Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_23.6547na 1ON51151125020.0
YOR378Wna 1ON51550318450.0
Smik_15.560na 1ON51650318230.0
Suva_8.435na 1ON51550318180.0
KLTH0C10560gna 1ON51550918130.0
Skud_15.545na 1ON51649417950.0
KLLA0B00352gna 1ON49849216150.0
TDEL0B005508.843ON5374818281e-104
NDAI0E002808.843ON5495168221e-103
SAKL0D01386g8.843ON5214768041e-100
Kpol_541.168.843ON5285057991e-100
Skud_13.258.843ON5375227902e-98
CAGL0L02519gna 1ON5294827875e-98
YML116W (ATR1)8.843ON5425057876e-98
KNAG0D00130na 1ON5654627826e-97
NCAS0B002908.843ON5425117782e-96
Smik_13.188.843ON5455097747e-96
Skud_13.4518.843ON5394817729e-96
NCAS0C004008.843ON5174847664e-95
KAFR0C04860na 1ON5345117642e-94
Suva_13.278.843ON5535087617e-94
TBLA0D032708.843ON5505027563e-93
CAGL0B02343g8.843ON5374657536e-93
TPHA0C047908.843ON5564827548e-93
KNAG0J002608.843ON5504657538e-93
Suva_13.4678.843ON5435207521e-92
KNAG0G034308.843ON5424847502e-92
KLTH0C03806g8.843ON5255057474e-92
YMR279C8.843ON5405307484e-92
NDAI0K004008.843ON5535037461e-91
NCAS0A02540singletonON5395157442e-91
Kwal_27.102458.843ON5155067403e-91
KAFR0B03930singletonON5554447382e-90
TBLA0D03280singletonON5805027332e-89
Smik_13.4928.843ON5435227266e-89
CAGL0M03003g8.843ON5584827172e-87
KAFR0B039408.843ON5475216962e-84
KAFR0A028408.843ON5204686732e-81
TBLA0C01160singletonON6005006201e-72
NCAS0A05720na 1ON5635115841e-67
NDAI0K02730singletonON6045645791e-66
TDEL0G04950singletonON5124743654e-37
SAKL0C06116gsingletonON1851261914e-16
Suva_10.11singletonON5405421634e-11
Skud_6.16na 2ON5495101412e-08
Kwal_34.15746na 3ON5181441251e-06
Smik_6.24na 2ON5441751242e-06
KLTH0H16214gsingletonON5511431232e-06
KLLA0C18931gna 3ON5531921232e-06
SAKL0F00440gsingletonON5441491232e-06
TDEL0D06610singletonON497941143e-05
SAKL0H16808g8.272ON6574781054e-04
SAKL0C02178gsingletonON5652171035e-04
Skud_13.2442.473ON5621711000.001
Smik_16.81na 4ON625198960.004
Suva_13.2652.473ON561232950.005
NCAS0C03460na 4ON630210920.013
KLLA0A04631g8.272ON579120920.014
Smik_13.2722.473ON561171920.015
YKR105C (VBA5)singletonON582140910.017
YMR088C (VBA1)2.473ON562171910.018
AGR076C8.272ON68650910.019
KLLA0F17776gna 5ON553128900.022
SAKL0C05588gsingletonON677142890.028
KLLA0D19941gsingletonON611123880.040
Kwal_26.6686singletonON569118870.054
NCAS0G029902.242ON581222860.062
Skud_14.2672.242ON562144860.070
KLTH0C10142gsingletonON573137850.10
KLTH0C10120gsingletonON651137840.11
Kpol_1039.192.242ON573235840.13
KLLA0E09879gsingletonON630233830.15
Kpol_543.448.272ON64350810.29
NDAI0H022002.473ON571178800.31
KAFR0J009302.242ON566224800.32
ZYRO0C01430g8.272ON59050800.35
TPHA0F012902.242ON562131780.57
TBLA0B10150singletonON571149780.57
TBLA0G025502.242ON613129780.63
SAKL0B12716gsingletonON632202780.68
TBLA0A014201.451ON572137770.76
TDEL0F039908.272ON63150761.0
KLTH0G09372g2.242ON551132761.2
Ecym_42988.272ON67847751.3
YPR198W (SGE1)singletonON54351741.6
KLLA0F10043gna 6ON52896732.1
SAKL0E04246gna 5ON56548732.2
SAKL0F00198gsingletonON537201732.3
Ecym_73992.473ON563174732.5
TBLA0E01970singletonON578112732.6
KLTH0B00132gsingletonON568123723.0
Skud_16.503singletonON54351723.1
TBLA0F030408.272ON90668723.1
ADL258W2.242ON534199723.2
ZYRO0G21890gsingletonON57667723.4
Suva_9.18na 7ON542116713.7
NCAS0A078102.473ON568178713.9
Suva_16.2898.479ON398190714.3
KNAG0E025602.473ON578185705.0
TBLA0A08510singletonON633148705.1
Kwal_56.237548.272ON58961705.2
TDEL0G03260singletonON612140705.4
YPL028W (ERG10)8.479ON398190705.8
KLLA0A07249g3.53ON508247705.9
KLTH0G13464g8.272ON593186705.9
SAKL0G13376g5.180ON62187706.4
CAGL0J01375g2.473ON56479696.5
NDAI0B037702.242ON571162697.0
TPHA0G031502.473ON60061688.6
Kwal_14.728singletonON568140689.2
KLTH0A07832gsingletonON504248689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.6547
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   968   0.0  
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   715   0.0  
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   706   0.0  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   704   0.0  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   702   0.0  
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   696   0.0  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   626   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   323   e-104
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      321   e-103
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   314   e-100
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   312   e-100
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   308   2e-98
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   307   5e-98
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   307   6e-98
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   305   6e-97
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      304   2e-96
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   302   7e-96
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   301   9e-96
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      299   4e-95
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     298   2e-94
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   297   7e-94
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   295   3e-93
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   294   6e-93
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   295   8e-93
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   294   8e-93
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   294   1e-92
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   293   2e-92
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   292   4e-92
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   292   4e-92
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               291   1e-91
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   291   2e-91
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   289   3e-91
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   288   2e-90
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   286   2e-89
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   284   6e-89
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   280   2e-87
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   272   2e-84
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   263   2e-81
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   243   1e-72
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            229   1e-67
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   227   1e-66
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   145   4e-37
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    78   4e-16
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    67   4e-11
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    59   2e-08
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    53   1e-06
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    52   2e-06
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    52   2e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    52   2e-06
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    52   2e-06
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    49   3e-05
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    45   4e-04
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    44   5e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    43   0.001
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    42   0.004
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    41   0.005
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    40   0.013
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    40   0.014
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    40   0.015
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    40   0.017
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.018
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    40   0.019
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    39   0.022
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    39   0.028
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    39   0.040
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    38   0.054
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    38   0.062
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    38   0.070
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    37   0.10 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    37   0.11 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    37   0.13 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    37   0.15 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    36   0.29 
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    35   0.31 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    35   0.32 
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    35   0.35 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    35   0.57 
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             35   0.57 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.63 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    35   0.68 
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    34   0.76 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    34   1.0  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   1.2  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    33   1.3  
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    33   1.6  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    33   2.1  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    33   2.2  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    33   2.3  
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    33   2.5  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    33   2.6  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    32   3.0  
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    32   3.1  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    32   3.1  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    32   3.2  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    32   3.4  
Suva_9.18 Chr9 complement(20639..22267) [1629 bp, 542 aa] {ON} Y...    32   3.7  
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    32   3.9  
Suva_16.289 Chr16 (501426..502622) [1197 bp, 398 aa] {ON} YPL028...    32   4.3  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    32   5.0  
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             32   5.1  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    32   5.2  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               32   5.4  
YPL028W Chr16 (498096..499292) [1197 bp, 398 aa] {ON}  ERG10Acet...    32   5.8  
KLLA0A07249g Chr1 complement(649905..651431) [1527 bp, 508 aa] {...    32   5.9  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    32   5.9  
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    32   6.4  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    31   6.5  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    31   7.0  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    31   8.6  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    31   9.2  
KLTH0A07832g Chr1 complement(660003..661517) [1515 bp, 504 aa] {...    31   9.5  

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/511 (94%), Positives = 484/511 (94%)

Query: 1   MDAELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQS 60
           MDAELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQS
Sbjct: 1   MDAELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQS 60

Query: 61  IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW 120
           IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW
Sbjct: 61  IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW 120

Query: 121 SLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG 180
           SLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG
Sbjct: 121 SLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG 180

Query: 181 GFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDX 240
           GFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERID 
Sbjct: 181 GFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDA 240

Query: 241 XXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAA 300
                       VNFAWNQGPVVGWQTPYTYA              IESRARFPLLPFAA
Sbjct: 241 AGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESRARFPLLPFAA 300

Query: 301 LSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTG 360
           LSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTG
Sbjct: 301 LSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTG 360

Query: 361 YILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIM 420
           YILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIM
Sbjct: 361 YILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIM 420

Query: 421 ISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGL 480
           ISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGL
Sbjct: 421 ISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGL 480

Query: 481 SGLGVLVAIVYAWSTLKKFKEEQLSEKSSNN 511
           SGLGVLVAIVYAWSTLKKFKEEQLSEKSSNN
Sbjct: 481 SGLGVLVAIVYAWSTLKKFKEEQLSEKSSNN 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/503 (69%), Positives = 403/503 (80%), Gaps = 3/503 (0%)

Query: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65
           ++L+     LK E+ + L       E+P+SL+ E+ FVG+L  AQLMTQAGL QS+AP+ 
Sbjct: 10  KNLDTNAEALKKED-KVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAPLH 68

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           IIGNSFG +N GQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAG
Sbjct: 69  IIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 128

Query: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185
           FSVYSNQIFFDCCRA QG+GPAFLLPN+IAILGRTY PG+RK MVFS+FGA+APGGF LG
Sbjct: 129 FSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG 188

Query: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISA-GILERIDXXXXX 244
           +VFSS+  QLAWWPWAYW MG AC VL VAG  VIP  P P  D S+  +LERID     
Sbjct: 189 AVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSV 248

Query: 245 XXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTD 304
                    NFAWNQGPVVGWQTPYTYA              IESRA FPLLPFAALS+D
Sbjct: 249 TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPLLPFAALSSD 308

Query: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364
            A+VL CIAAGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVAISG CAA+TTG++LS
Sbjct: 309 TAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLS 368

Query: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424
           H P   VML AM AFTVG +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++
Sbjct: 369 HTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 428

Query: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE+RVN+ GA  L+GYR +WYMGIGLSGLG
Sbjct: 429 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLG 488

Query: 485 VLVAIVYAWSTLKKFKEEQLSEK 507
           + VA  YAWST  K K +++SEK
Sbjct: 489 IFVAATYAWSTFMKSK-KRISEK 510

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/503 (68%), Positives = 400/503 (79%), Gaps = 2/503 (0%)

Query: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65
           E+L+     LK ++           EKP+SL+ E+ FVG+L  AQLMTQAGL QS+AP+ 
Sbjct: 10  ENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLH 69

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           IIG+SFG +NPGQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAG
Sbjct: 70  IIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 129

Query: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185
           FSVYSNQIFFDCCRA QG+GPAFLLPN+IAILGRTY PG+RK MVFS+FGA+APGGFVLG
Sbjct: 130 FSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLG 189

Query: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISA-GILERIDXXXXX 244
           +VFSS+  QLAWWPWAYW MG AC +L VAG  +IP  P P  D+++  +LERID     
Sbjct: 190 AVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSV 249

Query: 245 XXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTD 304
                    NFAWNQGPVVGWQTPYTYA              IESRA FPLLPFAALS+D
Sbjct: 250 TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAFPLLPFAALSSD 309

Query: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364
            A+VL CIAAGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVAISG CAAL TG++LS
Sbjct: 310 TAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS 369

Query: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424
           H P   VM  AM AFTVG +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++
Sbjct: 370 HTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 429

Query: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE+ VN+ GAN L+GYR +WY+GIGLSG G
Sbjct: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFG 489

Query: 485 VLVAIVYAWSTLKKFKEEQLSEK 507
           + VA  YA ST  K K +++SEK
Sbjct: 490 IFVAATYAVSTFMKSK-KRVSEK 511

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/503 (68%), Positives = 401/503 (79%), Gaps = 2/503 (0%)

Query: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65
           ++LE      K ++   L   +   E P SL+ EA FVG+L  AQLMTQAGL QSIAP+ 
Sbjct: 10  KNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSIAPLH 69

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           IIG+SFG +NPGQLSWF+++YSLTVGTFILIAGRLGD+FGH+K F++GF WY+LWSLLAG
Sbjct: 70  IIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAG 129

Query: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185
           FSVYSN+IFFDCCRA QG+GPAFLLPN+IAILGRTY PGKRK MVFS+FGA+APGGFVLG
Sbjct: 130 FSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGASAPGGFVLG 189

Query: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDI-SAGILERIDXXXXX 244
           +VFSS+  QLAWWPWAYW MG AC +L VAG  VIP    P  D  S  +LER+D     
Sbjct: 190 AVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSV 249

Query: 245 XXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTD 304
                    NFAWNQGPVVGW+TPYTY               IESRA +PLLPFAALS+D
Sbjct: 250 TGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESRAAYPLLPFAALSSD 309

Query: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364
            A+VLGCIAAGWSSFGIWIFY WQF+E+SR QSPLL+SAQF PVAISG CAA+TTG++LS
Sbjct: 310 AAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLS 369

Query: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424
           H PA  VML AM AFTVG +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+SN+
Sbjct: 370 HTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNS 429

Query: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE++VN+ GAN L+GYR +WYMGIGLSGLG
Sbjct: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSGLG 489

Query: 485 VLVAIVYAWSTLKKFKEEQLSEK 507
           + VA VYA ST  K K++  SEK
Sbjct: 490 IFVAAVYASSTFLKSKKKA-SEK 511

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/509 (66%), Positives = 398/509 (78%), Gaps = 4/509 (0%)

Query: 2   DAELESLEAQFVELKNEEGESLQLVQSH---VEKPQSLMREALFVGILSCAQLMTQAGLA 58
           D E    +   +  ++   +  +L Q H   ++KP+SL+ EA FVG++  AQLMTQAGL 
Sbjct: 5   DKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLG 64

Query: 59  QSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYS 118
           QSIAP+ IIG+SFG  NPGQLSWF+AAYSLTVGTFILIAGRLGD++GHKK F++GF WY+
Sbjct: 65  QSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYA 124

Query: 119 LWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATA 178
           LWSLLAGFSVYSNQIFFDCCRA QGIGPA LLPN+IAILGRTY PG+RK M+ S+FGATA
Sbjct: 125 LWSLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFGATA 184

Query: 179 PGGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERI 238
           P GFVLG+VFSSIF QL WWPWAYWAMG  C  L VAGI+VIP+ P P++D S    +R+
Sbjct: 185 PAGFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRL 244

Query: 239 DXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPF 298
           D             +NFAWNQGPVVGWQTPYTY+              IESRA  PLLP 
Sbjct: 245 DIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESRAPHPLLPL 304

Query: 299 AALSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALT 358
           +ALS+D A+VLGC+ AGWSSFGIWI+YFW FLE+ R  SPLLTSAQF PVAISGLCAALT
Sbjct: 305 SALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALT 364

Query: 359 TGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAAT 418
           TG++++ V A  VML AM AFTVGG+L+ATAP+ Q YWAQ FVS+I+MPWGMDMSFPAAT
Sbjct: 365 TGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAAT 424

Query: 419 IMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGI 478
           IM+S++MPHEHQGLAASLVN VVNYSIS+ LG AGT+E RVNN GAN L+GYRGAWYMGI
Sbjct: 425 IMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGI 484

Query: 479 GLSGLGVLVAIVYAWSTLKKFKEEQLSEK 507
           GLSG G+L+A +Y + T KK K+   SEK
Sbjct: 485 GLSGFGILIAFMYEYHTFKKSKKMP-SEK 512

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/494 (68%), Positives = 388/494 (78%), Gaps = 2/494 (0%)

Query: 15  LKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGIS 74
           LK ++   L       E P SL+ E  FVG+L  AQLMTQAGL QS+AP+ IIG SFG +
Sbjct: 19  LKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTT 78

Query: 75  NPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIF 134
           NPGQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAGFSVYSN+IF
Sbjct: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIF 138

Query: 135 FDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQ 194
           FDCCRA QG+GPAFLLPN+IAILGRTY  GKRK MVFS+FGA APGGFVLG+VFSS+  Q
Sbjct: 139 FDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ 198

Query: 195 LAWWPWAYWAMGTACLVLGVAGIIVIPQ-APPPKIDISAGILERIDXXXXXXXXXXXXXV 253
           LAWWPWAYW MG AC  L +AG  +IP  A P +   S  +LER+D              
Sbjct: 199 LAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILF 258

Query: 254 NFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTDLAYVLGCIA 313
           NFAWNQGPVVGWQTPYTY               IESRA FPLLPFAALS+D A+VL CIA
Sbjct: 259 NFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRAAFPLLPFAALSSDTAFVLSCIA 318

Query: 314 AGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVML 373
           AGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVA+SG CAALTTGY+LS  P   VML
Sbjct: 319 AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVML 378

Query: 374 IAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLA 433
            AM AFT G +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++MPHEHQGLA
Sbjct: 379 FAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLA 438

Query: 434 ASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAW 493
           ASLVNTVVNYSIS+ LG AGTIE+ VN+ GA  L+GYR +WYMGIGLSGLG+ VA +YAW
Sbjct: 439 ASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAW 498

Query: 494 STLKKFKEEQLSEK 507
           ST KK K+   SEK
Sbjct: 499 STFKKSKKRT-SEK 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 380/492 (77%), Gaps = 3/492 (0%)

Query: 16  KNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISN 75
            +EE +SL L  S   +  SL++E   + +L  AQLMTQAGLAQSI P++IIG+SFGI N
Sbjct: 8   SHEEQDSLLLQNS--REWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKN 65

Query: 76  PGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFF 135
           PGQLSWF++A+SLTVGTFILIAGRLGD FGHKK FV+GFLWY+LWS+LAGFSVYSNQIFF
Sbjct: 66  PGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFF 125

Query: 136 DCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQL 195
           DCCRA QGIGPAF LPN+IAI+ RTY PG+++ M+FS+FGA AP GFV+G+VFSS+ S+ 
Sbjct: 126 DCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEF 185

Query: 196 AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNF 255
           AWWPWAYW MG  C +LGVAG +VIP  PP   D    ++ERID              NF
Sbjct: 186 AWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNF 245

Query: 256 AWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTDLAYVLGCIAAG 315
           AWNQGPVVGW+T YTYA              IESRA+ PLLP   LS+D  +V+GCIAAG
Sbjct: 246 AWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAG 305

Query: 316 WSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIA 375
           WSSFGIW++Y WQ + + R Q PLL+SAQFVPVAISGLCAA++T ++L+      VM+IA
Sbjct: 306 WSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIA 365

Query: 376 MIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAAS 435
           MIAFTVG +LVAT P++QTYWAQTFVS+I+MPWGMDMSFPAATI++S AMP  HQGLAAS
Sbjct: 366 MIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAAS 425

Query: 436 LVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWST 495
           LVNT++NYSIS+ LGFAGTIE+++++   + L+GYRGA+YMGIGL+GLG+ VAI YA   
Sbjct: 426 LVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFH 485

Query: 496 LKKFKEEQLSEK 507
             + K   LSEK
Sbjct: 486 YSRLKRS-LSEK 496

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  323 bits (828), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/481 (37%), Positives = 278/481 (57%), Gaps = 17/481 (3%)

Query: 39  EALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILI 96
           E LFV  LSC   QL+ QAG   +++ ++++      S+  + SW  A++ L  G+FILI
Sbjct: 63  EVLFV--LSCMMGQLLNQAGSTMTLSTMKVLERELD-SSSAKSSWLMASFPLVSGSFILI 119

Query: 97  AGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIA 155
           +GRLGD++G KK+ ++G++W ++WSL+ G S +S N  FF   RA QG+G +F+LPN + 
Sbjct: 120 SGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLG 179

Query: 156 ILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSSI--FSQLAWWPWAYWAMGTACLVL 212
           I+G  Y PG +RK +V S+ G  AP G   G +F+ +    + + WPWA++A   A  + 
Sbjct: 180 IVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLT 239

Query: 213 GVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYA 272
            +    VIP + P  ++  A     +D              NF WNQ  VVGW T Y  A
Sbjct: 240 TIISYFVIPNSIPVNVNKFA-----MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIA 294

Query: 273 XXXXXXXXXXXXXXIESR-ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFL 330
                          E + A+ PLLP     S  +  +L  + AGW SFGIWIFY++QF+
Sbjct: 295 LLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFV 354

Query: 331 EDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAP 390
              R+ SP+     F  V+I G  AALT G+ +  V    ++  +MIAFT G ++++  P
Sbjct: 355 LTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTP 414

Query: 391 INQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALG 450
           +++TY+     +++I+ +GMD+SFPAA+I++S+ +  ++QG+A SLVNTVVNYS+SL LG
Sbjct: 415 VHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLG 474

Query: 451 FAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAW-STLKKFKEEQLSEKSS 509
             GTIE ++N  G   LEG+R A Y  IG+  LG+L++ V+     L + K  + +E   
Sbjct: 475 IGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELEY 534

Query: 510 N 510
           N
Sbjct: 535 N 535

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 290/516 (56%), Gaps = 16/516 (3%)

Query: 6   ESLEAQFVELKNEEGESLQL-VQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQSI 61
           E+ E    EL + E E   +   S  + P   Q+  +E LF+     +QL+ QA   Q++
Sbjct: 38  ENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTL 97

Query: 62  APVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWS 121
           + + II +SF  S  G+ +W  A++ L  G+FILI+GR+GD++G KK  + G+L++ +WS
Sbjct: 98  SIMNIITDSFK-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156

Query: 122 LLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATAP 179
           L++GF+ YS N IFF   RA QG+G AF+LPN + I+G  Y P  +RK +V S+ GA+AP
Sbjct: 157 LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAP 216

Query: 180 GGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILER 237
            G  +GS+F+ +        WPWA++A   A  +     I  IP   P  I   A     
Sbjct: 217 IGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFA----- 271

Query: 238 IDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLL 296
           +D             +NF WNQGP+VGWQ  Y                  E + A+ P+L
Sbjct: 272 MDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPIL 331

Query: 297 PFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCA 355
           P        +  +L  +  GW SFGI+ FY++ FL + R  S L     +   AI G  A
Sbjct: 332 PVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVA 391

Query: 356 ALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFP 415
           A+  G  +  + A  ++  +MIAF +G ++++  P++QTY+     ++II+ +GMDMSFP
Sbjct: 392 AVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 451

Query: 416 AATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWY 475
           AA I++S+ +  ++QG+A SL NT+VNYS+SL LG   T+E ++N  G   L+GYR A Y
Sbjct: 452 AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511

Query: 476 MGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEKSSNN 511
           +G+GL+GLG++++ +Y    L   ++E+LS    ++
Sbjct: 512 LGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHD 547

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/476 (35%), Positives = 279/476 (58%), Gaps = 13/476 (2%)

Query: 38  REALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIA 97
           +E LF+     +QL+ QAG  Q+++ + I+  +F  S+  Q +W  A++ L  G+FIL++
Sbjct: 52  KEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFD-SSTSQQTWLMASFPLVSGSFILVS 110

Query: 98  GRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAI 156
           G++GD++G KK  +VG++   +WSL+ G + Y++ + FF   RA QG+G AF+LPN + I
Sbjct: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170

Query: 157 LGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA-WWPWAYWAMG-TACLVLG 213
           +G  Y  G  RK MV S+ GA AP G  +G +FS +   L+  W W ++A   TA + +G
Sbjct: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMG 230

Query: 214 VAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAX 273
           ++ I VIP   P  +  S+     +D              NF WNQGP+VGW T Y    
Sbjct: 231 LS-IWVIPNTIPTNVRGSS-----MDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVL 284

Query: 274 XXXXXXXXXXXXXIESR-ARFPLLPFAALSTD-LAYVLGCIAAGWSSFGIWIFYFWQFLE 331
                         E++ A  PL+P  A+    L   L  +  GW SFGIW FY++ F+ 
Sbjct: 285 LIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVL 344

Query: 332 DSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPI 391
           + R  +PL     +    I G+ AA++ GY +  +P   ++ ++M+AF  G ++++  P+
Sbjct: 345 NLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPV 404

Query: 392 NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGF 451
           +QTY+      +II+ +GMD+SFPA++I++S+ +P E+QG+A SLV+T++NYS+S+ LG 
Sbjct: 405 DQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGI 464

Query: 452 AGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEK 507
           AGT+E ++N  G + L+GYR A Y+GIGL+ LGV ++ ++      + +   + E+
Sbjct: 465 AGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 278/505 (55%), Gaps = 18/505 (3%)

Query: 17  NEEGESLQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73
           N+E  S++L  S +  P    S  +E  F+     +QL+  AG  Q+++ + ++      
Sbjct: 29  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 88

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ- 132
           S+  ++ W  A++ L  G+FIL++GRLGD++G KK+ ++G++   +WSL+ G S YS+  
Sbjct: 89  SDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 147

Query: 133 IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSI 191
           IFF   RA QG+G + +LPN + ++G  Y PG  +K MV SI GA +P G  LG +FS +
Sbjct: 148 IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 207

Query: 192 FSQLAW--WPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXX 249
            +  +   WPWA++A   A  +        IP   P  ++  +     +D          
Sbjct: 208 VATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS-----MDWIGSFTGVLG 262

Query: 250 XXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAAL-STDLAY 307
               NF WNQ P  GW + Y                  E R A  PLLP   + +  L  
Sbjct: 263 LILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIM 322

Query: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367
           +L  +  GW SFGIW FY++ F+ + R+ SPL     +    ISG   A++ G+++  + 
Sbjct: 323 ILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR 382

Query: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427
              ++  +M+ F +G ++ +  P++QTY+     ++II+P GMD+SFPA++I++S+ +P+
Sbjct: 383 PAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 442

Query: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLV 487
           +HQG+A SLVNTV+NYS SL LG AGT+E   N  G + L GYRGA Y GI  SG+ VL+
Sbjct: 443 QHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLI 502

Query: 488 AIVYAWSTL-KKFKEEQLSEKSSNN 511
           A +Y   T+   +K+ +  EK   N
Sbjct: 503 AGLYMVETIFDSYKDRK--EKDCEN 525

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  308 bits (790), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/522 (34%), Positives = 280/522 (53%), Gaps = 26/522 (4%)

Query: 2   DAELESLEA-----------QFVELKNEEGESLQLVQSHVEKPQSLM---REALFVGILS 47
           +AE ES+ A           + V +  + GE + + +   + P        E LF+    
Sbjct: 18  EAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCM 77

Query: 48  CAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHK 107
            +QL+ QAG  Q+++ + II NSFG SN    +W  A++ L  G+FILI+GRLGD++G K
Sbjct: 78  ISQLLNQAGTTQTLSIMNIIANSFG-SNENSRTWLMASFPLVSGSFILISGRLGDIYGLK 136

Query: 108 KLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK- 165
           K+  +G++   +WSL+ G + YS +  FF   RA QG+G AF+LPN + I+G  Y  G  
Sbjct: 137 KMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTF 196

Query: 166 RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQA 223
           RK +V S+ GA AP G  LG +F+ +        WPWA++A     ++     +  IP  
Sbjct: 197 RKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNN 256

Query: 224 PPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXX 283
            P  I   +     +D             +NF WNQ P+ GW   Y              
Sbjct: 257 IPTNIQHFS-----MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVV 311

Query: 284 XXXIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLT 341
               E+R A+ PLLP A L    +  ++  +  GW SFGI+ FY++QF  + R  S +  
Sbjct: 312 FIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWA 371

Query: 342 SAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFV 401
              +    I G+ AAL  G  +  V     + ++M+AF +G ++ +  P+++TY+     
Sbjct: 372 GGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLG 431

Query: 402 SLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNN 461
           ++II+ +GMD SFPA++I+ S+ +P E+QG+A SLVNTVVNYS+SL LG   T+ET V+ 
Sbjct: 432 TMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDP 491

Query: 462 KGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQ 503
            G + L+GYRGA Y+GIGL+ L  +++ +Y    + K  + +
Sbjct: 492 DGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  307 bits (787), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 177/482 (36%), Positives = 268/482 (55%), Gaps = 11/482 (2%)

Query: 20  GESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI--SNPG 77
            E L  V + +  P++ +RE   V IL  +QL+T  G  Q +     +   + I  +  G
Sbjct: 19  AEKLTEVDTSIRLPKTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGG 78

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS--NQIFF 135
            + W +A+Y L     +LIAG+LGDL GHK++ V G++W ++WSL+ GFS Y   NQ F+
Sbjct: 79  LVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFY 138

Query: 136 DCCRALQGIGPAFLLPNSIAILGRTY-TPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQ 194
              RALQGIG  F++PNS+AI+GRTY  PG +K ++FSIFG     GFV+G+ FSS+F+Q
Sbjct: 139 YTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQ 198

Query: 195 LAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVN 254
           L  W W YWA+   C++  V  I+ IP         S  + +R D              +
Sbjct: 199 LTKWAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFD 258

Query: 255 FAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTDLAYVLGCIAA 314
            A+ Q   +GW  P+TY               ++ R   PL+P   L  D+  +L C+  
Sbjct: 259 VAFTQASALGWSPPHTYITLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYF 318

Query: 315 GWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS-HVPACAVML 373
           G+ SF IW  +FWQF E   + SPL  +A+ VP+AI  + AA+ T   L  ++ A  +M+
Sbjct: 319 GFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMV 378

Query: 374 IAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLA 433
           I+M+ F V  +L+AT   N TYWAQ FVS II P+ +D++ P AT++ S+++  E QG+A
Sbjct: 379 ISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIA 438

Query: 434 ASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEG-----YRGAWYMGIGLSGLGVLVA 488
           ASL+ TV++Y+IS+   +   +   V   G +   G         +  GI LSG+G++ A
Sbjct: 439 ASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTA 498

Query: 489 IV 490
           ++
Sbjct: 499 VI 500

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  307 bits (787), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 183/505 (36%), Positives = 281/505 (55%), Gaps = 14/505 (2%)

Query: 6   ESLEAQ-FVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPV 64
           ESL A  F + ++E  +S Q  Q+     +   +E LF+     +QL+ QAG  Q+++ +
Sbjct: 35  ESLTATAFTQSEDEMVDSNQKWQNP-NYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIM 93

Query: 65  RIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLA 124
            I+ +SFG S     SW  A++ L  G+FILI+GRLGD++G KK+ +VG++   +WSL+ 
Sbjct: 94  NILSDSFG-SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 152

Query: 125 GFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGF 182
           G + YS +  FF   RA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G 
Sbjct: 153 GITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 212

Query: 183 VLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDX 240
            LG +F+ +        WPWA++A   A  +  V  I  IP   P  I   +     +D 
Sbjct: 213 TLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFS-----MDW 267

Query: 241 XXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFA 299
                       +NF WNQ P+ GW   Y                  E R A+ PLLP A
Sbjct: 268 IGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRA 327

Query: 300 ALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALT 358
            +    +  ++  +  GW SFGI+ FY++QF  + R  + L     +    I G+ AAL 
Sbjct: 328 VIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALL 387

Query: 359 TGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAAT 418
            G+ + +V     +  +M+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++
Sbjct: 388 VGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASS 447

Query: 419 IMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGI 478
           I+ S+ +P E+QG+A SLVNTVVNYS+SL LG   T+ET+VN+ G + L+GYRGA Y+GI
Sbjct: 448 IIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGI 507

Query: 479 GLSGLGVLVAIVYAWSTLKKFKEEQ 503
           GL+ L  +++ +Y   +  K +  +
Sbjct: 508 GLASLACMISGLYMVESFIKGRRAR 532

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  305 bits (782), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 175/462 (37%), Positives = 269/462 (58%), Gaps = 9/462 (1%)

Query: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94
           SL+ E +FV ++S +Q++  AG  Q I  + +I   F +++P    W +  Y+ T G+F+
Sbjct: 74  SLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFV 133

Query: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNS 153
           LIAG++GD+ GHK +F++G+ W +LWSLL GFS Y  +  FF  CRA QGIG AF   ++
Sbjct: 134 LIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSA 193

Query: 154 IAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLG 213
           ++ILG++Y P KRK  +FS FGA    G VLG VFS++F+QLA W WAYW+M  AC+V+ 
Sbjct: 194 LSILGKSYPPCKRKNFIFSFFGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVVII 253

Query: 214 VAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAX 273
           +  I  IP     K + S   +   D              + AWNQ P  G+   Y Y  
Sbjct: 254 ILSIFFIPGDVVEKHETSN--VFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVL 311

Query: 274 XXXXXXXXXXXXXIESRARFPLLPFAALSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDS 333
                        +E++   PLLP+  +S +   VL  I   ++SF +W  Y ++F   +
Sbjct: 312 LIVSVVILALAMYVETKVDDPLLPWTHISANTLKVLLAIFFAYASFTMWAAYTFRFNLMA 371

Query: 334 RSQSPLLTSAQFVPVAISGLCAALTTGYILS-HVPACAVMLIAMIAFTVGGVLVATAPIN 392
           +  + LL +A+  P+A+SG+ AAL +  +L+ HV     MLI+++AF V  +L+AT    
Sbjct: 372 KGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAG 431

Query: 393 QTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFA 452
           QTYW + FV+ I++ +G+D+SFP+AT+++SN +P + +GL ASLV  V+NY+ +L    A
Sbjct: 432 QTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTA 491

Query: 453 GTI-----ETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489
            ++        + +KG    +      Y+GIG +GLG LVAI
Sbjct: 492 ASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAI 533

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  304 bits (778), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/511 (35%), Positives = 287/511 (56%), Gaps = 19/511 (3%)

Query: 4   ELESLEAQFVELKNEEGESLQLVQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQS 60
           ++E +E   +     + E+ QL  S  + P   Q+  +E LF+     +QL+ QA   Q+
Sbjct: 34  DIEEIEKDVIS----QTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQT 89

Query: 61  IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW 120
           ++ + II +SF  S  G+ +W  A++ L  G+FILI+GR+GD++G KK  V G++++ +W
Sbjct: 90  LSIMNIITDSFN-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148

Query: 121 SLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATA 178
           S+++G + YS+   FF   RA QG+  AF+LPN + I+G  Y P   RK +V S+ GA+A
Sbjct: 149 SIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASA 208

Query: 179 PGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILE 236
           P G   GS+F+ +        WPWA++A   A        I  IP + P  +   A    
Sbjct: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFA---- 264

Query: 237 RIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPL 295
            +D             +NF WNQGP+VGWQT Y  A               E + A  PL
Sbjct: 265 -MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPL 323

Query: 296 LPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLC 354
           LP        +  +L  +  GW SFGI+ FY++ FL + R  S L     +   AI G  
Sbjct: 324 LPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTV 383

Query: 355 AALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSF 414
           AA+  G  +  + A  ++ ++M+AF +G ++++  P++QTY+     ++II+ +GMDMSF
Sbjct: 384 AAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSF 443

Query: 415 PAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAW 474
           PAA I++S+ +  ++QG+A SL NT+VNYS+SL LG   T+E ++N  G + L+GYRGA 
Sbjct: 444 PAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503

Query: 475 YMGIGLSGLGVLVAIVYAWSTLKKFKEEQLS 505
           Y+GIGL+GLG+++  +Y    L   +++ L+
Sbjct: 504 YLGIGLAGLGIIITAIYLGEILWGKRKQHLA 534

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  302 bits (774), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 281/509 (55%), Gaps = 22/509 (4%)

Query: 12  FVELKNEEGESLQLVQSHVEKPQSLM---REALFVGILSCAQLMTQAGLAQSIAPVRIIG 68
           F  L++E  E  Q  Q+    P+      +E LF+     +QL+ QAG  Q+++ + I+ 
Sbjct: 45  FTNLEDEMVECNQKWQN----PKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILS 100

Query: 69  NSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSV 128
           +SFG S     SW  A++ L  G+FILI+GRLGD++G KK+ +VG++   +WSL+ G + 
Sbjct: 101 DSFG-SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITN 159

Query: 129 YS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGS 186
           YS +  FF  CRA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G  LG 
Sbjct: 160 YSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGC 219

Query: 187 VFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXX 244
           +F+ +        WPWA++A   A L+     I  IP   P  I   +     +D     
Sbjct: 220 LFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFS-----MDWIGSV 274

Query: 245 XXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIES-RARFPLLPFAALST 303
                   +NF WNQ P+ GW   Y                  E   A+ PLLP A +  
Sbjct: 275 LGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKD 334

Query: 304 -DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYI 362
             +  ++  +  GW SFGI+ FY++QF  + R  + L     +    I G+ AAL  G+ 
Sbjct: 335 YHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFT 394

Query: 363 LSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMIS 422
           + +V     +  +M+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++I+ S
Sbjct: 395 IKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFS 454

Query: 423 NAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSG 482
           + +P E+QG+A SLVNTVVNYS+SL LG   T+ET+++  G + L+GYRGA Y+GIGL+ 
Sbjct: 455 DNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLAS 514

Query: 483 LGVLVAIVYAWSTLKKFKEEQLSEKSSNN 511
           L  +++ +Y    ++ F  +  ++ ++ N
Sbjct: 515 LACMISGLY---MVESFINDHKAKAATEN 540

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  301 bits (772), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 171/481 (35%), Positives = 260/481 (54%), Gaps = 16/481 (3%)

Query: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94
           S  +E +F+G    AQL+ QAG   ++  + ++  SFG  +  Q +W  A++ L  G+FI
Sbjct: 64  SFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFI 122

Query: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNS 153
           LI+GRLGD++G KK+ ++G++   +WS+++G S YSN   FF  CRA QG+G AF+LPN 
Sbjct: 123 LISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNI 182

Query: 154 IAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACL 210
           + ++G  Y  G  RK +V S+ GA  P G + G VF  +        WPW ++A G A  
Sbjct: 183 MGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATF 242

Query: 211 VLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYT 270
           +  +     IP   P  +    G+   +D              NF WN+ P+ GW   Y 
Sbjct: 243 ISMLMAWYSIPNNVPTNVH---GL--SMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYI 297

Query: 271 YAXXXXXXXXXXXXXXIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQ 328
                            E + A  PLLP A      +  +L  +  GW SFGIW FY+  
Sbjct: 298 IVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVS 357

Query: 329 FLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVAT 388
           F  + R  SP+ T   +   AI G  AA    + +  +    ++  A++AF  G ++ + 
Sbjct: 358 FQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSV 417

Query: 389 APINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLA 448
            P+ Q+YW   F    ++ +GMD+SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL 
Sbjct: 418 LPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 477

Query: 449 LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVY----AWSTLKKFKEEQL 504
           LG   T+E ++N  G N LEGYR A Y+GIGL+ LGVL+++ Y     W+  KK + + L
Sbjct: 478 LGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSL 537

Query: 505 S 505
            
Sbjct: 538 E 538

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  299 bits (766), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 264/484 (54%), Gaps = 12/484 (2%)

Query: 34  QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTF 93
           QS ++E  F+     A L+ QAG  Q ++ + +I  SF  S+ G  +W  A++ L  G+F
Sbjct: 35  QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFH-SDVGTQTWLMASFPLVSGSF 93

Query: 94  ILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPN 152
           ILI+GR+GD++G KK  + G+++  +W+LL GF+ Y++   FF  CRA QG+G +F+LPN
Sbjct: 94  ILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPN 153

Query: 153 SIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA--WWPWAYWAMGTAC 209
            + ++G  Y  G  RK +V S+ G TAP G  +G+++  + +  +   WPW ++A   A 
Sbjct: 154 IMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAA 213

Query: 210 LVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPY 269
            V  +  I  +P+  P  +   A     +D              NF WNQGPV GW  PY
Sbjct: 214 FVNLIMAIYSVPENVPTNVHNFA-----MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPY 268

Query: 270 TYAXXXXXXXXXXXXXXIESRARF-PLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFW 327
                             E +    PLLP        +  +LG +  GW SFGIW FY++
Sbjct: 269 IIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYY 328

Query: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVA 387
            F  + R+ SPL   A      I G  AA   G+ ++ V    ++  + + FT+G ++++
Sbjct: 329 AFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLS 388

Query: 388 TAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISL 447
             PI+QTYW       II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNT++NYS SL
Sbjct: 389 VTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSL 448

Query: 448 ALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEK 507
            LG   T+E ++N  G   L GYR A Y+ +GL GLG  VA +     L + ++ +L + 
Sbjct: 449 CLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKRKSRLDDI 508

Query: 508 SSNN 511
            S N
Sbjct: 509 RSLN 512

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  298 bits (764), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 287/511 (56%), Gaps = 22/511 (4%)

Query: 17  NEEGESLQLVQSH-------VEKPQSL-MREALFVGILSCAQLMTQAGLAQSIAPVRIIG 68
           +E    +++V SH        E P ++  +E + V ++S  Q ++  G  Q I  +  I 
Sbjct: 18  HEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSGQFISLLGAVQGIPQMASIA 77

Query: 69  NSFGISNPGQ---LSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           ++F +  P Q   L W +AAY+ T  TF++IAG+LGD+ GHK +F+ G+ W +LWSLL G
Sbjct: 78  STFSL-RPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTG 136

Query: 126 FSVYS--NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFV 183
           FS Y+  N +FF  CR  QGIG AFL P  +A+LG+ Y P KRK  VFS +GA  P G V
Sbjct: 137 FSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCKRKNYVFSFYGACGPFGIV 196

Query: 184 LGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXX 243
            GSVFS++F+QL  W W YW+M   CL++ +   I IP+   PK + SA      D    
Sbjct: 197 AGSVFSALFTQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSA--FYSFDYVGG 254

Query: 244 XXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALST 303
                     +  WNQ P+  ++ PY Y+              I+SR + PL+P+ ++ +
Sbjct: 255 FCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSRVKDPLIPWKSMCS 314

Query: 304 DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYIL 363
           ++   L  +  G+  F IW+FY W+F   +++ S LL +A+F+P+ ISG+ AA  +  +L
Sbjct: 315 NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLL 374

Query: 364 S-HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMIS 422
           +  VP    +L A+ AF +  +L++T  + +TYW   FV+ +I+  G+D++FP+AT+++S
Sbjct: 375 NKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLS 434

Query: 423 NAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEG-----YRGAWYMG 477
           N + +E QGLAA+L  T +NY  +L  G A  I T   +    R +G        A Y+ 
Sbjct: 435 NGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVA 494

Query: 478 IGLSGLGVLVAIVYAWSTLKKFKEEQLSEKS 508
           IG +G+ V+VAI  + +   K + + L EK 
Sbjct: 495 IGTAGIAVVVAIFGSITEYYKERMDDLREKK 525

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  297 bits (761), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 276/508 (54%), Gaps = 17/508 (3%)

Query: 13  VELKNEEGESLQLVQSHVEKPQSLM---REALFVGILSCAQLMTQAGLAQSIAPVRIIGN 69
           + L N E E ++  Q   + P       +E LF+     +QL+ Q+G  Q+++ + I+ +
Sbjct: 51  IVLTNSEDEVMKTKQKW-QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILAD 109

Query: 70  SFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVY 129
           SFG S+    SW  A++ L  G+FILI+GR+GD+FG K + ++G++   +WSL+ G + Y
Sbjct: 110 SFG-SDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKY 168

Query: 130 S-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSV 187
           S +  FF   RA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G  LG  
Sbjct: 169 SGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCF 228

Query: 188 FSSIFSQLA--WWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXX 245
           F+ +   +    WPWA++A     ++  +  I  IP   P  +   +     +D      
Sbjct: 229 FAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFS-----MDWIGSGL 283

Query: 246 XXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAALST- 303
                  +N  WNQ P+ GW   Y                  E   A+ PLLP A +   
Sbjct: 284 GVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDR 343

Query: 304 DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYIL 363
            +  ++  +  GW SFGI+ FY++QF  + R  +PL     +    I G+ AAL  G+ +
Sbjct: 344 HMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSI 403

Query: 364 SHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISN 423
             V     +  AM+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++I+ S+
Sbjct: 404 KRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSD 463

Query: 424 AMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGL 483
            +P E+QG+A SLVNTVVNYS+SL LG   T+E +++  G + L+GYRGA Y+GIGL+ L
Sbjct: 464 YLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASL 523

Query: 484 GVLVAIVYAWST-LKKFKEEQLSEKSSN 510
             +++ +Y     +K  + + ++E   +
Sbjct: 524 ACIISGLYMVECYIKDHRAKAVAEDKRS 551

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  295 bits (756), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 273/502 (54%), Gaps = 16/502 (3%)

Query: 16  KNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISN 75
            N+E  S Q       K Q      +F G++   QL++QAGL Q+++ + ++      ++
Sbjct: 55  DNDESSSYQNPDYFKNKYQEF--GFIFSGMI--GQLLSQAGLTQTLSIMNVLAKELDSTS 110

Query: 76  PGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIF 134
             Q +W  +++ L +G+FIL++GRLGD++G KK+ + G++  ++WS++ G S Y+ N  F
Sbjct: 111 SRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAF 169

Query: 135 FDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFS--SI 191
           F   RA QG+G AF LPN I ++G  Y PG  RK M+ SI GA +P G  LG +F+  ++
Sbjct: 170 FITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTV 229

Query: 192 FSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXX 251
               + WPW+++A G    V  +     IP + P  I    G+  ++D            
Sbjct: 230 KYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIH---GL--KMDWLGSVLGVFGLI 284

Query: 252 XVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAALSTD-LAYVL 309
            +NF +NQ P+VGWQ+ Y                  E + A+ PL+P A  S   +  +L
Sbjct: 285 ILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMIL 344

Query: 310 GCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPAC 369
             +  GW SFGIW FY++ F  + R  SPL   + +    ISG   A+  G  +  +   
Sbjct: 345 FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS 404

Query: 370 AVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEH 429
            +   +M+ F  G ++ A  P+NQT++      + ++P GMD SFPA++I++S+++P ++
Sbjct: 405 VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY 464

Query: 430 QGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489
           QG+A SLVNTV+NYS S+ LG AGT+E + N+ G + L GYR A Y  IGL+GL V V+ 
Sbjct: 465 QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSG 524

Query: 490 VYAWSTLKKFKEEQLSEKSSNN 511
            Y    L K +   L E    +
Sbjct: 525 GYMIECLWKDRVLSLEENKQTD 546

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  294 bits (753), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 169/465 (36%), Positives = 259/465 (55%), Gaps = 13/465 (2%)

Query: 31  EKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTV 90
           E   S ++E LF+     +QL+ QAG  Q+   + I+ +S    N G+ +W  AA+ L  
Sbjct: 54  EYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQN-GKQAWLMAAFPLIS 112

Query: 91  GTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFL 149
           G+FILI+GR+GD++G KK  +VG+L+  +WSL+ G + Y++   FF   RA QG+G + +
Sbjct: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172

Query: 150 LPNSIAILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMG 206
           LPN + I+G  Y  G KRK MV S+ G  AP G  LG+VFS +        WPWA+++  
Sbjct: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYA 232

Query: 207 TACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQ 266
               +  V  I +IP   P  +        ++D             +NF WNQ P+ GW 
Sbjct: 233 ITAAINFVLSIWLIPNTIPTNVH-----GHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWD 287

Query: 267 TPYTYAXXXXXXXXXXXXXXIESR--ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWI 323
           + Y                  E       PLLP   L S     VL  +  GW SFGI+ 
Sbjct: 288 SAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFS 347

Query: 324 FYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGG 383
           FY++ F  + R  +PL     +    I G+ AAL  G+ +  V    ++ ++M+AF  G 
Sbjct: 348 FYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGS 407

Query: 384 VLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNY 443
           ++++  PI+QTY+      +II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNT+VNY
Sbjct: 408 IIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNY 467

Query: 444 SISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVA 488
           S+S  LG AG +E  VNN G + L+GYRGA+Y+GIGL+ +  +++
Sbjct: 468 SMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIIS 512

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  295 bits (754), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 165/482 (34%), Positives = 263/482 (54%), Gaps = 16/482 (3%)

Query: 31  EKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYS 87
           +KPQ   S + E  F+      QL+ QAG  QS++ + II   FG S   + +W  A++ 
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFG-SETSKQAWLFASFP 124

Query: 88  LTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGP 146
           L  G+FIL+ GR GD++G KK+ ++G+   ++WS++ G + Y++   FF   +A QG+G 
Sbjct: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184

Query: 147 AFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYW 203
           +F+LPN I ++G  Y PG  +K +  S  GA AP G   G +FS I        WPW ++
Sbjct: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244

Query: 204 AMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVV 263
           A      ++GV     +P   P   +       ++D              +F WNQ P+ 
Sbjct: 245 AFAIVSFLVGVTCYFFVPDNVPTNTN-----NLKMDWIGSAVGVVGLLLFSFVWNQAPMD 299

Query: 264 GWQTPYTYAXXXXXXXXXXXXXXIE-SRARFPLLPFAAL-STDLAYVLGCIAAGWSSFGI 321
           GW   Y                  E + A  PLLP A   +  +  +L  I  GW +FGI
Sbjct: 300 GWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGI 359

Query: 322 WIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTV 381
           W FY++ F  + R  SP+ T   +    +SG   A   G+++  +    +++I++  FT+
Sbjct: 360 WSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTM 419

Query: 382 GGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVV 441
           G ++ A  P +QTYW  TF  ++++P GMD+SFPA++I++S+ +P E+QG+A SLVNT+V
Sbjct: 420 GNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMV 479

Query: 442 NYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL-KKFK 500
           NYS S  LG A T+E ++N+ G + L+GYR A+Y G+G+  LG+ +A +Y + T    +K
Sbjct: 480 NYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYK 539

Query: 501 EE 502
           E+
Sbjct: 540 EK 541

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  294 bits (753), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 171/465 (36%), Positives = 248/465 (53%), Gaps = 12/465 (2%)

Query: 38  REALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIA 97
           +E  F+     AQL+ QAG AQ+ AP+ I+ ++F  S   Q +W  A++ L  G+FIL++
Sbjct: 73  QEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVS 131

Query: 98  GRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAI 156
           GR+GD++G KK  + G+L   +WSL+ GF+ Y+ N  FF  CRA QG+G AF+LPN + +
Sbjct: 132 GRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGL 191

Query: 157 LGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQL--AWWPWAYWAMGTACLVLG 213
           +G  Y     RK  V S  G  AP G  LG V+S + +      WPW ++A      +  
Sbjct: 192 IGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINM 251

Query: 214 VAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAX 273
           V  I  IP   P  I         +D              NF WNQGP+ GW   Y  A 
Sbjct: 252 VMAIYSIPSTVPTNIHGFG-----MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIAL 306

Query: 274 XXXXXXXXXXXXXIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLE 331
                         E + A+ PLLP   +    +  +L  +  GW SFGIW FY++ F  
Sbjct: 307 LIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366

Query: 332 DSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPI 391
           + R  S +     F    I G  AA      +  V    ++  +M  FTVG ++++  P+
Sbjct: 367 NLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPV 426

Query: 392 NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGF 451
           +Q+YW       II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNT+VNYS SL LG 
Sbjct: 427 HQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV 486

Query: 452 AGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL 496
             T E +VN  G ++L+GYR A Y+GIGL   G+LVA  Y +  L
Sbjct: 487 GSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVL 531

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  294 bits (752), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 177/520 (34%), Positives = 268/520 (51%), Gaps = 26/520 (5%)

Query: 7   SLEAQFVELKNEEGESLQLVQSHVEKPQ--------------SLMREALFVGILSCAQLM 52
           S++A+   + + E E +  V S  +  Q              S  RE +F+     AQL+
Sbjct: 23  SMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLL 82

Query: 53  TQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVV 112
            QAG   ++  + ++  SF  S   + +W  A++ L  G+FILI+GRLGD++G KK+ ++
Sbjct: 83  NQAGQTHALTIMNVLSKSFN-SESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMI 141

Query: 113 GFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMV 170
           G++   +WSL+ G S YSN   FF  CRA QG+G AF+LPN + ++G  Y  G  RK +V
Sbjct: 142 GYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLV 201

Query: 171 FSIFGATAPGGFVLGSVFSS--IFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKI 228
            S  GA AP G + G +F    +      WPW ++A   A  +  +     IP   P  +
Sbjct: 202 ISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNV 261

Query: 229 DISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIE 288
               G    +D              NF WNQ P  GW T Y  A               E
Sbjct: 262 H---GF--SMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYE 316

Query: 289 SR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFV 346
            + A+ PLLP A      +  +L  +  GW SFGIW FY+  F  + R  SP+ T   + 
Sbjct: 317 VKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYF 376

Query: 347 PVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIM 406
              I G  AA      +  V    ++  A++AF VG ++ +  P+ Q++W   F    I+
Sbjct: 377 VFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAIL 436

Query: 407 PWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANR 466
            +GMD+SFPA++I++S+ +P E+QG+A SLVNTV+NYS SL LG   T+E ++N  G + 
Sbjct: 437 CFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDL 496

Query: 467 LEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSE 506
           L+GYRGA Y+G+GL+ LGVL++  Y   T    + ++  +
Sbjct: 497 LKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKD 536

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  293 bits (750), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 165/484 (34%), Positives = 273/484 (56%), Gaps = 12/484 (2%)

Query: 34  QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTF 93
           Q+  +E +FVG    +QL+ QA + Q+++ + I+  SF  SN    +W  A++ L  G+F
Sbjct: 63  QNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFH-SNAKNQTWLMASFPLVSGSF 121

Query: 94  ILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPN 152
           ILI+GR+GD++G K   V G +++ +W+L++GF+ Y++   FF   R+ QG+G AF+LPN
Sbjct: 122 ILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPN 181

Query: 153 SIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTAC 209
            +  +G  Y P   RK +V S+ GA AP G  +G+ F+ +        WPW+++AM  A 
Sbjct: 182 VMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIAS 241

Query: 210 LVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPY 269
            +  +  +  IP   P  +   +     +D             +NF WNQGP+ GW   Y
Sbjct: 242 TLTLLGALYSIPNHIPTNVHGFS-----MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAY 296

Query: 270 TYAXXXXXXXXXXXXXXIESR-ARFPLLP-FAALSTDLAYVLGCIAAGWSSFGIWIFYFW 327
                             E   A  PLLP     +  +  +L  +  GW SFGI+ FY++
Sbjct: 297 IIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYF 356

Query: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVA 387
            FL + R  S +     +   AI G+ A++  G  +  + A  ++  +MIAF VG ++++
Sbjct: 357 AFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLS 416

Query: 388 TAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISL 447
             P+ QTY+     ++II+ +GMDMSFPAA I++S+++P+++QG+A SL NT+VNYS+SL
Sbjct: 417 VTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSL 476

Query: 448 ALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEK 507
            LG   T+E+++N  G + L+GYR A Y+GIG++ L V+++++Y    L   ++E++   
Sbjct: 477 CLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMEST 536

Query: 508 SSNN 511
           S  N
Sbjct: 537 SETN 540

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  292 bits (747), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 275/505 (54%), Gaps = 19/505 (3%)

Query: 16  KNEEGESLQLVQSHVEKPQSLMR---EALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFG 72
            +E+ + L   +S ++ P    +   E LFV     +QL+ QA   Q+     ++     
Sbjct: 24  NHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLK 83

Query: 73  ISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ 132
            +   Q +W  A++ L  G+FIL++G++GD++G KK  + G+    +WSL+ G S Y++ 
Sbjct: 84  -AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHN 142

Query: 133 I-FFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSS 190
           + FF   R+ QG+G AF+LPN   I+G  Y P  K K MVFS+ GA AP G  LG +FS 
Sbjct: 143 VDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSG 202

Query: 191 IF-SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXX 249
           +  ++   W W ++A      + G+    VIP   P  +        ++D          
Sbjct: 203 LIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKF-----KMDWLGSFLGVCG 257

Query: 250 XXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAAL-STDLAY 307
               NF WNQ P  GW + Y                  E+R A+ PLLP A L +  L  
Sbjct: 258 LIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMM 317

Query: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367
           +L  +  GW SFGIW +Y+  F+ + R  +PL     +   AI G  AA   G+ +    
Sbjct: 318 ILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTG 377

Query: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427
              ++L ++IAF VG ++++  P++QTY+  +  +++I+ +GMD+SFPA++I++S+ +P 
Sbjct: 378 PAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPS 437

Query: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLV 487
           ++QG+A SLVNT++NYS+SL LG +GT E +VN  G + L+GYR A Y+GIGL+ +G+ V
Sbjct: 438 QYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFV 497

Query: 488 AIVYA---WSTLKKFK--EEQLSEK 507
           +  YA   W T ++ +    +L EK
Sbjct: 498 SGAYAIEDWWTRRRERSVRIKLDEK 522

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  292 bits (748), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 278/530 (52%), Gaps = 33/530 (6%)

Query: 2   DAELE---SLEAQFVELKNEEGESLQLVQSHVEKPQ--------------SLMREALFVG 44
           D+E++   +++A+   + + E E +  + S  +  Q              S  +E +F+ 
Sbjct: 15  DSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIA 74

Query: 45  ILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLF 104
               AQL+ QAG   ++  + ++  SF  S     +W  A++ L  G+FILI+GRLGD++
Sbjct: 75  TCMLAQLLNQAGQTHALCIMNVLSKSFN-SEANNQAWLMASFPLAAGSFILISGRLGDIY 133

Query: 105 GHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSIAILGRTYTP 163
           G KK+ +VG++   +WS+++G S YSN   FF   RA QG+G AF+LPN + ++G  Y  
Sbjct: 134 GLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKV 193

Query: 164 GK-RKQMVFSIFGATAPGGFVLGSVFSS--IFSQLAWWPWAYWAMGTACLVLGVAGIIVI 220
           G  RK +V S  GA AP G + G +F    +      WPW ++A G A  +  +     I
Sbjct: 194 GSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSI 253

Query: 221 PQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXX 280
           P   P  I    G+   +D              NF WNQ P+VGW  PY           
Sbjct: 254 PNNVPTNIH---GL--SMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIF 308

Query: 281 XXXXXXIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSP 338
                  ES+ A  PLLP A      +  +L  +  GW SFGIW FY+  F  + R  SP
Sbjct: 309 LVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSP 368

Query: 339 LLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQ 398
           + T   +    I G  AA    + +  +    ++  +++AF  G ++ +  P+ Q+YW  
Sbjct: 369 VWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKL 428

Query: 399 TFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETR 458
            F    I+ +GMD+SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL LG  GT+E +
Sbjct: 429 NFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQ 488

Query: 459 VNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYA----WSTLKKFKEEQL 504
           +N  G + L+GYR A Y+G+GL+ LGV++++ Y     W+  +K ++  L
Sbjct: 489 INKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSL 538

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  291 bits (746), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 176/503 (34%), Positives = 269/503 (53%), Gaps = 21/503 (4%)

Query: 23  LQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQL 79
           LQ   S  + P    S  +E +FV     A L+ QAG +Q ++ + +I +SF  S  GQ 
Sbjct: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ- 114

Query: 80  SWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCC 138
           +W  A++ L  G+FILI+GRLGD++G K++ + GF++  +WSL+ GF+ Y++   FF   
Sbjct: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVA 174

Query: 139 RALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQL 195
           RA QG+G +F+LPN + ++G  Y  G  RK +V S+ G  AP G   G+++  +      
Sbjct: 175 RAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENP 234

Query: 196 AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNF 255
             WPW ++A   A  V  V G   +P   P  ++   G    +D              NF
Sbjct: 235 KQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVN---GF--TMDWIGSVLGVIGLILFNF 289

Query: 256 AWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAALST-DLAYVLGCIA 313
            WNQGP+VGW+  Y                  E + A+ PLLP A      +  +L  + 
Sbjct: 290 VWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLF 349

Query: 314 AGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVML 373
            GW SFGIW FY++ F  + R  SP+ +   F    I G  AA T    +  V    ++ 
Sbjct: 350 LGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLF 409

Query: 374 IAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLA 433
            + I FT G ++++  P++QTYW  TF   II+ +GMD+ FPA++I++S+ +P ++QG+A
Sbjct: 410 FSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMA 469

Query: 434 ASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI---- 489
            SLVNT+VNYS SL LG   T+E ++N  G + L+GYR A Y G+G++GLG  +A     
Sbjct: 470 VSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVC 529

Query: 490 --VYAWSTLKKFKEEQLSEKSSN 510
             +++    K  K+ Q     SN
Sbjct: 530 HDIWSKRNAKDPKDLQRCGTGSN 552

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  291 bits (744), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 270/515 (52%), Gaps = 15/515 (2%)

Query: 4   ELESLEAQFVELKNEEGESLQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQS 60
           E +++     E+ +   +S+    S  + P    S  +E  F+     A L+ QAG  Q 
Sbjct: 24  EDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQV 83

Query: 61  IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW 120
           ++ + +I  SF  S+ G+ +W  A++ L  G+FILI+GR+GD++G KK  + G+++  +W
Sbjct: 84  LSTMNVISESFH-SDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 121 SLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATA 178
           SLL GF+ ++ N  FF  CRA QG+G +F+LPN + ++G  Y  G  RK +V S+ G TA
Sbjct: 143 SLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTA 202

Query: 179 PGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILE 236
           P G  +G+++  +        WPW ++A     LV  +  +  +P   P  +   A    
Sbjct: 203 PTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFA---- 258

Query: 237 RIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARF-PL 295
            +D              NF WNQGPV GW   Y                  E +    PL
Sbjct: 259 -MDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPL 317

Query: 296 LPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLC 354
           LP        +  +L  +  GW +FGIW FY++ F  + R  SP+     +    I G  
Sbjct: 318 LPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTI 377

Query: 355 AALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSF 414
           AAL   + +  V    ++  + + FT+G ++++  PI+Q YW       II+ +GMD+SF
Sbjct: 378 AALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSF 437

Query: 415 PAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAW 474
           PA++I++S+ +P ++QG+A SLVNTV+NY+ SL LG   T+E ++N  G + L+GYR A 
Sbjct: 438 PASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSAL 497

Query: 475 YMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEKSS 509
           Y+ +GL GLG  +A +    TL   + ++L++  S
Sbjct: 498 YLAVGLGGLGSCIAFINLCYTLWMKRRDRLADLKS 532

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  289 bits (740), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 278/506 (54%), Gaps = 19/506 (3%)

Query: 6   ESLEAQFVELKNEEGESLQL-VQSHVEKPQSLMR---EALFVGILSCAQLMTQAGLAQSI 61
           E L++     +  +G++  +  +S ++ P    +   E +FV     +QL+ QA   Q+ 
Sbjct: 13  EKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTN 72

Query: 62  APVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWS 121
               ++      +   Q  W  A++ L  G+FIL++G++GD++G KK  + G++   +WS
Sbjct: 73  PLFDVLSKDLN-AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWS 131

Query: 122 LLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKR-KQMVFSIFGATAP 179
           L+ G S Y++ + FF   R+ QG+G AF+LPN + I+G  Y P    K +VFS+ GA AP
Sbjct: 132 LICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAP 191

Query: 180 GGFVLGSVFSSIF-SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERI 238
            G  LG VFS +  ++   W W ++A      + G+  + +IP   P  ++       ++
Sbjct: 192 IGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN-----EYKM 246

Query: 239 DXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLP 297
           D              NF WNQ P+ GW + Y                  E R A+ PLLP
Sbjct: 247 DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLP 306

Query: 298 FAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAA 356
            + L +  L  +L  +  GW SFGIW FY+  F+ + R  SPL     +   AI G+ A+
Sbjct: 307 HSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVAS 366

Query: 357 LTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPA 416
           L  GY +       ++ ++M+AF  G +++A  P++QTY+  T   +II+ +GMD+SFPA
Sbjct: 367 LLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPA 426

Query: 417 ATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYM 476
           A+I++S+ +P ++QG+A SLV+T+++YS+SL LG +GT E +VN  G + L+GY+ A Y+
Sbjct: 427 ASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYV 486

Query: 477 GIGLSGLGVLVAIVYA----WSTLKK 498
           GIGL+ LGV+++  +     W++ +K
Sbjct: 487 GIGLASLGVVISGAFMIEDWWTSRRK 512

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  288 bits (738), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 161/444 (36%), Positives = 248/444 (55%), Gaps = 12/444 (2%)

Query: 38  REALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIA 97
           +E LF+     + L+ QAG  Q+ + + +IG++F   +  + +W  A++ L  G+FIL++
Sbjct: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVS 138

Query: 98  GRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAI 156
           GR+GD++G K+  + G +   +WSL+ GF+ YS+ + FF  CRA QG+G AF+LPN + +
Sbjct: 139 GRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGL 198

Query: 157 LGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA--WWPWAYWAMGTACLVLG 213
           +G  Y  G  RK +V S  G  AP G   G+ ++ + +  A   WPW ++A   A ++  
Sbjct: 199 VGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNL 258

Query: 214 VAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAX 273
           V  I  IP   P  +    G    +D              NF WN+ P+VGW+  Y    
Sbjct: 259 VLAIYSIPDTVPVNVH---GF--SMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVL 313

Query: 274 XXXXXXXXXXXXXIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLE 331
                         E + A+ PLLP A     ++  +L  +  GW SFGIW FY++ FL 
Sbjct: 314 LIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLL 373

Query: 332 DSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPI 391
           + R  +PL   A      + G  AA T  + +  V    ++  +M+AFTVG ++++  P+
Sbjct: 374 NLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV 433

Query: 392 NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGF 451
           +QTYW  TF   II+ +GMD+SFPA++I++S+A+P E+QG+A SLVNT+VNYS SL LG 
Sbjct: 434 HQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM 493

Query: 452 AGTIETRVNNKGANRLEGYRGAWY 475
             T E +VN  G + L+GYR A Y
Sbjct: 494 GTTAEIQVNKNGTDLLKGYRAALY 517

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  286 bits (733), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/502 (33%), Positives = 275/502 (54%), Gaps = 21/502 (4%)

Query: 19  EGESLQLVQSHVEKPQSLM-REALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISN 75
             E+LQ  ++ V  P+    R   ++ I+SC  +Q M+QAGL Q+++ + I+        
Sbjct: 76  NSENLQ-SENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEK 134

Query: 76  PGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIF 134
             Q +W  A+++L++G+FIL++GRLGD++G KK+ + G+   ++WSL+ GFS YS N  F
Sbjct: 135 SRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAF 193

Query: 135 FDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF- 192
           F   RA QG+G AF+LPNS+ ++G  Y PG  +K M+    GA +P G  LG +F+ I  
Sbjct: 194 FITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIG 253

Query: 193 -SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKI-DISAGILERIDXXXXXXXXXXX 250
                 WPW++++ G       +     IP   P  I ++S      +D           
Sbjct: 254 TKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLS------MDWIGAILGIFGL 307

Query: 251 XXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-ARFPLLPFAALSTD-LAYV 308
             +NF +NQ P+VGWQ+ Y                  E + A+ PL+P A  S   +  +
Sbjct: 308 LILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMI 367

Query: 309 LGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPA 368
           L  +  GW +FG W FY++ F+ + R  +       +    +SG   A   G+++  VP 
Sbjct: 368 LFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPP 427

Query: 369 CAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHE 428
             ++ I+MI F  G V++   PI+Q+Y+      + ++P G+D+SFPAA+I++S+A+P +
Sbjct: 428 SVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQ 487

Query: 429 HQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVA 488
           +QG+A SLV T+ NYS S+ LG AG++E   N+ G N L+GYR A      L+GLG++V+
Sbjct: 488 YQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVS 547

Query: 489 IVYAWSTLKKFKEEQLSEKSSN 510
            +Y    L   +E   + KS+N
Sbjct: 548 GIYMVINLITIRE---NSKSTN 566

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  284 bits (726), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 177/522 (33%), Positives = 275/522 (52%), Gaps = 20/522 (3%)

Query: 2   DAELESLEAQFVELKNEEGESLQLV-QSHVEKP---QSLMREALFVGILSCAQLMTQAGL 57
           D  + S E + V       ES Q+   S  + P    S  +E +F+     AQL+ QAG 
Sbjct: 28  DKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQ 87

Query: 58  AQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWY 117
             ++  + ++  SF   +  Q +W  A++ L  G+FILI+GRLGD++G KK+ ++G++  
Sbjct: 88  THALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVII 146

Query: 118 SLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFG 175
            +WS+++G S YSN   FF  CRA QG+G AF+LPN + ++G  Y  G  RK +V S+ G
Sbjct: 147 IIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIG 206

Query: 176 ATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAG 233
           A AP G + G VF  +        WPW ++A   A  +  +     IP   P  +    G
Sbjct: 207 ACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVH---G 263

Query: 234 ILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESR-AR 292
           +   +D              NF WNQ P+ GW   Y                  E + A 
Sbjct: 264 L--SMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAE 321

Query: 293 FPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAIS 351
            PLLP A      +  +L  +  GW SFGIW FY+  F  + R  SP+ T   +    I 
Sbjct: 322 VPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIF 381

Query: 352 GLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMD 411
           G  AA    + +  +    ++  A++AF  G ++ +  P+ Q+YW   F    I+ +GMD
Sbjct: 382 GSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMD 441

Query: 412 MSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYR 471
           +SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL LG   T+E ++N  G N L+GYR
Sbjct: 442 LSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYR 501

Query: 472 GAWYMGIGLSGLGVLVAIVYA----WSTLKKFKEEQLSEKSS 509
            A Y+GIGL+ LG+L+++ Y     W+  K+ ++++L  ++S
Sbjct: 502 AAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEAETS 543

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  280 bits (717), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 171/482 (35%), Positives = 262/482 (54%), Gaps = 18/482 (3%)

Query: 38  REALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFIL 95
           +E +F  I+SC  AQL+ QAG  QS++ + ++ + F  SN  +  W  A++ L  G+FIL
Sbjct: 84  KEVMF--IISCMVAQLLNQAGQTQSLSTMNVLADYFK-SNSSKQPWLMASFPLVSGSFIL 140

Query: 96  IAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSI 154
           I+GRLGD++G KK   VG++  +LWS++ G + Y+N   FF  CR+ QG+G AF+LPN +
Sbjct: 141 ISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIM 200

Query: 155 AILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLV 211
            ++G  Y  G  RK +V S  G  AP G  LG++F  +        WPW ++A G A  V
Sbjct: 201 GLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFV 260

Query: 212 LGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTY 271
             +  +  IP   P  ++        +D             +N  WNQ P+VGW   Y  
Sbjct: 261 NMLLALYSIPNNVPTNLNN-----LNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYII 315

Query: 272 AXXXXXXXXXXXXXXIESR-ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQF 329
                           E + A  PLLP + L +  +  +L  +  GW SFGIW +Y++ F
Sbjct: 316 VLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAF 375

Query: 330 LEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATA 389
             + R  +PL          I G  AA      +  V    ++  +M+AF  G ++++  
Sbjct: 376 QLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVT 435

Query: 390 PINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLAL 449
           P++QTYW       II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNTVVNYS SL L
Sbjct: 436 PVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCL 495

Query: 450 GFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL--KKFKEEQLSEK 507
           G   T+E + N  GA+ L+GYR A Y+ IGL+  GV V++V+  + +  K+ ++   SE 
Sbjct: 496 GMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESEC 555

Query: 508 SS 509
            S
Sbjct: 556 ES 557

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  272 bits (696), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 162/521 (31%), Positives = 267/521 (51%), Gaps = 17/521 (3%)

Query: 1   MDAELESLEAQFVELKNEEGESLQLVQSHVEKP---QSLMREALFVGILSCAQLMTQAGL 57
           +D   +S++   + + +++  S+    S  + P   +S  +E  F+G    A L+ QAG 
Sbjct: 33  LDVLSDSVKKDQISITDDDVSSIS-NNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQ 91

Query: 58  AQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWY 117
            Q+++ + ++ +S   S+    +W  A+++L  G+FIL++GR+GD++G K  F+ G + +
Sbjct: 92  TQTLSTMNVLADSLN-SDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIF 150

Query: 118 SLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFG 175
            +WS+L G S Y+ N  FF  CRA QG+G AF+LPN + ++G  Y  G  RK +V S  G
Sbjct: 151 CIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIG 210

Query: 176 ATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAG 233
             AP G   G ++  +   S    WPW ++A   A  +  + GI  IP   P  I     
Sbjct: 211 CMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNI----- 265

Query: 234 ILERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIE-SRAR 292
              ++D             +NF WNQ P+ GW   Y                  E  +A 
Sbjct: 266 YNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAE 325

Query: 293 FPLLP-FAALSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAIS 351
            PLLP     +  +  ++  +  GW +FGIW FY++ F  + R  SPL   +      I 
Sbjct: 326 SPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIF 385

Query: 352 GLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMD 411
           G   A+T  + ++ V    +  ++ I FT G ++ +    +QTYW  +    II+  GMD
Sbjct: 386 GSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMD 445

Query: 412 MSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYR 471
           +SFP ++I++S+ +P ++QG++ SLVNT+ NY+ SL LG   T E + NN G + L+GYR
Sbjct: 446 LSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYR 505

Query: 472 GAWYMGIGLSGLGVLVAIVYAWSTL-KKFKEEQLSEKSSNN 511
            A Y+ IGL  LG   +  Y    L  ++++ + +EK  + 
Sbjct: 506 AALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKEDK 546

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  263 bits (673), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 253/468 (54%), Gaps = 15/468 (3%)

Query: 17  NEEGESLQLVQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73
           NE+ E +   +S  + P   ++  +E LFVG     QL+ QA   Q+++ + ++ +SF  
Sbjct: 24  NEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNS 83

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQ 132
           S   Q +W  A++ L  G+FILI+GR+GD++G KK  + G+++  +WSL+ GF+ YS + 
Sbjct: 84  SRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSD 142

Query: 133 IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSI 191
            F    RA QG+G AF LPN +  +G  Y  G  RK MV S+  A+AP G  +G  F+ +
Sbjct: 143 TFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGL 202

Query: 192 F--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXX 249
                 + WPW+++A   AC    +  I  IP   P  ++   G   ++D          
Sbjct: 203 IVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN---GF--KMDWIGSALIVTG 257

Query: 250 XXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIE-SRARFPLLPFA-ALSTDLAY 307
               NFAWNQGP+VGW   Y                  E + A  PL+      S ++  
Sbjct: 258 LILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMII 317

Query: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367
            +  +  GW S+GIW FY++ F+ + R  SP+     +    I G+ A+   G  +  + 
Sbjct: 318 TIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKIT 377

Query: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427
           A  ++L +M+ F VG  L++ AP++Q+Y+  T   + I+  G+D SFPAATI++S+ +P 
Sbjct: 378 APVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPM 437

Query: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWY 475
           E+QG+A SL  T+VNYS+SL LG   T+E ++N  G + L+GYR A Y
Sbjct: 438 EYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  243 bits (620), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 155/500 (31%), Positives = 251/500 (50%), Gaps = 19/500 (3%)

Query: 21  ESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLS 80
           ES  L +  + K +   +E  FV +    Q ++Q GL Q ++ + I+      +   Q  
Sbjct: 106 ESQNLRRPDIFKNR--FQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQ-P 162

Query: 81  WFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCR 139
           W  AA+ L +G  ILI+GRLGD+FG KK+ ++G++  ++W+L+ GFS Y++    F   R
Sbjct: 163 WLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSR 222

Query: 140 ALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFS--SIFSQLA 196
             QG+G A  LPN   ++G  Y P   +K M+F I GA +P G  LG +F+  S+   + 
Sbjct: 223 TFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIK 282

Query: 197 WWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXVNFA 256
            WPW++++      + G+     IP      I+ +   L ++D             +NF 
Sbjct: 283 NWPWSFYSFAIVAFLNGIIAWFCIPN----DIEKNPQGL-KMDWIGSALGLFGLVVLNFV 337

Query: 257 WNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIE-SRARFPLLPFAALST-DLAYVLGCIAA 314
           +NQ P+ GW + Y                  E + A FPL+P    S   L  +L  +  
Sbjct: 338 FNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFC 397

Query: 315 GWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLI 374
           GW  F IW FY++ F  + R  SPL  S+    + ISG    +     +  +    ++  
Sbjct: 398 GWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFF 457

Query: 375 AMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAA 434
           +M+ F  G +L A  PI+QT++   F S+ + P GM  SFP+A++M +  +P  ++ +A 
Sbjct: 458 SMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAG 517

Query: 435 SLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWS 494
           SLVN  +NY+ S+ +G AG+     NN G + L G+R A Y+ IGLSG  V ++ +Y   
Sbjct: 518 SLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIG 577

Query: 495 TL-----KKFKEEQLSEKSS 509
           ++     +K KE +L    S
Sbjct: 578 SIWTDRNQKMKENKLINTDS 597

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  229 bits (584), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 159/511 (31%), Positives = 262/511 (51%), Gaps = 29/511 (5%)

Query: 14  ELKNEEGESLQLVQSHVEKPQ-------SLMREALFVGILSCAQLMTQAGLAQSIAPVRI 66
           +   E+  +LQ  Q+  +          S +RE +F+ I++ +Q ++ A  +Q+I  +  
Sbjct: 39  QRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDA 98

Query: 67  IGNSFGISNPGQLS--WFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLA 124
           I   F +     L   W +AA+++T GTFI+ AG+L DL G K +F+ G+ WY+LWSLL 
Sbjct: 99  ITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLV 158

Query: 125 GFSVYSNQ---IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGG 181
           G S Y+ +    FF   R  QGIG A L P+S+A+LG+ Y P  +K +VFS++G   P G
Sbjct: 159 GISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSCKKNIVFSLYGFCVPLG 218

Query: 182 FVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIP-----QAPPPKIDISAGILE 236
            V+G VFS+IF+QLA W W YW+M        +     IP     ++   K   +   L 
Sbjct: 219 VVVGGVFSAIFTQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLP 278

Query: 237 RIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLL 296
           + D                 WNQ     +++   Y               +E     P++
Sbjct: 279 KFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEFYVDDPII 338

Query: 297 PFAALSTDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAA 356
           P   +       L  +   + SF IW+FY W++    R+ + LL +A+FVP++I+G  AA
Sbjct: 339 PARKIHPQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAA 398

Query: 357 LTTGYILSH-VPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFP 415
           L +  ++S  VP    +L    +F +  +L  T    ++YWA+ F+++II+  G+D+SFP
Sbjct: 399 LFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFP 458

Query: 416 AATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNK--GANRLEGYRGA 473
           +AT+++SN +P E +G++A+LV T +NY   +    A TI     +K   +  ++ +  A
Sbjct: 459 SATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKA 518

Query: 474 WYM----GIGLSGLGVLVAIV-----YAWST 495
            ++    GIG SG+ V+V +      Y+W T
Sbjct: 519 IHIAAAVGIGASGIAVVVGLYGTVTEYSWET 549

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  227 bits (579), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/564 (27%), Positives = 273/564 (48%), Gaps = 84/564 (14%)

Query: 21  ESLQLVQSHVEKPQSLMR-------------EALFVGILSCAQLMTQAGLAQSIAPVRII 67
           E++Q  QSH     SL+R             + +F+ ++  +Q +T A  +Q+I  +  +
Sbjct: 40  ETVQDQQSHKVTHSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAILQMDSL 99

Query: 68  GNSFGI--SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
              F I  ++  QL W +A++++T G FI++AG+L D+   + +F+ G++W+SLW+L+ G
Sbjct: 100 SVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITG 159

Query: 126 FSVY--SNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK------------------ 165
           F+ Y   N IF   CR  QGIG A L P+++ +L + YT  +                  
Sbjct: 160 FASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSP 219

Query: 166 -----------------------------RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA 196
                                         K + FS++GA AP G V+G +FS+IF+QLA
Sbjct: 220 SHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLA 279

Query: 197 WWPWAYWAMGTACLVLGVAGI--IVIPQAPPPKIDISAGILER---IDXXXXXXXXXXXX 251
            WPW YW+M     +L +     +V+P  P  K+D +   L+     D            
Sbjct: 280 TWPWNYWSMSIVTTLLSILSYFYVVVP-IPVEKLDSNPNSLKNWKNFDFLGVILGISALI 338

Query: 252 XVNFAWNQGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAALSTDLAYVLGC 311
               +W+Q  +  ++T + Y                E     P++P   +       L  
Sbjct: 339 LFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYFNNPIIPIRQIHPGTIKALLV 398

Query: 312 IAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAA-LTTGYILSHVPACA 370
           +   + SF  W+FY W+   + +  SP+L S +F+P++++G+ +A  +   I+  VP   
Sbjct: 399 VFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQI 458

Query: 371 VMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQ 430
            +L    +F +  +L+ T  ++ +YW   F S+I +  G+D+SFP+AT++++N +P E Q
Sbjct: 459 RLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQ 518

Query: 431 GLAASLVNTVVNYSISLALGFAGTI-----ETRVNNKGANR--LEGYRGAWYMGIGLSGL 483
           G+ A+LV +V+NY  ++    A TI     E+ +++    +  L+G   A  +G+G SG+
Sbjct: 519 GICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGI 578

Query: 484 GVLVAIV-----YAWSTLKKFKEE 502
            VL+ I      Y+W T K F ++
Sbjct: 579 AVLIGIYGTITEYSWKT-KGFSKK 601

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  145 bits (365), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 126/474 (26%), Positives = 213/474 (44%), Gaps = 47/474 (9%)

Query: 36  LMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFIL 95
           L +E  FV     AQ   QAG    +  V ++ +SF         +   +Y +  G+F+L
Sbjct: 47  LCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSF------HGKFLLNSYPMVCGSFML 100

Query: 96  IAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSI 154
           I GRLG++ G+K+  + G++   L SLL G S YS + IF+  CRA QG+G A +LPN  
Sbjct: 101 IGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFS 160

Query: 155 AILGRTY---TPGKRKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTAC 209
           A     Y       RK ++ +I G  A  G  LG+  S I      + W WAY+    A 
Sbjct: 161 AAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAA 220

Query: 210 LVLGVAGIIVIPQAPPPK-----------IDISAGILERIDXXXXXXXXXXXXXVNFAWN 258
            +        +P     K            + S G+L                 +N A N
Sbjct: 221 TLTLALSYYSVPDNITKKNKPCLNGLGWFSNRSCGLL----------------MLNVACN 264

Query: 259 QGPVVGWQTPYTYAXXXXXXXXXXXXXXIESRARFPLLPFAA----LSTDLAYVLGCIAA 314
              V    + +++               +    +F   P  +     +  ++ VL  I  
Sbjct: 265 LAAVA--SSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFF 322

Query: 315 GWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLI 374
           GW ++GIW  YF++FL + R+ SPL   + ++ + I G  A +    ++        +L 
Sbjct: 323 GWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLF 382

Query: 375 AMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAA 434
           + + FT   ++++  PI+Q+Y+  T  S+I +  G+D SFP++ I++ N +P ++  + A
Sbjct: 383 SSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTA 442

Query: 435 SLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVA 488
            L N + NY+IS   G   +    +++     ++ YR  +Y  IGLS +G+  A
Sbjct: 443 VLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYRYVYYFAIGLSAIGLFAA 494

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 71/126 (56%), Gaps = 3/126 (2%)

Query: 49  AQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKK 108
           +QL+ Q G  Q++  + ++   F  S   Q +   A+  L  G+FIL++G++GD++G K 
Sbjct: 3   SQLLNQVGTTQTLPLINVLSRGFESSTAEQ-TRLVASIPLVSGSFILVSGKVGDIYGLKN 61

Query: 109 LFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-R 166
             + G+    +WS + G + Y+  + FF   RA QG+G AF+LPN +  +   Y  G  R
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 167 KQMVFS 172
           K MV++
Sbjct: 122 KNMVYA 127

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 440 VVNYSISLALGFAGTIETRVNNKGANRL 467
           ++ YS+ + LG AGT+E RV+  GA+RL
Sbjct: 156 MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 116/542 (21%), Positives = 208/542 (38%), Gaps = 66/542 (12%)

Query: 20  GESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQL 79
           G++L+ +++  +K    +   + +  L C        +A  I+ +  +   + IS     
Sbjct: 10  GKALEKIRNRCQKSTYQLNVNVALIFLGCT--FDLLNVASMISLIDDLAQKYDISYT-TA 66

Query: 80  SWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCR 139
           SW   +Y++T   FI   GRLGD+ G+  LF V   ++++ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC--AVMPNFPAFAVFR 124

Query: 140 ALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI----FGATAPGGFVLGSVFSSIFSQL 195
           A+QGI  A L+P + A++     P +  Q  FSI    F +T   G ++G  F++  +++
Sbjct: 125 AIQGISAAGLVPCAYALI-PMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAA--TKI 181

Query: 196 AWWPWAYWAMGTACLVLGVAGII---VIPQAPPPKIDISAGILERIDXXXXXXXXXXXXX 252
            +    Y       L+  VA      V   + PP+ D +   +  +D             
Sbjct: 182 GYKGIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSIL 241

Query: 253 VNFAWNQGPVVGWQTPYTYAXXX----------------XXXXXXXXXXXIESRARFP-- 294
           +     +G    W  P TY                               I++   F   
Sbjct: 242 IVVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKV 300

Query: 295 --LLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAI- 350
             L+P   L   +   ++   A   +     I+   Q+ +     SPL    + VP+ I 
Sbjct: 301 QLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIIC 360

Query: 351 ----SGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQT-YWAQTFVSLII 405
               +GLCA  +T       P   V+L   +A     +L     I +  +W   F S  +
Sbjct: 361 MVIGNGLCAFEST----KLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQAL 416

Query: 406 MPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTV----VNYSISLALGFAGTIETRVNN 461
           + +G+ + +P A  +     P   +G+A+ +  T     +  + S+     G I+     
Sbjct: 417 VGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGK 476

Query: 462 KGANR--LEGYRGAWYMGIGLSGLGVLVA-------------IVYAWSTLKKFKEEQLSE 506
            GA++    G++   Y  + +  LG LV              I    S++++ K E   E
Sbjct: 477 SGASQKFRTGFQNCTYFTVAVGALGFLVTLFGLKDTRPPTDDISDVESSIQRTKVEMDQE 536

Query: 507 KS 508
           KS
Sbjct: 537 KS 538

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 102/510 (20%), Positives = 201/510 (39%), Gaps = 53/510 (10%)

Query: 21  ESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLS 80
            +L+ +++  +K +  +   + +  L C        +A  I+ +  +  ++ IS     S
Sbjct: 11  NALEEIRNKCQKSRYQLNVNVGLIFLGCT--FDLLNVASMISLIDDLAKTYNISYTTA-S 67

Query: 81  WFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRA 140
           W   +Y++T   FI   GRLGD+ G+  LF +    +++ SLL   +V  N   F   RA
Sbjct: 68  WSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC--AVMPNFPAFAVFRA 125

Query: 141 LQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI----FGATAPGGFVLGSVFSSIFSQLA 196
           +QGI  A L+P + A++     P ++ Q  FSI    F +T   G ++G  F++  +++ 
Sbjct: 126 IQGICAAGLVPCAYALI-PILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAT--TKIG 182

Query: 197 WWPWAYWAMGTACLVLGVAGII---VIPQAPPPKIDISAGILERIDXXXXXXXXXXXXXV 253
           +    Y       L+  +A      V      P+ D ++  ++ +D             +
Sbjct: 183 YRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILI 242

Query: 254 NFAWNQGPVVGWQTPYTYAXXX----------------XXXXXXXXXXXIESRARFP--- 294
                +G    W  P TY                               I++   F    
Sbjct: 243 VVGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQ 301

Query: 295 -LLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAI-- 350
            L+P   L   +   ++   A   +     ++   Q+ + +   SPLL   + VP+ I  
Sbjct: 302 LLIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICM 361

Query: 351 ---SGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQT-YWAQTFVSLIIM 406
              + LCA  +T       P   V +   +A     +L+    + +  +W   F +  ++
Sbjct: 362 VIGNALCAFEST----KLRPRVGVAIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALV 417

Query: 407 PWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNN-KG-A 464
            +G+ + +P A  +     P E +G+A+ +  T     I +      ++   +N  KG +
Sbjct: 418 GFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKS 477

Query: 465 NRLEGYRGAW----YMGIGLSGLGVLVAIV 490
           N ++ +R  +    Y  + +  LG LV  +
Sbjct: 478 NAIQKFRTGFQNCSYFTVAVGALGFLVTAI 507

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 73/144 (50%), Gaps = 11/144 (7%)

Query: 50  QLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKL 109
            L+  AG+   I+ +  +G ++ +   G  SW   +Y++T   FI   GRLGD+ G+  L
Sbjct: 40  DLLNVAGV---ISVIEDLGETYKLGYTGA-SWALTSYAITFAGFIAFMGRLGDIVGNSVL 95

Query: 110 FVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQM 169
           F +    ++L+SLL   +V  +   F   RALQGI  A ++P   A++     P +  Q 
Sbjct: 96  FTISCFLFTLFSLLC--AVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEP-QDIQK 152

Query: 170 VFSI----FGATAPGGFVLGSVFS 189
            FSI    F +T   G ++G  F+
Sbjct: 153 FFSIVSCGFSSTIGIGLIVGGAFA 176

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 32/176 (18%), Positives = 74/176 (42%), Gaps = 10/176 (5%)

Query: 323 IFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYI-LSHVPACAVMLIAMIAFTV 381
           I+   Q+ +     SPL+   + +P+ +S +    T     L   P   V+L  +     
Sbjct: 335 IYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGVVLGFLFMLCG 394

Query: 382 GGVLVATAPI-NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTV 440
             +L+    I N  +W   F S I +  G  + +P A  ++    P   +G+A+ +  T 
Sbjct: 395 SIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAKGIASGMTQTF 454

Query: 441 VNYSISLA-------LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489
             + + +        LG    ++  +N++   + + ++   Y  + ++ LG+++ +
Sbjct: 455 AQFGVEVTFSVMVSVLGNITDVKETLNSQETFK-DRFQNCAYFSVAVAALGLILTL 509

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 85/175 (48%), Gaps = 12/175 (6%)

Query: 21  ESLQLVQSHVEK-PQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQL 79
           ++LQ +++  +K P  L      VG++          +A  I+ +  +   + IS     
Sbjct: 11  KALQEIRNKCQKSPYQLNVN---VGLIFLGCTFDLLNVASMISLIDDLAKKYNISYTTA- 66

Query: 80  SWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCR 139
           SW   +Y++T   FI   GRLGD+ G+  LF +    +++ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC--AVMPNFPAFAVFR 124

Query: 140 ALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI----FGATAPGGFVLGSVFSS 190
           A+QGI  A L+P + A++     P ++ Q  FSI    F +T   G ++G  F++
Sbjct: 125 AIQGICAAGLVPCAYALI-PILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAA 178

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 71/172 (41%), Gaps = 16/172 (9%)

Query: 328 QFLEDSRSQSPLLTSAQFVPVAI-----SGLCAALTTGYILSHVPACAVMLIAMIAFTVG 382
           Q+ + +   SPLL   + VP+ I     + LCA  +T       P   V L   +A    
Sbjct: 337 QYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFEST----KLKPRVGVALGFSLALAGS 392

Query: 383 GVLVATAPI-NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVV 441
            +L+    I +  +W   F S  ++ +G+ + +P A  +     P + +G+A+ +  T  
Sbjct: 393 IILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFG 452

Query: 442 NYSISLALGFAGTIETRVNN-KGA-----NRLEGYRGAWYMGIGLSGLGVLV 487
              I +      ++   +N  KG      N   G++   Y  + +  LG LV
Sbjct: 453 QLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLV 504

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 10/143 (6%)

Query: 32  KPQSLMREALFVGILSCA-QLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTV 90
           K Q ++  AL    L C   L+  AG+   I+ +  +G ++G+      SW   +Y++T 
Sbjct: 27  KYQLIINMALI--FLGCTFDLLNVAGV---ISVIEDLGETYGLEYT-TASWALTSYAITF 80

Query: 91  GTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLL 150
              I   GRLGD+ G+  LF +   ++SL+ LL   +V +N   F   RALQGI  A L+
Sbjct: 81  AGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLC--AVVTNFPAFAVLRALQGIAAAGLV 138

Query: 151 PNSIAILGRTYTPGKRKQMVFSI 173
           P   A++     P +  Q+ F++
Sbjct: 139 PCGYALIPTLADP-EDVQLFFAV 160

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 79/182 (43%), Gaps = 18/182 (9%)

Query: 323 IFYFWQFLEDSRSQSPLLTSAQFVPVAIS-----GLCAALTTGYILSHVPACAVMLIAMI 377
           I+   Q+ +     SPLL   + VP+ I+      +CA+ +    L      A+  ++M+
Sbjct: 339 IYIIDQYSQYVDKNSPLLAGVKLVPLIITMVIGNTICASKSVK--LRPRIGVALGFLSMV 396

Query: 378 AFTVGGVLVATAPINQT-YWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASL 436
             ++  +L+    + +  YW   F S I++ +G  + +P A  ++    P   +G+A+ +
Sbjct: 397 CGSI--ILIQLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGV 454

Query: 437 VNTVVNYSISLA-------LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489
             T     I +        LG    +++R ++    R +G++   Y  +     G+++  
Sbjct: 455 TQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSFERFR-DGFQKCTYFTLASGAFGLVLTT 513

Query: 490 VY 491
            +
Sbjct: 514 FF 515

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 92/192 (47%), Gaps = 20/192 (10%)

Query: 34  QSLMREALFVGIL-SCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGT 92
           Q  ++   F+ IL +C   +  A +   I  V  I   F +S+  Q  W   +Y +T   
Sbjct: 17  QDTLKHLKFICILIACG--LDLASVGAMIVLVTDIETRFNVSHT-QSGWALTSYVITFAG 73

Query: 93  FILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPN 152
           FI   GR+GD+ G+  +  V  + + ++SLL   +V  N I F   RA QG+  A ++P 
Sbjct: 74  FIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPNFIAFTVFRAFQGMAGAGIVPC 131

Query: 153 SIAILGRTYTPGKRKQMVFSIF----GATAPGGFVLGSVFSSIFSQLAWWPWAYW----A 204
           + A++ + +  G   Q  FSI      A A  GF++G  F    + L +  + Y+    +
Sbjct: 132 AYALVNKMFQ-GPNLQRYFSILSSVISAMAGVGFIIGGAFGE--TALGYKSFFYFLFAAS 188

Query: 205 MGTA---CLVLG 213
           + TA   C+++G
Sbjct: 189 LATAAVICVLIG 200

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 10/149 (6%)

Query: 45  ILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLF 104
           ++SCA       +   ++  R I N++ I      SW   AY++T   FI   GR+GD+ 
Sbjct: 31  MVSCA--FDLINVTAVLSATRDIENTYQIEFTTA-SWALTAYAITFAGFIAFLGRVGDII 87

Query: 105 GHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPG 164
           G+  LFV     +S+ SL+   +V +N   F   RALQGI  A ++P+  A++  T +  
Sbjct: 88  GNSVLFVSSCFLFSILSLIC--AVVNNFGTFAVFRALQGIAAAGIVPSGYALI-PTLSDE 144

Query: 165 KRKQMVFSI----FGATAPGGFVLGSVFS 189
              Q  F+I    F  +   GF++G  F+
Sbjct: 145 HEVQSFFAIVSCGFSTSFGIGFIIGGAFT 173

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 4/136 (2%)

Query: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHV--PACAVMLIAMIAFTVGGVL 385
           Q+ +     SPLL + + +P+ +S L   +    I S +  P  AV+L   I F    +L
Sbjct: 337 QYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIA-IKSDLISPRKAVVLGFFIMFIGSIIL 395

Query: 386 VATAPI-NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYS 444
           +    I +  YW   F S  ++ +G  + FP +  ++    P E++G+A+ ++ T   + 
Sbjct: 396 IQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFG 455

Query: 445 ISLALGFAGTIETRVN 460
           + +      +I   +N
Sbjct: 456 VEVTFSVMTSILGNIN 471

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 80  SWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCR 139
           SW   +Y++T   FI   GRLGD+ G+ +LF V    +++ SLL G  +  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCG--LMPNFEAFAVMR 124

Query: 140 ALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI 173
           ALQGI  A L+    A++    +P ++ Q  FSI
Sbjct: 125 ALQGIAAAGLVMCGYALI-PILSPKEQVQEYFSI 157

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 58/135 (42%), Gaps = 2/135 (1%)

Query: 323 IFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHV-PACAVMLIAMIAFTV 381
           I+   Q+ +   + SPL+   + VP+ IS +      G   + + P   V L   +A + 
Sbjct: 326 IYIIDQYSQYKENDSPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALSG 385

Query: 382 GGVLVATAPIN-QTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTV 440
             +L     +    +W   F + +++ +G+ + +P A  +     P E +G+A+ +  T 
Sbjct: 386 SIILTQLRAVKYDVFWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQTF 445

Query: 441 VNYSISLALGFAGTI 455
               I +A     ++
Sbjct: 446 GQLGIEIAFSIMASV 460

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 106/478 (22%), Positives = 179/478 (37%), Gaps = 56/478 (11%)

Query: 3   AELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIA 62
           A+   LE   +E KN  G S   ++        ++  ++++GI         A L  +I 
Sbjct: 105 AKTIDLETSSIEAKNNTGLSPARIK--------IIMGSMYLGIF-------LASLDNTIV 149

Query: 63  PVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL 122
              +   +   +    +SW + AY L+  TF  + G++ D+FG K L +   + ++L  L
Sbjct: 150 STLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209

Query: 123 LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI----FG-AT 177
           + G S           R + GIG   L   S +I      P + + +   I    FG  T
Sbjct: 210 ICGLS--PGLWCLVAGRFIAGIGGGGLTSMS-SITTSDIVPLRNRALYQGICNFFFGLGT 266

Query: 178 APGGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGI--- 234
           A GG V G  FS        W  A+      C    ++  +++     PK    +GI   
Sbjct: 267 ACGGLV-GGWFSE---HGGGWRVAFLIQIPLC---AISCSLIVAYLELPKGCKGSGIQSD 319

Query: 235 --------LERIDXXXXXXXXXXXXXVNFAWNQGPVVGWQTPYT----YAXXXXXXXXXX 282
                   L RID                A + G   G + P+     YA          
Sbjct: 320 EDNQISEKLRRIDWFGALSLVVFLLLFMLASSLG---GKELPFQSNGFYALCVAIVVGGA 376

Query: 283 XXXXIESR-ARFPLLPFAALSTDLAYVLGCIAAGW-SSFGIWI--FYFWQFLEDSRSQSP 338
               +E+  ++ P+LP A L      +LG   A W S  G+    ++   +     +  P
Sbjct: 377 TFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP 434

Query: 339 LLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVL-VATAPINQTYWA 397
                + +P   S    +L  GY +        +L+A  A  V G L ++    N   W 
Sbjct: 435 TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR 494

Query: 398 QTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTI 455
           Q ++ L+I  +G+ +      + +  A+PHEHQ    S+     +   +L +   G I
Sbjct: 495 Q-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 88/217 (40%), Gaps = 19/217 (8%)

Query: 18  EEGESLQLVQSHVEKPQSLMR---EALFVG-ILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73
           + GE  +   SH E P + +R    AL +G  LS       A L  +IA          +
Sbjct: 23  DTGE--ESTTSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIAS--------DL 72

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI 133
               Q+SW + AY L+   F  + G+L D+FG K L ++  L ++L   + G    +N  
Sbjct: 73  DASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVW 132

Query: 134 FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFS 193
                R + GIG       S  I      P +++ +   +       G   GSV  ++  
Sbjct: 133 VLSTGRFVAGIGGGGQATLS-TITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQ 191

Query: 194 QLAWWPWAYWA---MGTACLVLGVAGIIVIPQAPPPK 227
           Q   W WA+     M   C  L +A ++ +P   P +
Sbjct: 192 QGIGWRWAFLVQVPMALVC-ALMIAVVLDLPADSPGR 227

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI 133
           S   +  W + ++ LT   F  + G+L D+ G K   ++   ++ L  LL  F+   N  
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLLTCFA--RNVT 125

Query: 134 FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSIF 192
            F   RA+ GIG   L  N+I+ +  +     R++ V+  +     G G +LG+    +F
Sbjct: 126 EFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGVF 183

Query: 193 SQLAWWPWAYWA---MGTACLVLGVAGI-IVIPQAPPPKIDISAGILERID 239
            +   W   +     M   C +L +  I I +   PP K   +   L RID
Sbjct: 184 IETIGWRALFGVQVPMIMLCTILAIKNINIKLFHVPPMKERYTLKNLSRID 234

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 87/198 (43%), Gaps = 5/198 (2%)

Query: 7   SLEAQFVELKNEEGESLQLVQSHVEKPQSLMREA-LFVGILSCAQLMTQAGLAQSIAPVR 65
           +++ +F    +E  E+  + + +V+K   L + + L+V +++ A  +  A L   I    
Sbjct: 26  AVDQKFAHTSSEHDET-SIPEDNVKKNVELSKGSILYVSLVAVALSLFLAALDVMIVSTI 84

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           I   +  + +  ++ W    YSL     +LI GR+    G K   +   + + + SL++ 
Sbjct: 85  IEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISA 144

Query: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185
            +   N +     R + GIG   +   S  ++G T     ++ M+ +I  ++     V+G
Sbjct: 145 LASSMNMLI--GGRVIAGIGGCGIQSLSF-VIGSTLVEESKRGMLIAILSSSFAIASVVG 201

Query: 186 SVFSSIFSQLAWWPWAYW 203
                +F+    W W ++
Sbjct: 202 PFLGGVFTSSVTWRWCFY 219

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 94/232 (40%), Gaps = 22/232 (9%)

Query: 18  EEGESLQLVQSHVEKPQSLMREALFVGI-----LSCAQLMTQAGLAQSIAPVRIIGNSFG 72
           EE E L L Q + E   +L +  +   +     LS       A +   +A        F 
Sbjct: 15  EEAEVLPLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVA------EEFS 68

Query: 73  ISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ 132
            S+  Q  W + ++ LT   F  + G+L D+ G +   +    ++ L  L+  F+   N 
Sbjct: 69  ESSKKQ--WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFA--RNV 124

Query: 133 IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSI 191
             F   RA+ GIG   L  N+I+ +  +     R++ V+  +     G G +LG+    I
Sbjct: 125 TEFSIARAVCGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGI 182

Query: 192 FSQLAWWPWAYWA---MGTACLVLGVAGI-IVIPQAPPPKIDISAGILERID 239
           F +   W   +     M   C +L +  I I +   PP K   +   L RID
Sbjct: 183 FIETIGWRALFGVQVPMIIVCSILAIKNINIKLFHVPPMKERYTLKNLSRID 234

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 35/210 (16%)

Query: 17  NEEGESLQLVQSHVEKP--------QSLMREALFVGIL--SCA------------QLMTQ 54
           NEE  +   V +HVEK         ++ M E L  GI+  +CA             +M  
Sbjct: 39  NEESGTDAEVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIV 98

Query: 55  AGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGF 114
           + + + +A        FG  +  +  W  A YSL      L+ GR+  + G K   +   
Sbjct: 99  STIIEDVAK------KFGAYS--KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAI 150

Query: 115 LWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIA-ILGRTYTPGKRKQMVFSI 173
           + + + SL++G +   N +     R + G+G + +   S+A ++G      +R+ ++ + 
Sbjct: 151 IIFEIGSLISGVANSMNMLI--GGRVIAGVGGSGI--QSLAFVIGSNLVDERRRGLIIAC 206

Query: 174 FGATAPGGFVLGSVFSSIFSQLAWWPWAYW 203
             +      V+G      F+  A W W ++
Sbjct: 207 MSSAFAVASVIGPFLGGAFTTHATWRWCFY 236

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 15/120 (12%)

Query: 18  EEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMT----------QAGLAQSIAPVRII 67
           E  E+  L++S  E      RE L V  +S A+L             A L  +I    + 
Sbjct: 32  EVAETEHLLESEDEA-----REGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLS 86

Query: 68  GNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
             +   +    +SW + AY L+  TF  + G++ D+FG + L ++  L++ L  L+ G S
Sbjct: 87  HIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 9/171 (5%)

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI 133
           S   +  W + ++ LT   F  + G+L D+ G K   +    ++ +  LL  F+   N  
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFA--RNVT 125

Query: 134 FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSIF 192
            F   RA+ GIG   L  N+I  +  +     R++ V+  +     G G +LG+    +F
Sbjct: 126 EFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVF 183

Query: 193 SQLAWWPWAYWA---MGTACLVLGVAGI-IVIPQAPPPKIDISAGILERID 239
            +   W   +     +   C VL +  I I +   PP K   +   L RID
Sbjct: 184 IETIGWRALFGVQVPVIMLCSVLAIKNINIKLFHVPPMKERYTLKNLSRID 234

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 57/140 (40%), Gaps = 5/140 (3%)

Query: 64  VRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLL 123
           + ++   FG  N  +  W    YSL      LI GR   + G +   ++  L +   SL+
Sbjct: 61  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 124 AGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFV 183
           A  +   N + F   R + G+G +  L     ++G T    + + +V SI         +
Sbjct: 119 AALASSMNMLIFG--RVVAGVGGSG-LQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 184 LGSVFSSIFSQLAWWPWAYW 203
           +G +    F+    W W ++
Sbjct: 176 VGPIIGGAFTTHVTWRWCFY 195

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI 133
           S   +  W + ++ LT   F  + G+L D+ G K   +    ++ L  LL  F+   N  
Sbjct: 68  SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCFA--RNVT 125

Query: 134 FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSIF 192
            F   RA+ GIG   L  N+I+ +  +     R++ V+  +     G G +LG+    +F
Sbjct: 126 EFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGVF 183

Query: 193 SQLAWWPWAY---WAMGTACLVLGVAGI-IVIPQAPPPKIDISAGILERID 239
            +   W   +     +   C VL +  I I +   PP K   +   L RID
Sbjct: 184 IETIGWRALFGIQVPVIMLCSVLAIKNINIKLFHVPPMKERYTLKNLSRID 234

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           ++SW + AY L+  TF  + G+L D+FG + L V   L + L +L+ G S
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS 225

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 77  GQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFD 136
            Q+SW + +Y L+   F  + G+L D+FG K L +   L +    +L G + ++  ++  
Sbjct: 67  NQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWML 125

Query: 137 CC-RALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSIFSQ 194
           C  R + G+G   L  NS++ +  +     R++ V+   G      G   GS+  +   Q
Sbjct: 126 CIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGVYQGMGNIVFALGCASGSLIGAFLQQ 183

Query: 195 LAWWPWAY 202
              W WA+
Sbjct: 184 RIGWRWAF 191

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 59/142 (41%), Gaps = 5/142 (3%)

Query: 62  APVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWS 121
           A + +I   F   +  +  W  + YSLT     L+ GR   + G K   +V  L +   S
Sbjct: 140 ASIEVIAEQF--KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 122 LLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGG 181
           L++  S   N +     R + GIG +  + +   ++  T TP + + ++ S+   +    
Sbjct: 198 LISAISNSMNMLIGG--RVVAGIGGSG-IQSLCFVIASTLTPDRSRVIIISVLSCSYAVA 254

Query: 182 FVLGSVFSSIFSQLAWWPWAYW 203
            V+G       +    W W ++
Sbjct: 255 AVVGPFLGGALTTHVTWRWCFY 276

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 81  WFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRA 140
           W  A YSL    F LI GR   L G +    +    + + S+++  +   + +     R 
Sbjct: 97  WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVG--RV 154

Query: 141 LQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPW 200
           + G+G + L   S+ ++G +    K + M+ SI  +      ++G      F+    W W
Sbjct: 155 IAGVGGSGLQTLSL-VIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVIWRW 213

Query: 201 AYW 203
            +W
Sbjct: 214 CFW 216

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 13/118 (11%)

Query: 372 MLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQG 431
           ++I ++ + VG ++  +A   Q  W Q F+  II  WG+      A ++IS   P   +G
Sbjct: 148 LMIVIVLYVVGTIIQISA---QDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 204

Query: 432 LAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489
              S    +V + I   LG+     TR  N  A         W + +GL  L  ++ I
Sbjct: 205 TLISCYQLMVTFGI--FLGYCAVYGTRKYNSSAQ--------WRIPVGLCFLWAMIII 252

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 97/222 (43%), Gaps = 28/222 (12%)

Query: 19  EGESLQLVQSHVEKPQSLMREALFVGILSCAQ------LMTQAGLAQSI-APV-----RI 66
           +G+SLQ   S  EK +          +L+  Q      L+T  G   S+ +P+     R 
Sbjct: 59  DGDSLQ--SSDEEKNEQASESTSPYTLLTYKQKWGMVALLTMCGFWSSLGSPIYYPALRQ 116

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL-LAG 125
           +   FG+ +  +++     Y L  G    I+G L D+FG + + ++G L Y + S+ LA 
Sbjct: 117 LEKQFGL-DENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLAC 175

Query: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185
              Y   +F    R +Q IG +  +  S  ++G      +R   V    GAT+ G  +LG
Sbjct: 176 APSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTLKHERGTFV----GATS-GLVLLG 227

Query: 186 SVFSSIFSQL--AWWPWA--YWAMGTACLVLGVAGIIVIPQA 223
             F S+   +  A W W   +W +   C    +   +++P+ 
Sbjct: 228 QCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 86  YSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL-LAGFSVYSNQIFFDCCRALQGI 144
           Y L  G    I+G L D FG + + + G L Y + S+ LA    Y   IF  C +++ GI
Sbjct: 145 YLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-GI 203

Query: 145 GPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFV-LGSVFSSIFSQL--AWWPWA 201
            P   +  S  ++G      +R   V    GAT+  GFV LG  F S+   +  A W W 
Sbjct: 204 SPTIAI--SSGVVGDFTLKHERGTFV----GATS--GFVLLGQCFGSLIGAVLTARWDWR 255

Query: 202 --YWAMGTACLVLGVAGIIVIPQA 223
             +W +   C    +   +V+P+ 
Sbjct: 256 SIFWFLTIGCGSCFLIAFLVLPET 279

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 57/137 (41%), Gaps = 5/137 (3%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           IG  F   +  ++ W    Y+L    F L+ GRL  + G K       + + + SL+   
Sbjct: 34  IGEKF--KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV 91

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGS 186
           S     I     R + G G +  + + + ++G +    + + MV ++ G      F +G 
Sbjct: 92  SNSMGMIIGG--RVVAGCGGSG-IQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGP 148

Query: 187 VFSSIFSQLAWWPWAYW 203
           V    F++   W W ++
Sbjct: 149 VIGGAFTENVSWRWCFY 165

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 5/137 (3%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           IG  F   N   + W    YSL+   F L+ GR+  L G K   ++  L + + SL+A  
Sbjct: 70  IGEKFNDYN--DVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIA-- 125

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGS 186
           +V ++       R + G G +  + + + I+G +    + + MV  +      G    G 
Sbjct: 126 AVSNSMGMLIAGRVVAGAGGSG-IQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGP 184

Query: 187 VFSSIFSQLAWWPWAYW 203
           +     ++ A W W ++
Sbjct: 185 ILGGALNEHASWRWCFF 201

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 100/235 (42%), Gaps = 24/235 (10%)

Query: 1   MDAELESLEAQFVELKN-EEGESLQLVQSHVE--KPQSLM---REALFVGILSCAQLMTQ 54
           +D  L   + + VE  + E  + ++ ++   E   P +L    ++ + VG+L+     + 
Sbjct: 57  VDGTLSRTQTREVEESDLESADDVKTIKDSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSS 116

Query: 55  AGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGF 114
            G       +R +   F I +   ++     Y L  G    + G L D++G + + + G 
Sbjct: 117 LGSPIYYPALRQLEKQFDI-DENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGM 175

Query: 115 LWYSLWSL-LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSI 173
           L Y + S+ LA  + Y   IF  C   LQ  G + ++  S   +G      +R   V ++
Sbjct: 176 LVYIVASIALACANSYGVIIFLRC---LQSCGISPIIAISSGCVGDFTMKAERGTFVGAV 232

Query: 174 FGATAPGGFVLGSVFSSIF--SQLAWWPWA----YWAMGTACLVLGVAGIIVIPQ 222
            G       +LG  F S+   +  A W W     + A+G  C +    GI+V+P+
Sbjct: 233 SGLV-----LLGQAFGSLIGAALAAAWDWRAIFWFLAIGAGCCLF--VGILVLPE 280

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 95/233 (40%), Gaps = 15/233 (6%)

Query: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65
           E  E   V+LKN       +  S  EK QS +   + + +   A ++ Q  +A  +  V 
Sbjct: 44  EDAEDVPVDLKN-------VFTSDNEKTQSSIMAGMRLYVCLFALVLAQLIVALDVFIVN 96

Query: 66  IIGN--SFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLL 123
            + +  S  +    +  W    YSL      LI GR   L G +   ++    + + S++
Sbjct: 97  TVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIV 156

Query: 124 AGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFV 183
           +  +   N +     R + GIG + L   S+ I+G +    + + +V ++  +      +
Sbjct: 157 SATATSMNNLVVG--RVVAGIGGSGLQTVSM-IIGCSLVEERNRTIVIAVIMSAFAVSSL 213

Query: 184 LGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILE 236
           +G      F+  A W W +W    +  V G A  +      P ++ I+A ++ 
Sbjct: 214 IGPFIGGAFTTHATWRWCFW---ISLPVGGSAAFLFFFTYNPERLSITARLVR 263

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           ++SW + AY L+  TF  I G++ D+FG K + +   + + + SL+ G S
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 11/178 (6%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           +   F  S+  Q  W + ++ LT   F  + G+L D+ G K   +    ++ L  LL  F
Sbjct: 70  VAEEFAESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLTCF 127

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLG 185
           +    Q  F   RA+ G+G   +  N+++ +  +     R++ +F  +     G G VLG
Sbjct: 128 AQNVTQ--FSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQVLG 183

Query: 186 SVFSSIFSQLAWWPWAY---WAMGTACLVLGVAGI-IVIPQAPPPKIDISAGILERID 239
           +    +F     W   +     M   C  L +  + I +   PP K   +   L RID
Sbjct: 184 APLGGLFLDHIGWRTLFGIQVPMIMFCSYLTITNVNIKLLHVPPRKERFTWKNLSRID 241

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 98/224 (43%), Gaps = 29/224 (12%)

Query: 14  ELKNEEGESLQLVQSHVEKPQSLM--REALFVGILSCAQLMTQAGLAQSI-APV-----R 65
           E  ++E E   +V+     P +L+  R+  F+       LMT  G   S+ +P+     +
Sbjct: 61  ECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFM-----VFLMTITGFWSSLGSPIYYPALK 115

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL-LA 124
            +   F I +  +++     Y L  G    I+G L D++G + + + G L + + S+ +A
Sbjct: 116 ELEQKFNI-DENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIA 174

Query: 125 GFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVL 184
               Y   +F  C +++ GI P   + + +      +T  KR++  F   GAT+  G VL
Sbjct: 175 KAPSYGVIVFLRCIQSI-GISPTIAISSGVV---SDFTV-KRERGTF--VGATS--GLVL 225

Query: 185 -----GSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQA 223
                G +  ++ +    W   +W +   C    + G  ++P+ 
Sbjct: 226 IGQGIGPLLGAVITAALHWRAVFWFLTIGCGSCMIIGFFLLPET 269

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           ++SW + AY L+  TF  + G+L D+FG K L ++  + + +  L+ G +
Sbjct: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 11/131 (8%)

Query: 97  AGRLGDLFGHKKLFVVGFLWYSLWSL-LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIA 155
            G L DLFG + + + G L Y++ S+ LA  + Y   +F  C ++  GI P   +  S  
Sbjct: 147 CGGLADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQS-AGISPTISI--SSG 203

Query: 156 ILGRTYTPGKRKQMVFSIFGATAPG---GFVLGSVFSSIFSQLAWWPWAYWAMGTACLVL 212
            +G      +R   V ++ G    G   G ++G+  ++ F+    W   +W +   C V 
Sbjct: 204 AVGDFTVKSERGTFVGAVSGLVLLGQAFGSLIGAALAASFN----WRAIFWFLTIGCGVS 259

Query: 213 GVAGIIVIPQA 223
            +    V+P+ 
Sbjct: 260 MMVAFFVLPET 270

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 19/149 (12%)

Query: 333 SRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPIN 392
           S++++ LL S   +  AI     ++T G I         ++IA I F V GV++  A I+
Sbjct: 111 SKARTGLLVSIFNIGCAI----GSVTLGNIGDIYGRRLGLIIATIIF-VAGVVIEIASID 165

Query: 393 QTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALG-F 451
           +  W Q F+  II   GM +    + ++IS   P E +G   S      ++ + + LG F
Sbjct: 166 K--WYQYFIGRIISGVGMGVVVILSPMLISEVSPKELRGAMVS------SFQLMITLGMF 217

Query: 452 AGTIETRVNNKGANRLEGYRGAWYMGIGL 480
            G        K +N  +     W +G+GL
Sbjct: 218 LGDCTEYGTKKYSNSTQ-----WRVGLGL 241

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 59/129 (45%), Gaps = 7/129 (5%)

Query: 96  IAGRLGDLFGHKKLFVVGFLWYSLWSL-LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSI 154
           ++G L D++G + + + G L Y + S+ +A  + Y   IF  C   LQ  G + L+  S 
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFLRC---LQSTGISPLIAISS 209

Query: 155 AILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPWAYWAMGTAC-LVLG 213
             +G      +R   V ++ G    G    GS+  +  +    W   +W +   C   + 
Sbjct: 210 GAVGDFTVKAERGTFVGAVSGLVLMGQ-AFGSLIGAALAAAYNWRAIFWFLAIGCGACMA 268

Query: 214 VAGIIVIPQ 222
           +AG IV+P+
Sbjct: 269 IAG-IVLPE 276

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 81/202 (40%), Gaps = 11/202 (5%)

Query: 4   ELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSI-- 61
           ++ES+     +  + + ES      HV  PQ L    L+  + S   ++  A L   I  
Sbjct: 7   DIESMGVIVEDRSSAQDES----SGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMS 62

Query: 62  APVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWS 121
           A + +I   F  ++  +  W  + YSL      L+ GR   +FG K   ++  L +   S
Sbjct: 63  ASIEVISEQF--NDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGS 120

Query: 122 LLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGG 181
           L++  S   N +     R + GIG +  + +   ++  T T  + + +  S+        
Sbjct: 121 LISAVSNSMNVLIGG--RVVAGIGGSG-IQSLCFVIASTLTTERSRGVAISVLSCAYAVA 177

Query: 182 FVLGSVFSSIFSQLAWWPWAYW 203
            V G      F+    W W ++
Sbjct: 178 AVAGPFMGGAFTTHVTWRWCFY 199

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 60/137 (43%), Gaps = 20/137 (14%)

Query: 64  VRIIGNSFGIS-NPGQLSWFSAAYSLTVGTFILIA----GRLGDLFGHKKLFVVGFLWYS 118
           V  +   F I+ N  Q+S +S   S T      +A    GR  D +G K   ++G L   
Sbjct: 44  VYFMVKDFNIAPNEAQVSRYSGYLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTC 103

Query: 119 LWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIA----ILGRTYTPGKRKQMVFSIF 174
           +  L+ GFS +  Q      R++ G     LL  +IA    I+G   T G+ + + FS  
Sbjct: 104 ISLLILGFSKHFYQAMI--ARSMMG-----LLNGNIAVIRTIVGELTTEGRHQAIAFS-- 154

Query: 175 GATAPGGFVLGSVFSSI 191
             T P  F  G+V  SI
Sbjct: 155 --TIPLLFQFGTVIGSI 169

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           ++SW + +Y L+  TF  + G++ D+FG K L V   + + +  L+ G S
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS 196

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 96  IAGRLGDLFGHKKLFVVGFLWYSLWSL-LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSI 154
           I+G L D++G + + ++G L Y   S+ LA    Y   +F  C   LQ  G + ++  + 
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRC---LQSAGISPIIAINS 197

Query: 155 AILGRTYTPGKRKQMVFSIFGATAPG---GFVLGSVFSSIFSQLAWWPWAYWAMGTACLV 211
            ++G      +R   V ++ G T  G   G ++G+  ++ F     W   +W +   C  
Sbjct: 198 GVVGDFTLKHERGTFVGAVSGFTLMGQAFGSLIGAALTAAFD----WRAIFWFLTIGCGT 253

Query: 212 LGVAGIIVIPQA 223
             +   +++P+ 
Sbjct: 254 CMIINFLILPET 265

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 79  LSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           +SW +A+Y L+   F  + G+L D+FG K + +   L + L  L+ G
Sbjct: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG 235

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%)

Query: 77  GQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           G + W    Y+L+   F+L+ GRL ++ G K+  ++  + + + SL++  S
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS 93

>KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {ON}
           uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g jen2
           Carboxylic acid permease
          Length = 528

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 46/96 (47%), Gaps = 7/96 (7%)

Query: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQGI--GPAFLLPN 152
           LI G LGD +G K  FV+      +  +  GF V S   F   CRA+ GI  G  F + +
Sbjct: 132 LIFGYLGDRYGRKYSFVLTMALIIVIQIGTGF-VNSFSAFLG-CRAIFGIIMGSVFGVAS 189

Query: 153 SIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVF 188
           + A+      P K K ++  IF      G++LG VF
Sbjct: 190 ATAL---ENAPNKAKSILSGIFQEGYAFGYLLGVVF 222

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125
           Q+SW + +Y L+   F  + G+L D+FG K L V   L +++   L G
Sbjct: 77  QMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG 124

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 80/201 (39%), Gaps = 11/201 (5%)

Query: 5   LESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSI--A 62
           +ES+     +  + + ES      HV  PQ L    L+  + S   ++  A L   I  A
Sbjct: 8   IESMGVIVEDRSSAQDES----SGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSA 63

Query: 63  PVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL 122
            + +I   F  ++  +  W  + YSL      L+ GR   +FG K   ++  L +   SL
Sbjct: 64  SIEVISEQF--NDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSL 121

Query: 123 LAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGF 182
           ++  S   N +     R + GIG +  + +   ++  T T  + + +  S+         
Sbjct: 122 ISAVSNSMNVLIGG--RVVAGIGGSG-IQSLCFVIASTLTTERSRGVAISVLSCAYAVAA 178

Query: 183 VLGSVFSSIFSQLAWWPWAYW 203
           V      S F+    W W ++
Sbjct: 179 VASPFMGSAFTTHVTWRWCFY 199

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 76/174 (43%), Gaps = 21/174 (12%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIF-FD 136
           ++ W + ++ LT   F  I G+L D+ G + + V+    YSL+ L    + Y+  I+ F 
Sbjct: 83  RIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLA---YSLFLLGCLVTAYARNIWEFA 139

Query: 137 CCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLGSVFSSIFSQL 195
             RA+ GIG   +    +  +G  ++   ++Q ++  +       G VLG+    I  + 
Sbjct: 140 FGRAICGIGAGGIPTMCVITMGDMFSV--KEQSIYQSYAHIIYTIGEVLGAPIGGIALET 197

Query: 196 AWWPWAYWA---MGTACLVLGVAGIIVIPQAPPP-----------KIDISAGIL 235
             W   + A   + T C+ L +    +  Q  PP           ++D+S  IL
Sbjct: 198 VGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRMDLSGSIL 251

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 372 MLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQG 431
           +++A I F +G VL+    +++  W Q F+  II   GM +    + ++IS   P E +G
Sbjct: 146 LILATIIFVIG-VLIEITSVDK--WYQYFIGRIIAGIGMGLIAVLSPMLISEVAPKELRG 202

Query: 432 LAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGL 483
              S    ++ + I   LG      T+  +  A         W +G+GL  L
Sbjct: 203 AMVSCYQLMITFGI--FLGNCCNYGTKSYSNSAQ--------WRIGVGLQFL 244

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 81  WFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRA 140
           W    YSL    F L+ GRL  + G +   +   + +   SL++  +   N +     R 
Sbjct: 83  WIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLI--SGRV 140

Query: 141 LQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPW 200
           + G+G + L   S+ I G      K + +V S+   T     ++G      F+    W W
Sbjct: 141 IAGVGGSGLQTLSLVI-GCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRW 199

Query: 201 AYW 203
            ++
Sbjct: 200 CFY 202

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 77  GQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127
           G + W    Y+LT   F+L+ GRL ++ G  +  ++  + + + SL++  S
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALS 93

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDC 137
           ++ W + +Y L+   F  + G+L D+FG K L +   L +    ++ G S   N + +  
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWG- 491

Query: 138 CRALQGIG 145
            R + GIG
Sbjct: 492 -RFVAGIG 498

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 84/199 (42%), Gaps = 8/199 (4%)

Query: 28  SHVEK-PQSLMREA---LFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFS 83
           S + K P S++R +   + V +L+ A   +  G       +R +   FG+S    ++   
Sbjct: 53  SEISKIPHSMLRYSQKWMMVALLTSAGFWSSLGSPAVYPALRNLQREFGVSE-DLVNIAV 111

Query: 84  AAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCCRALQG 143
             Y L  G    +   L D +G + + ++G L + + S+  G +  ++       R +Q 
Sbjct: 112 VVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSI--GIACSNSFALVIALRCIQS 169

Query: 144 IGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPWAYW 203
            G + ++  +  ++G      +R   + ++ G T  G    GS+  +  +    W   +W
Sbjct: 170 SGISPIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQ-AFGSLIGASLTAAYNWRAVFW 228

Query: 204 AMGTACLVLGVAGIIVIPQ 222
            M   C V  +A  + +P+
Sbjct: 229 FMTIGCGVCFLANFLFLPE 247

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 79  LSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFFDCC 138
           ++W + AY LT      + G++ D+ G +K  + G + ++L  LL  F+    Q+     
Sbjct: 97  VTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLCNFANTIPQLAI--A 154

Query: 139 RALQGIG 145
           RA+ GIG
Sbjct: 155 RAICGIG 161

>Suva_9.18 Chr9 complement(20639..22267) [1629 bp, 542 aa] {ON}
           YIL166C (REAL)
          Length = 542

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 14/116 (12%)

Query: 119 LWSLL----AGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIF 174
           LWS++    AG     N+  F   R L GI     +P++I  L   YT G       S F
Sbjct: 155 LWSIICITQAGLK---NKAQFIATRCLLGIVQGGFIPDNILYLSYYYT-GAELTFRLSFF 210

Query: 175 GATAPGGFVLGSVFSSIFSQ------LAWWPWAYWAMGTACLVLGVAGIIVIPQAP 224
               P   +LGS+F+S   +      LA W + +   G   L +GVA   ++ + P
Sbjct: 211 WCAIPLFQILGSLFASGVLEMRGIHGLAGWQYLFIIEGFISLAVGVASFYLMRRGP 266

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 72/178 (40%), Gaps = 11/178 (6%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           +   F  S+  Q  W + ++ LT   F  + G+L D+ G K   +    ++ L   L  F
Sbjct: 67  VAEEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCF 124

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPG-GFVLG 185
           +    Q  F   RA+ GIG   +  N+++ +  +     R++ ++  +     G G +LG
Sbjct: 125 AQNITQ--FSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQLLG 180

Query: 186 SVFSSIFSQLAWWPWAYWA---MGTACLVLGVAGIIV-IPQAPPPKIDISAGILERID 239
           +    +F     W   +     M   C  L    I V +   PP K   +   L RID
Sbjct: 181 APLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERFTWKNLSRID 238

>Suva_16.289 Chr16 (501426..502622) [1197 bp, 398 aa] {ON} YPL028W
           (REAL)
          Length = 398

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 75/190 (39%), Gaps = 25/190 (13%)

Query: 324 FYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTV-- 381
           F    + +  +SQ     +++ VPV I G      T       PA   +     A TV  
Sbjct: 181 FAIESYQKSQKSQKEGKFNSEIVPVTIKGFRGKPDTQVTNDEEPARLHVEKLKSARTVFQ 240

Query: 382 ---GGVLVATA-PINQTYWAQTFVS------------LIIMPWGMDMSFPAA-TIMISNA 424
              G V  A A PIN    A   VS             +I  WG     PA  T   S A
Sbjct: 241 RENGTVTAANASPINDGAAAIILVSERVLKEKNLKPLALIKGWGEAAHLPADFTWAPSLA 300

Query: 425 MPH--EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMG--IGL 480
           +P   +H G+    +N+V  +  + A    G + T++     +++  Y GA  +G  +G 
Sbjct: 301 VPKALKHAGIED--INSVDYFEFNEAFSVVGLVNTKILKLDPSKVNVYGGAVALGHPLGC 358

Query: 481 SGLGVLVAIV 490
           SG  V+V ++
Sbjct: 359 SGARVVVTLL 368

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 77/185 (41%), Gaps = 25/185 (13%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           I   F  S+  Q  W + +Y LT   F  + G+L D+ G K   +    +++L  LL  F
Sbjct: 69  IAAEFAESDKKQ--WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLLTCF 126

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFS-----IFGA----T 177
           +    Q  F   RA+   G      N+++ +  T     R++ V+      +FG      
Sbjct: 127 AQNVTQ--FSIARAI--CGIGGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQLLG 182

Query: 178 AP-GGFVLGSV-FSSIFSQLAWWPWAYWAMGTACLVLGVAGI-IVIPQAPPPKIDISAGI 234
           AP GGF+L S+ + SIF            M   C VL +  + I +   PP     +   
Sbjct: 183 APIGGFLLDSIGWRSIFGIQV-------PMLMLCSVLALKNVNIKLVHIPPRNERFTWKN 235

Query: 235 LERID 239
           L RID
Sbjct: 236 LSRID 240

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 13/148 (8%)

Query: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIF--FDCCRALQGI---GPAFL 149
           +I   L +L+G K + VV  L ++L+     F+V + + F     CR   G     P  +
Sbjct: 247 IIYAPLSELYGRKGVLVVSGLGFALFQ----FAVATAENFQTIMICRFFAGFIGAAPMAI 302

Query: 150 LPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQLAWWPWAYWAMGTAC 209
           +P   A +  T   GK       +F      G +LG V  S   Q   W W  + +G   
Sbjct: 303 VPAVFADMFDTDFRGK----AICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQA 358

Query: 210 LVLGVAGIIVIPQAPPPKIDISAGILER 237
             + VA ++ + +   P I ++   L R
Sbjct: 359 CAVFVAIVLFVEETHHPTILVNKAKLLR 386

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           IG+ F  ++  ++SW + +Y L+  T   + G+L D  G K L V   + +S+  L+ G 
Sbjct: 109 IGSEF--NSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166

Query: 127 S 127
           S
Sbjct: 167 S 167

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 57/140 (40%), Gaps = 11/140 (7%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           +   FG  +  +  W  A YSL      LI GR+  + G K   +   + + + SL+A  
Sbjct: 82  VAREFG--DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAAL 139

Query: 127 SVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVF---SIFGATAPGGFV 183
           +   + +     R + G+G + +      I+       KR  ++    S FG  +  G  
Sbjct: 140 ANSMDMLIGG--RVIAGLGGSGIQTLCFVIISTLVEESKRGLLIACMGSAFGIASVVGPF 197

Query: 184 LGSVFSSIFSQLAWWPWAYW 203
           LG  F++  +    W W +W
Sbjct: 198 LGGAFTTHVT----WRWCFW 213

>YPL028W Chr16 (498096..499292) [1197 bp, 398 aa] {ON}
           ERG10Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA
           thiolase), cytosolic enzyme that transfers an acetyl
           group from one acetyl-CoA molecule to another, forming
           acetoacetyl-CoA; involved in the first step in
           mevalonate biosynthesis
          Length = 398

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 73/190 (38%), Gaps = 25/190 (13%)

Query: 324 FYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTV-- 381
           F    + +  +SQ       + VPV I G      T       PA   +     A TV  
Sbjct: 181 FAIESYQKSQKSQKEGKFDNEIVPVTIKGFRGKPDTQVTKDEEPARLHVEKLRSARTVFQ 240

Query: 382 ---GGVLVATA-PINQTYWAQTFVS------------LIIMPWGMDMSFPAA-TIMISNA 424
              G V  A A PIN    A   VS             II  WG     PA  T   S A
Sbjct: 241 KENGTVTAANASPINDGAAAVILVSEKVLKEKNLKPLAIIKGWGEAAHQPADFTWAPSLA 300

Query: 425 MPH--EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMG--IGL 480
           +P   +H G+    +N+V  +  + A    G + T++     +++  Y GA  +G  +G 
Sbjct: 301 VPKALKHAGI--EDINSVDYFEFNEAFSVVGLVNTKILKLDPSKVNVYGGAVALGHPLGC 358

Query: 481 SGLGVLVAIV 490
           SG  V+V ++
Sbjct: 359 SGARVVVTLL 368

>KLLA0A07249g Chr1 complement(649905..651431) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q08268 Saccharomyces cerevisiae
           YOL119C MCH4 Protein with similarity to mammalian
           monocarboxylate permeases which are involved in
           transport of monocarboxylic acids across the plasma
           membrane mutant is not deficient in monocarboxylate
           transport
          Length = 508

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 47/247 (19%), Positives = 96/247 (38%), Gaps = 41/247 (16%)

Query: 2   DAELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREAL-----FVGILSCAQLMTQAG 56
           D ++        E    EG+ L L+  H + P   ++  L     F+G++    L+   G
Sbjct: 67  DKQVTGPHESTREFAEAEGDPL-LLDDHSKFPDGGLKAWLVVFGSFIGLIPVFGLVNSIG 125

Query: 57  LAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLW 116
             +S   +  +    G+S+P  +SW  + Y  T  T  ++AG   D  G +   + G + 
Sbjct: 126 AIESYISINQLA---GVSSP-VISWIFSLYLCTTFTSCILAGGYFDRNGSRDPMIFGMIM 181

Query: 117 Y-----------SLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK 165
           +           ++W  +  FSV            + G     L+   ++++   +   K
Sbjct: 182 FTGGLIATANCTTVWQFILAFSV------------VVGFASGILMIPLVSVVATFFI--K 227

Query: 166 RKQMVFSIFGATAPGGFVLGSVFSSIFSQL---AWWPWAYWAMGTACLVLGVAGIIVIPQ 222
           ++ +  SI      GG + G VF  +  +L     + WA   +   C V  +   +++ +
Sbjct: 228 KRAIATSI---ATTGGSIGGIVFPILLRKLYTKVGFQWALRILALICAVCLIFATVMVKE 284

Query: 223 APPPKID 229
              P+ +
Sbjct: 285 REKPETE 291

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 81/186 (43%), Gaps = 31/186 (16%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           IG+ F  ++  + SW + +Y L+  T   + G+L D  G K L V     +++  L+ G 
Sbjct: 113 IGSEF--NSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170

Query: 127 SVYSNQIFFDCC-RALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFS-----IFG-ATAP 179
              SN I+     R + GIG   L   S+A +  +     R + V+      +FG  TA 
Sbjct: 171 ---SNSIWAVVAGRFISGIGGCGL--TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTAS 225

Query: 180 GGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVI------PQAPPPKIDISAG 233
           GG V G+ F         W  A+      C +  ++GI+++      P+A     D  + 
Sbjct: 226 GGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWSA 274

Query: 234 ILERID 239
            L R+D
Sbjct: 275 RLRRLD 280

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 139 RALQGIG---PAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQL 195
           R L G+    P  L+  S++ + R     K + +  S+F A    G V+G +  S+ S  
Sbjct: 235 RFLDGLAFSAPMCLIGGSLSDMWR----NKERGVAMSVFSAAPFMGPVMGPIVGSLLSVK 290

Query: 196 AWWPWAYWAM--GTACLVLGVAGIIVI 220
             W W YW M   +ACL     G++V+
Sbjct: 291 CSWRWVYWFMLIFSACLY----GVMVV 313

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           +   F  S+  Q  W + +Y LT   F  + G+L DL G K   +    ++ L  LL  F
Sbjct: 64  VAEEFQESDKKQ--WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCF 121

Query: 127 SVYSNQIFFDCCRALQGIG 145
           +    Q  F   RA+ G+G
Sbjct: 122 ANSVTQ--FAIARAICGVG 138

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 67/162 (41%), Gaps = 14/162 (8%)

Query: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL-LA 124
           +I N F I+    ++     Y +  G    I G L D  G + + +   L Y    + LA
Sbjct: 104 VIENEFNITEE-MVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSSVLVYCCACIGLA 162

Query: 125 GFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVL 184
               Y+  I   C +A  GI P   + NS  I+G   T  +R   V  + G       V+
Sbjct: 163 CSHTYAQIIVLRCLQA-AGISPVIAI-NS-GIMGDITTRAERGGYVGYVSGFQ-----VI 214

Query: 185 GSVFSSIFSQ--LAWWPWA--YWAMGTACLVLGVAGIIVIPQ 222
           GS F ++      A W W   +W +     V  VA II++P+
Sbjct: 215 GSAFGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPE 256

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126
           +   F  SN  Q  W + +Y LT   F  + GRL D+ G K   ++   ++ + S L  F
Sbjct: 93  VAEDFNASNQKQ--WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTF 150

Query: 127 S 127
           S
Sbjct: 151 S 151

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 56/140 (40%), Gaps = 5/140 (3%)

Query: 64  VRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLL 123
           +  +  SFG  +  +  W    YSL    F L+ GR+    G +   V   + +   SL+
Sbjct: 67  IDTVCKSFG--DYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLI 124

Query: 124 AGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFV 183
           +  +   N +     R + G+G + L   S+ I G      K + +V S+   T     +
Sbjct: 125 SALARSMNMLI--AGRVVSGVGGSGLQTLSLVI-GCQLVDEKSRPLVLSLLNCTFAIASI 181

Query: 184 LGSVFSSIFSQLAWWPWAYW 203
           +G      F+    W W ++
Sbjct: 182 IGPFIGGAFTTHVTWRWCFY 201

>KLTH0A07832g Chr1 complement(660003..661517) [1515 bp, 504 aa] {ON}
           weakly similar to uniprot|P15365 Saccharomyces
           cerevisiae YJR152W DAL5 Allantoin permease;
           ureidosuccinate permease; expression is constitutive but
           sensitive to nitrogen catabolite repression
          Length = 504

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 102/248 (41%), Gaps = 39/248 (15%)

Query: 2   DAELESLEAQFVE----LKNEEG---ESLQLVQSHVEKPQSLMRE-ALFVGILSCAQLMT 53
           +AE+ S  +  +E    + NE+    E L+ V    E+ ++L+R+  L++  L C   ++
Sbjct: 15  EAEISSRSSSLIEKPDKITNEDALNDEYLETVTFTAEEEKALVRKIDLYILPLMCFVFLS 74

Query: 54  QAGLAQSIAPVRIIGNSFGIS-NPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVV 112
           Q    QS++   I G +  +      +SW S  +S+         G+LG  F    L  +
Sbjct: 75  QYLDKQSLSYATIFGLTKDLKMGQHDISWCSTIFSI---------GQLGANFVFTYLMTI 125

Query: 113 G----------FLWYSLWSLLAGFSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYT 162
                       +W      LA  +       F   R   GI  A + P  + I   +Y 
Sbjct: 126 VPRAPMTGACVVIWSVCCMCLAAPTTKEG---FWVGRLFLGIFEAVVQPACVLI--TSYW 180

Query: 163 PGKRKQMVFSI----FGATAP--GGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAG 216
             KR+Q + +       A A   G F++  +  +  S +A W   + A G   LV G+A 
Sbjct: 181 YRKREQPLRTACWISMNAIAQIVGSFLMYGIGKTNKSSVADWKLMFIACGVISLVAGIAF 240

Query: 217 IIVIPQAP 224
            ++IP +P
Sbjct: 241 YLLIPVSP 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,407,135
Number of extensions: 1685209
Number of successful extensions: 5895
Number of sequences better than 10.0: 213
Number of HSP's gapped: 5823
Number of HSP's successfully gapped: 228
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)