALTI---PFFSQLNQYIGTFIGFFAILGIYYSNY 428

Query: 361 TWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYA---- 416
            W A ++P+ S + F N  + Y V  IL+ +  +   KY+ YSP +     LL Y     
Sbjct: 429 KWTA-FLPLNSNDIFTNRGESYVVQDILDENSMLVESKYQEYSPPYYSAGNLLVYGGIFA 487

Query: 417 -------LNXXXXXXXXXHCALYNGKDIKNKFRNKN------HGGQDIHMRLYTQNYKDC 463
                              C     + IKN FRN +       G  D   RL  + YKD 
Sbjct: 488 QYPFAFLYVFFTEWASILQCFKQMYRQIKN-FRNVSIKSSTYDGFDDPQTRL-MKKYKDV 545

Query: 464 PDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLN 523
           PDWW+LV+ VV L LG   I  + +  P W  F  L I+F+  IP   + ++T  ++ + 
Sbjct: 546 PDWWFLVVLVVALVLGILCIKLYPTQTPVWGLFFILGINFVFLIPICFIFSMTGFNMTMG 605

Query: 524 IITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYAT 583
           +ITE+I GY LP   +A +  K  G+ +  Q      D KLA Y K+P R +F  Q+   
Sbjct: 606 VITEIIIGYALPGNGLALMTLKSLGYTIDNQAESYIADQKLAHYAKIPQRAVFKGQLVGV 665

Query: 584 IISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYN- 642
           +I   V++G+  W   N+K++C+S   + FTC      +++S+ W     +  P R++N 
Sbjct: 666 LIQCFVSLGVISWQIVNVKDICTSKAENKFTCPKEVNFYSSSVFWG----VIGPKRVFNG 721

Query: 643 --PIMWF-FLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYS---- 695
             PI+ + FLIG  + L+  A++  F   +  +  H  +   G        PYN S    
Sbjct: 722 LYPILKYTFLIGFLLCLLCCAIKYFFP--RQTRLFHPTILIGGMQQF---APYNLSYVTA 776

Query: 696 -LFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNS 754
            L+F+  ++   I++ +  W+ KYNYV+ A   + VA + +IIF  V+Y    ++WWGN+
Sbjct: 777 GLYFSFGFMF-YIKRYYTKWWEKYNYVLAAAFSSAVAFSAIIIFFSVKYKPKPIDWWGNN 835

Query: 755 V 755
           +
Sbjct: 836 I 836

>ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 922

 Score =  277 bits (709), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 213/734 (29%), Positives = 349/734 (47%), Gaps = 55/734 (7%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+  VRA V   DD    V  +R                   + R   ++I+  + Q+
Sbjct: 184 HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQL 243

Query: 127 VCYPIGKILA-LLPQRDCA--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 182
           + +P+G + A ++P       +    +LN P P+++KE    T+  ++  S+ Y  ++++
Sbjct: 244 LLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVIL 303

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
               FY  K+  GY        Q LG+G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 304 TLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFS 363

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
           +  +     G  ++   FF I ++ +F + W+P +LF+ LS FN + W      NF    
Sbjct: 364 KKTEKG---GRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTWIKP--DNFNLAM 418

Query: 303 IFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNT 361
           + G   G+G  PI SFD+  ++     S   TP +  AN  A               +N 
Sbjct: 419 VTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAG-GLIAAICVLAIYYSNQ 474

Query: 362 WYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSP-------LFVPFSYLLS 414
           +  +Y+P+ S   F NT  +Y+V+ I+N    V++ KY+ YSP       LF    ++ S
Sbjct: 475 FDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIAS 534

Query: 415 YALNXXXXXXXXXHCALYNGKDIKN-------------KFRNKNHGGQ---DIHMRLYTQ 458
           Y L             L   KD  +              +R  +H  +   D H R+  +
Sbjct: 535 YPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRM-MR 593

Query: 459 NYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQ 518
            Y + PDWWY ++ ++ + +G A + G+ ++ P W+ F+A+ ++ +  IP  ILEA T  
Sbjct: 594 RYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTAL 653

Query: 519 HVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAI 578
            +GLN++ E+I GY LP  P A +L K +G+ +  Q      +LKL  Y K+PP  +F  
Sbjct: 654 QLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRG 713

Query: 579 QIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPG 638
           Q++  +I  LV++G+  W  SNIK+ C   Q   FTC +  T +NAS++W        P 
Sbjct: 714 QMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGA----IGPK 769

Query: 639 RIYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPP-----S 689
           RI+    PI+ W +LIG  + + +   + +      + F    V     N  PP      
Sbjct: 770 RIFEGVYPILKWCWLIGAIIGIGLGLWKLLIPRFYPLWFNPLLVVGGMLNMAPPYNLTYM 829

Query: 690 TPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLN 749
           TP   + FF+  Y+     + W     KYNYV+ AG +TG+ ++ +IIF  VQY    ++
Sbjct: 830 TPGAIANFFSQFYMRKYHLRIW----QKYNYVLVAGFQTGLVISSIIIFFSVQYKEKPIS 885

Query: 750 WWGNSVYKNTYDHA 763
           WWGN V  N  D A
Sbjct: 886 WWGNDVINNGLDAA 899

>Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {ON}
            YPR194C (REAL)
          Length = 877

 Score =  275 bits (704), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 215/729 (29%), Positives = 338/729 (46%), Gaps = 65/729 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVRA V  +DDPT+ V  +R                   S R  ++++   V Q+
Sbjct: 143 HSPYQEVRAVVDPSDDPTVPVETFRAYFLAIVWSIVGSGFNEFFSHRVVTITLGTPVIQM 202

Query: 127 VCYPIGKILALLPQRDCARCPWF---------NLNPGPFTKKEHAVVTIAVALTSSTAYA 177
             Y  GK  A         C  F         N+N  P+T+KE    T+   +     Y 
Sbjct: 203 FLYICGKAWA-----KTVPCWGFTVKGTKYGININT-PWTQKEQMFATLLYGICQGAFYT 256

Query: 178 MNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLF 237
              ++ Q  FY+     GY  LL    Q +G+G AG+ RR+VV P+  +WP  + ++++ 
Sbjct: 257 HYNILTQKIFYHSSFSFGYQFLLSLAVQFIGFGFAGILRRFVVYPSRALWPTVMPTIAIN 316

Query: 238 DSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHN 297
            +L  +    S      MSRY FF +     FI+ W P ++   L+ FN + W   +  N
Sbjct: 317 KALLGKEKYES-----GMSRYNFFFLTFFIMFIYNWFPTYILNILNTFNWMTWIKPSNIN 371

Query: 298 FIANTIFGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXX 356
            +AN I G  +GIG  PIS FD+  +S     S    P+W                    
Sbjct: 372 -LAN-ITGSVTGIGINPISSFDWNVLS---FNSPLVFPFWSYLTQYLG-SILAALIVVAV 425

Query: 357 XXTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYA 416
             +N    +++P+ + + + NT + + V+KIL+ +  ++L+KY++YSP F     L+SY 
Sbjct: 426 YYSNYMNCQFLPMFTNSLYTNTGESFKVTKILDSENKLDLKKYQSYSPPFYTAGNLVSYG 485

Query: 417 LNXXXXXXXXXHCALYNGKDIKNKFRN-------------------KNHGGQDIHMRLYT 457
                         + + K + N F++                     +   D     ++
Sbjct: 486 SFICAYPLMITWSFIVHSKLLLNAFKDWALNLWSLRKPKSWTAMFKSEYAALDEFDDPHS 545

Query: 458 ---QNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEA 514
              ++YK+ PDWWY  + +  L +G A +  + ++ P W  FV+L  +F+  IP  IL+A
Sbjct: 546 NAMKSYKEVPDWWYFAILLASLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQA 605

Query: 515 VTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRL 574
            T    GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  
Sbjct: 606 TTGFSFGLNLLIEMVMGYALPGNPVAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMA 665

Query: 575 IFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFL 634
           +F  Q    +I   VN+G+  W  SNIK+ C+  Q   FTC +  T +NAS++W      
Sbjct: 666 VFRGQCVIVLIQIFVNLGVLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGA---- 721

Query: 635 FSPGRIYNPI----MWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPST 690
             P RI+N I     W +LIG  +  IVF + + +       F   P+ F G   I    
Sbjct: 722 IGPKRIFNHIYPIFKWCWLIGACIG-IVFGVWKRWGRFYPRDF--DPMLFVG-GMINMGP 777

Query: 691 PYNYSLF---FAMSYVLNRIRKRWPL-WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGG 746
           PYN   F     +S++     KR  L  + KYNYV+ AG  TG+ L+ +IIF  VQY   
Sbjct: 778 PYNLMYFTPGMIVSFISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDT 837

Query: 747 KLNWWGNSV 755
             NWWGN+V
Sbjct: 838 AFNWWGNTV 846

>Smik_16.458 Chr16
           complement(787205..789133,789181..789306,789322..789348,
           789352..789837) [2568 bp, 855 aa] {ON} YPR194C (REAL)
          Length = 855

 Score =  266 bits (680), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 193/637 (30%), Positives = 309/637 (48%), Gaps = 52/637 (8%)

Query: 151 LNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYG 210
           L P   T+K+    T+  A+     Y    ++ Q  FY+     GY  LL  + Q +G+G
Sbjct: 208 LCPTGLTQKKQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFG 267

Query: 211 AAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFI 270
            AG+ R++VV PA  +WP  + ++++  +L  +    S      MSRY+FF +     F+
Sbjct: 268 FAGILRKFVVYPARALWPTVMPTIAINKALLGKEEHES-----GMSRYKFFFLTFFVMFV 322

Query: 271 WYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVESGIGALPIS-FDYTQVSQAMSGS 329
           + W P F+   L+ FN + W   T  N +AN   GV +G+G  PIS FD+  +S     S
Sbjct: 323 YNWFPTFIINILNTFNWMTWIKPTSIN-LANITGGV-TGLGINPISSFDWNVIS---FNS 377

Query: 330 VFATPYWVSANSCASVXXXXXXXXXXXXXTNTWYAKYMPVISGNTFDNTQQKYNVSKILN 389
               P+W                      +N    +Y+P+ + + + NT   + V+KIL+
Sbjct: 378 PLVYPFWSYLTQYLGCILAALIVIAVYY-SNYMICQYLPIFTNSLYTNTGNSFKVTKILD 436

Query: 390 PDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXXXXXXXHCALYNGKDIKNKFRN------ 443
            D  ++++KY++YSP +     L++Y               + + K + N F++      
Sbjct: 437 SDNKLDVKKYQSYSPPYYTAGNLVTYGAFICAYPLMITWSFIVHSKLLFNAFKDWTLNLW 496

Query: 444 ------------KNH-----GGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGF 486
                       KN+        D H     +NY++ PDWWY  + +  L +G A +  +
Sbjct: 497 ALRKLTTWAIMFKNNYRLLDDYDDPHSNA-MKNYREVPDWWYFAILIASLIVGIAVVEHY 555

Query: 487 DSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKL 546
            ++ P W  FV+L  +F+  IP  IL+A T    GLN++ E++ GY LP  P+A ++ K 
Sbjct: 556 PTNTPVWGLFVSLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGYALPGNPVAIMILKA 615

Query: 547 YGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCS 606
           +G+ +  Q      +LK+A Y K+PP  +F  Q    +I   VN+G+  W  SNIK+ C+
Sbjct: 616 FGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCIIVLIQIFVNLGVLNWQISNIKDFCT 675

Query: 607 STQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYN---PIM-WFFLIGLAVPLIVFALQ 662
             Q   FTC +  T +NAS++W        P RI+N   PI+ W +LIG  + ++    +
Sbjct: 676 PHQNAKFTCPDAVTYYNASVVWGA----IGPKRIFNYIYPIIKWCWLIGACIGILFGVWK 731

Query: 663 RVFKHNQAIKFMHAPVFFAGPNSIPPSTPYN---YSLFFAMSYVLNRIRKRWPL-WFSKY 718
           R  K     K+    +F  G  ++ P  PYN   Y+    +SY+     KR  L  + KY
Sbjct: 732 RWGKFYP--KYFDPMLFVGGMLNMSP--PYNLMYYTSGMIVSYISQYYMKRHHLNLWEKY 787

Query: 719 NYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSV 755
           NYV+ AG  TG+ L+ +IIF  VQY     NWWGN+V
Sbjct: 788 NYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTV 824

>Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {ON}
           similar to Ashbya gossypii ADL399C /ACL205C /AGL027W
          Length = 867

 Score =  265 bits (678), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 214/741 (28%), Positives = 348/741 (46%), Gaps = 61/741 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+ EVR+ V  TDDP+I +  +R                     R   +SI     Q+
Sbjct: 133 HSPYTEVRSMVSPTDDPSIPIETFRAYFIATFWSVVGSGFNEFFRHRQVPISIETAAVQL 192

Query: 127 VCYPIGKILA-LLPQRD-CARCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 183
           +  PIGK+ A  +P      R   F +N P P+++KE    T+  ++T  + Y+   ++ 
Sbjct: 193 LICPIGKLWANKVPLWGFTVRGRRFAINVPEPWSEKEQMFATLLYSITLGSFYSSFNILT 252

Query: 184 QTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNR 243
              +YN  +   + +LL  + Q +G+G AG+ RR+VV PA  +WP  L S+++  +L +R
Sbjct: 253 MKKYYNDDVSYLFQLLLSISLQFMGFGFAGVLRRFVVYPAKAVWPSCLPSIAVNKALLSR 312

Query: 244 TVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTI 303
              +       +S   FF I L   F + W+P  L   L+ FN + W +    N  A T 
Sbjct: 313 KDKSG-----GLSIQNFFYISLGVLFAYNWIPTVLAGFLANFNWMTWLAPNNFNLAAIT- 366

Query: 304 FGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTW 362
            G  +G+   P+ SFD   ++     +   TP++  ++                  +N  
Sbjct: 367 -GGSTGLAYNPLPSFDLNAIAYF---TPLVTPFFAYSHIYIGAVIASLVVIALYY-SNYM 421

Query: 363 YAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXX 422
            ++Y+PV S + + N   KYN+S+IL  D+ V+  KY+ YSP +     L+SY       
Sbjct: 422 ESQYLPVFSQSLYTNKATKYNISEIL-VDYKVDEAKYQTYSPPYYSAGVLVSYGSFLCFY 480

Query: 423 XXXXXHCALYNGKDIKNKFRN-------KNHGG----------------QDIHMRLYTQN 459
                   +   + +   FR+         H                   D H RL  +N
Sbjct: 481 TMVFGFAIIDEFRVLYEAFRDWFFALLSLRHKKSWIDMWASDYHVLSEFDDAHSRL-MRN 539

Query: 460 YKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQH 519
           YK+ PDWW+ V+ VV +      I  F+S  P W  F+++ ++F+  IP   L A T   
Sbjct: 540 YKEVPDWWFFVVLVVAIAFAIIVIECFNSQTPLWLLFLSIGLNFIFLIPLTTLHARTTFT 599

Query: 520 VGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQ 579
            GLN++ E+I GY+LP  P A +L K +G+ +  Q      ++K+A Y K+ P  +F  Q
Sbjct: 600 AGLNLLVEMIVGYILPGNPYALMLIKAFGYNIDGQADNYISNMKVAHYCKISPVALFRGQ 659

Query: 580 IYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFSP 637
           +    I   VN+ +  W  SNI   C   QP  F+C + RT +NAS++W    PQ +F+ 
Sbjct: 660 LVMVFIQIFVNLFVVNWQFSNISGFCDEHQPAKFSCPDIRTYYNASVMWGAMGPQKIFT- 718

Query: 638 GRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVF-FAGPNSIPPSTPYNYSL 696
            ++Y  + W + IG AV  +  AL +  K+ +       P+    G  S  P  PYN  +
Sbjct: 719 -KVYPQLKWCWAIG-AVIGVGCALWK--KYGKFYPRSFNPILIIIGMLSFSP--PYN-MV 771

Query: 697 FFAMSYVLNRI------RKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNW 750
           +F   +++N I      R R  +W  KYNYV+   ++ G+  + ++IF  +QY   +LNW
Sbjct: 772 YFTPGFIVNFISQFYMKRYRLRIW-EKYNYVLEGALKCGLVFSSLVIFAAIQYNDYQLNW 830

Query: 751 WGNSVYKNTYDHAYRKYYVLK 771
           WGNSV + +    Y + Y+ K
Sbjct: 831 WGNSVPETS---VYERTYISK 848

>ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 885

 Score =  258 bits (659), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 199/739 (26%), Positives = 339/739 (45%), Gaps = 68/739 (9%)

Query: 68  SPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVV 127
           SP+ EVRA     DDPTI V  +R                   + R P++S+     Q++
Sbjct: 148 SPYVEVRAVASPVDDPTIPVETFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQML 207

Query: 128 CYPIG----KILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIA 183
            YP      +++     +   R    N+    +++KE   VT+  ++T+   Y+   ++ 
Sbjct: 208 VYPCAVLWVRVMPCWGFKVFGRRIALNIE-SQWSEKEQMFVTLLYSITNGAFYSEYNIVT 266

Query: 184 QTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNR 243
           Q   Y   +   Y  LL ++ Q LG+G AG+ RR+VV P+  +WP ++ +++L  +L   
Sbjct: 267 QQIHYKSPMSYAYQFLLSFSLQFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKAL--- 323

Query: 244 TVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTI 303
            + +   NG  + R + F I  +  F++ W P +LF+ LS FN + W      NF   T+
Sbjct: 324 -LSSDHSNG--IGRKKMFYITATAIFVYNWFPTYLFEALSTFNWMTWIKP--DNFSLATV 378

Query: 304 FGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNTW 362
            G  +G+G  PIS FD+T +      S    P+ V+  +                  N  
Sbjct: 379 TGGINGVGLNPISTFDWTNIGT----SSLYLPFRVTLTTYLG-GLLAALVTLGVYYMNYR 433

Query: 363 YAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNXXXX 422
             +++P+ + + ++N    Y V +IL  D  ++ +K++ Y   +     +++Y       
Sbjct: 434 ECQFLPIFTQSLYNNRATSYRVEEILTEDRKLDEQKFQKYGFPYYTAGNIVAYGCFMCVY 493

Query: 423 XXXXXHCALYNGK-----------DI---------KNKFRNKNH---GGQDIHMRLYTQN 459
                   L  G            D+         +  F N  H      D H R+  + 
Sbjct: 494 TALVVTSILQQGAFYGRVYKTWILDLWSLRKPSSWRAVFSNDKHVLDDFHDSHSRM-MRK 552

Query: 460 YKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQH 519
           YK+ P+WWY+ + +V + +G   +  F ++ P W  F+A+ ++F+  +P  +L+A     
Sbjct: 553 YKEVPEWWYMTIFIVSIVIGIIVVKVFKTNTPVWGLFLAVALNFVLLLPITLLQATRGVT 612

Query: 520 VGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQ 579
           +GLN++ ++I G  LP  P A +  K +G+ +  Q      ++KLA Y K+PP  +F  Q
Sbjct: 613 IGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQADNYLGNMKLAHYAKIPPVPLFRGQ 672

Query: 580 IYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGR 639
           +   +I   VN+G+  W   NI+  C   Q   FTC   RT FNAS++W        P R
Sbjct: 673 LLMVLIQIFVNLGVINWQLHNIENYCDPKQRFKFTCPGIRTYFNASVMWGA----IGPKR 728

Query: 640 IYN---PIM-WFFLIGLAVPLIVFALQRVFKHNQAIKF--MHAPV-FFAGPNSIPPSTPY 692
           I+    PIM W +LIG  V L     +++    + I +    +PV F  G  S  P  PY
Sbjct: 729 IFEHVYPIMKWCWLIGACVGLFFGLWKKLSIMYKKIPYPDRFSPVIFIIGMLSFGP--PY 786

Query: 693 N--------YSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYP 744
           N        Y  F +M Y+     + W     +YNYV+ AG+  G+  + +++F  VQ+ 
Sbjct: 787 NLQYTTSGLYVGFISMCYMKRYHLRVW----ERYNYVVAAGISCGLVFSAIVMFFTVQWK 842

Query: 745 GGKLNWWGNSVYKNTYDHA 763
           G +++WWGN+V     D+A
Sbjct: 843 GVEISWWGNTVSYAGLDYA 861

>ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 890

 Score =  256 bits (655), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 205/742 (27%), Positives = 341/742 (45%), Gaps = 74/742 (9%)

Query: 68  SPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVV 127
           SP+ EVRA     DDPTI V  +R                   S R PS++++    Q++
Sbjct: 141 SPYVEVRAVASPVDDPTIPVETFRAYFLATFWVVVGSALTMFFSERQPSIALSISAVQML 200

Query: 128 CYPIGKILA-LLPQRDCARCPWFN-------LN-PGPFTKKEHAVVTIAVALTSSTAYAM 178
            YP G + A L+P      C  FN       LN   P+T+KE   VT+   +T+ + YA 
Sbjct: 201 VYPCGLLWARLMP------CWGFNVYGRRIALNIDSPWTEKEQMFVTLLYGITTGSFYAN 254

Query: 179 NILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFD 238
             ++ Q   Y   +   Y +LL    Q LG+G AG+ R++VV PA  +WP  + +++L  
Sbjct: 255 YNILTQHIHYRSPMPYAYQLLLSIPLQFLGFGLAGIMRKYVVYPATAMWPSIMTTIAL-- 312

Query: 239 SLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNF 298
              N+ + +   +G    R + F +  +  F++ W P +LF+ LS FN + W      NF
Sbjct: 313 ---NKAMMSDEHSG-GFGRKKMFYLTFAIIFVYNWFPTYLFEALSTFNWITWIKP--DNF 366

Query: 299 IANTIFGVESGIGALPIS-FDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXX 357
              T+ G  +G+G  P+S  D+T +   + G  F  P+ V+                   
Sbjct: 367 NLATVTGGINGVGLNPLSTLDWTNI--GVGG--FYLPFRVTLTMYMG-GLLAALITLGVY 421

Query: 358 XTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYAL 417
             N    +++P+ + + ++N  + Y V +IL  D  ++ +K++ Y   +     +++Y  
Sbjct: 422 YMNYSECQFLPIFTQSLYNNKAKVYQVEEILTEDRLLDEQKFQKYGFPYYTAGNMVAYGC 481

Query: 418 NXXXXXXXXXHCALYNG--------------------KDIKNKFRNKNH---GGQDIHMR 454
                        L  G                      ++  F N+ H      D H R
Sbjct: 482 FMCVYTALVVSSILQQGAFYMRVYKAWILDLWSLRTRSGLREAFSNEKHVLDEFHDPHCR 541

Query: 455 LYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEA 514
           +  + YK+ P+WWY+ + VV + +G   +  F ++ P W  F+A+ ++F+  +P  +L+A
Sbjct: 542 M-MRKYKEVPEWWYMSIFVVSIVIGVIVVTTFKTNTPVWGLFLAVGLNFILLLPITLLQA 600

Query: 515 VTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRL 574
                +GLN++ ++I G  LP  P A +  K +G+ +  Q      ++K+A Y K+PP  
Sbjct: 601 TRGVTIGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQTDNYLSNMKMAHYAKIPPIP 660

Query: 575 IFAIQIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFL 634
           +F  Q+   +I   VN+G+  W   N++  C   Q   FTC   RT FNAS++W      
Sbjct: 661 LFRGQLLMVLIQVFVNLGVINWQLHNVENYCDPKQRFKFTCPGVRTYFNASVMWGA---- 716

Query: 635 FSPGRIYN---PIM-WFFLIGLAVPLIVFALQRVF---------KHNQAIKFMHAPVFFA 681
             P RI+    PIM W +LIG  V L     +R+          +    + F+   + F 
Sbjct: 717 IGPRRIFEHVYPIMKWCWLIGACVGLFFGIWKRLSIMYDKIPYPRRFSPVIFIIGMLSFG 776

Query: 682 GPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCV 741
            P ++  ST   Y  F +M Y L R   R  +W  +YNYV+ A +  GV  + +++F  V
Sbjct: 777 PPYNLQYSTSGLYVGFISMFY-LKRYHLR--IW-ERYNYVIAAAITCGVVFSAILMFFSV 832

Query: 742 QYPGGKLNWWGNSVYKNTYDHA 763
           Q+   +LNWWGNS+     D+A
Sbjct: 833 QWKDIELNWWGNSISYAGLDYA 854

>AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPR194C (OPT2)
          Length = 877

 Score =  236 bits (603), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 196/730 (26%), Positives = 331/730 (45%), Gaps = 65/730 (8%)

Query: 67  NSPFPEVRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQV 126
           +SP+PEVRA V   DDPTI V  +R                     RYP +  + + AQ 
Sbjct: 141 HSPYPEVRAVVGPGDDPTIPVETFRCYFLTTTITIIGCGLTTFFQSRYPLIEFSSMAAQF 200

Query: 127 VCYPIGKILA-LLPQRDCARCPW--FNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 182
           + + +G + +  +P       P   F LN    ++KKE    T+  ++T+   Y+   ++
Sbjct: 201 LFFILGTLWSKFMPAVRIPIFPGYGFQLNLQTSWSKKEQMFATLLYSITTGVFYSYFNIL 260

Query: 183 AQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHN 242
            Q  FYN     G+ ++L  + Q +G+G AGL R +VV PA  +WP ++ +++L    +N
Sbjct: 261 TQDMFYNDPTSLGFQIILSLSLQFMGFGLAGLLRPFVVFPARALWPLSMPTIAL----NN 316

Query: 243 RTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANT 302
             +   V  G  + +  F+  +  G FI+ W P      LS  N + W      N  A T
Sbjct: 317 ALLAQDVGKGTSIRKVFFYFGI--GMFIYNWFPTVFADVLSNLNWLTWIKPNNFNLAAIT 374

Query: 303 IFGVESGIGALPI-SFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTNT 361
             G   GI   P+ + D+  ++       F T +     S  SV             TN 
Sbjct: 375 --GGRYGIATNPLPTLDWNYITHWALALPFYTVFLQYLGSLLSVVIIIAVYY-----TNY 427

Query: 362 WYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYS------------------ 403
              +Y+P+     + N  + ++ SK+L  DF ++ +KY+ YS                  
Sbjct: 428 MECQYLPIFGQPLYSNEGKFFDASKVLT-DFKLDWQKYQQYSLPYYSAGNIVGYGSFISL 486

Query: 404 -PLFVPFSYLLSYA-LNXXXXXXXXXHCALYNGKDIKNKFRNKN---HGGQDIHMRLYTQ 458
             L   +S +  Y  L            +L      +N  +N +    G  D H R   +
Sbjct: 487 YTLLAAYSIITEYEILGGACKRLGVGLWSLTKLDTWRNLHKNDSSILEGYDDAHCR-EMR 545

Query: 459 NYKDCPDWWYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQ 518
            Y + P+WW+  + ++ L L    +  + ++ P W  F+A+ ++    +P   L++ T  
Sbjct: 546 KYPEVPEWWFFAIFLISLVLAIILVTTYKTNTPVWGIFLAVGLNVAFLLPLTTLQSTTGA 605

Query: 519 HVGLNIITELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAI 578
            +GLN++ ++I GY+LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +F  
Sbjct: 606 SLGLNLLVQMITGYLLPGNPYALMIIKAFGYNIDGQADNYLSNLKMAHYCKIPPVPLFRG 665

Query: 579 QIYATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PQFLFS 636
           Q+   ++  +V++ +  W   N+ + C+     GF C   RT +NASI+W +  P+ +FS
Sbjct: 666 QLSMVLLQVIVSLAVINWQIHNVPDFCNPKNRSGFICQGPRTYYNASIVWGIIGPKKVFS 725

Query: 637 PGRIYNPIMWFFLIGLAVPLIVFA----LQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPY 692
              +Y  + W +LIG A+  ++F     L R +K      F +  VF  G  S+ P  PY
Sbjct: 726 --YLYPMMKWCWLIG-ALLGVLFGGWCRLSRKYKLYYPRSF-NPVVFVTGMISLMP--PY 779

Query: 693 NYSLFFAMSYV-------LNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPG 745
           N  ++ +  YV       L R   R  +W  KYNYV+ A    GV  + + IF  +QYP 
Sbjct: 780 NLRVYTSKLYVAFIGQYWLRRYHLR--IW-EKYNYVVAAAFNCGVIFSAITIFFAIQYPE 836

Query: 746 GKLNWWGNSV 755
            +L+W  N++
Sbjct: 837 IRLDWILNTI 846

>ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]
           {ON} weakly similar to uniprot|Q06593 Saccharomyces
           cerevisiae YPR194C OPT2 Oligopeptide transporter member
           of the OPT family
          Length = 776

 Score =  159 bits (403), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 174/724 (24%), Positives = 307/724 (42%), Gaps = 63/724 (8%)

Query: 73  VRATVPATDDPTIVVNHWRXXXXXXXXXXXXXXXXXXXSLRYPSLSINFLVAQVVCYPIG 132
           V+  V   DDP      +R                   S R  S + +    Q+  Y +G
Sbjct: 61  VKGVVTLEDDPQEPCFTFRMVILSIIFILPGAFLDTMNSYRTTSAAYSIFFVQICSYWVG 120

Query: 133 KILA-LLPQRDCARCPW-FNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNM 190
           K LA +LP +      + F+LNPGP++ KE+ ++T+A A  ++       +     +Y  
Sbjct: 121 KWLAKILPSKQIGIGKYKFSLNPGPWSIKENVLITLAAASGATGNQGTTPVSLAEVYYKT 180

Query: 191 KLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDASVV 250
           K+     +  +W     GY  + + R +++     +WP+ L+  +LF+S+      A + 
Sbjct: 181 KVNPAVAIFFMWCINFSGYAMSYIARNFLIYDPQFVWPRALMQTNLFNSMKK----ADLP 236

Query: 251 NGWKMS--RYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVES 308
           N  + S  + + F +++ G  +W + P ++F  LS  + + W +   +N+ AN I G   
Sbjct: 237 NHQRQSSRKMKVFFMLIIGMTVWEFFPEYVFPMLSSLSFLCWVAP--NNYTANFIGGGMG 294

Query: 309 GIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVXXXXXXXXXXXXXTN-TWYAKYM 367
           G+G L  S D+  ++     SV  +PYW +    A+               N + Y K  
Sbjct: 295 GMGFLNHSLDWANIT----SSVMLSPYWTTCVQFAAFFFSCWVLIPAAKWGNMSSYKK-- 348

Query: 368 PVISGNTFDNTQQKYNVSKIL--------NPDFSVNLEKYKAYSPLFVPFSYLLSYALNX 419
            ++S          Y  S ++        N   S N + Y+ + P+++      +   + 
Sbjct: 349 GLMSNKLLTRNGTVYPSSSLIIYDEGASKNGKVSFNEKAYQLHGPIYIGAQKAWNMFFDY 408

Query: 420 XXXXXXXXHCALYNGKDIKNKFR--------NKN-HGGQDIHMRLYTQNYKDCPDWWYLV 470
                      L+  KDI   F+        NKN +   +  +     NY++ P WW+ +
Sbjct: 409 AAFTSAISWMLLFGRKDIAKNFKKLKQRLFHNKNINLLYNDRLNKIQSNYEEVPVWWFAL 468

Query: 471 LQVVMLGLGFATICGFDS-HLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELI 529
           L ++ L + F TI   ++  +P W +FVA+ +SF+  IP   L A++N  + +    EL+
Sbjct: 469 LFLITLVV-FVTIFATNTMFIPWWTYFVAVGVSFIIIIPLAYLYAISNFQLAIGTFDELL 527

Query: 530 CGYML------PFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYAT 583
            G M+           A+    L G +  R    L +D K+  YM +PP+ +F  Q+   
Sbjct: 528 YGVMVQNLSTHKHPASASTYGALSGDLWYRAQYML-QDQKIGHYMHIPPKAVFLSQVLGQ 586

Query: 584 IISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTI--FNASIIWSM---PQFLFSPG 638
           +I   +N G   W+     +    T  D      G+++  +N + +  +   P   FS G
Sbjct: 587 LIGVPMNYGTVRWVLDTKMDYLRGTAKDPLHQWTGQSLTSYNTNAVLYVLLGPTRFFSSG 646

Query: 639 RIYNPIMWF-FLIGLAVPLIVFALQRVFKHNQ-----AIKFMHAPVFFAGPNSIPPSTPY 692
             +N I+ F  L+G   P +++AL ++F   +        F      F G  S   +T +
Sbjct: 647 --HNKIIPFGLLVGFFAPFLIYALYKLFPRRKFNLWNVTIFCSTMSTFYGNLSTGYATQF 704

Query: 693 NYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCV--QYPGGKLNW 750
                F+M Y+ N   K W      YNY+  A  +TG  LAV++IF+      P    NW
Sbjct: 705 VVGT-FSMYYLYNHKPKFW----RNYNYLTAAAFDTGYNLAVLLIFIIFSSHKPIKMPNW 759

Query: 751 WGNS 754
           WGN+
Sbjct: 760 WGNN 763

>ZYRO0C14630g Chr3 (1139589..1141742) [2154 bp, 717 aa] {ON} similar
           to uniprot|P53134 Saccharomyces cerevisiae YGL114W
           Putative member of the oligopeptide transporter (OPT)
           family of membrane transporters
          Length = 717

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query: 494 AFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYGFIVMR 553
           A F+AL +S L     G  E   N   G+  I++LI   ++P      VL  L    V  
Sbjct: 472 ALFIALFLSILGIRALG--ETDLNPVSGIGKISQLIFALVVPRDRKGAVLLNLVAGGVAE 529

Query: 554 QGL----ELSRDLKLALYMKVPPRLIFAIQIYATI 584
            G     +L +DLK    +   PR  F  QI   I
Sbjct: 530 SGAQQAGDLMQDLKTGHLLGASPRAQFIAQIVGAI 564

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 14/100 (14%)

Query: 582 ATIISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFN--ASIIWSMPQFLFSP-- 637
           A  I G+   GI         ++C++ +         R IF   A+I++ M Q L +P  
Sbjct: 137 ARAICGMGAGGINAMSSITTSDICTTRE---------RGIFQGYANIVFGMGQVLGAPLG 187

Query: 638 GRIYNPIMWFFLIGLAVPLIVFALQRVFKHNQAIKFMHAP 677
           G   + I W  L G+ VP+I+F    +   N  IK +H P
Sbjct: 188 GLFLDHIGWRTLFGIQVPMIMFC-SYLTITNVNIKLLHVP 226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,803,637
Number of extensions: 3228622
Number of successful extensions: 9084
Number of sequences better than 10.0: 40
Number of HSP's gapped: 8997
Number of HSP's successfully gapped: 46
Length of query: 782
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 664
Effective length of database: 39,950,811
Effective search space: 26527338504
Effective search space used: 26527338504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)