Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_23.6537na 1ON55255229720.0
KLTH0C10516gna 1ON56155316690.0
Suva_8.436na 1ON54555016210.0
Skud_15.546na 1ON54255315700.0
YOR380W (RDR1)na 1ON54655415320.0
Smik_15.561na 1ON54655515030.0
SAKL0D13464g2.565ON6873872189e-18
KLTH0D07898g2.565ON6723792001e-15
KNAG0M021202.565ON6083791511e-09
KAFR0A021302.565ON7074321465e-09
SAKL0C03938g1.128ON780591431e-08
SAKL0A02860g6.279ON7452491296e-07
TPHA0F013802.231ON890441297e-07
ZYRO0E06270g2.565ON912881271e-06
TDEL0C044802.231ON852741261e-06
SAKL0E08998g2.231ON823411242e-06
KLLA0F04609g2.231ON916401242e-06
Kpol_1039.112.231ON992381243e-06
KLTH0G09108g2.231ON782401233e-06
Kwal_23.47542.231ON812401233e-06
NDAI0D034804.121ON7082721224e-06
NCAS0A127202.565ON7594151206e-06
AER370W2.231ON801381191e-05
YOR337W (TEA1)7.56ON759511181e-05
KAFR0F014901.128ON658441181e-05
Skud_7.2744.113ON1080811181e-05
TBLA0G026102.231ON1000381181e-05
KAFR0J017102.231ON848821181e-05
NCAS0E023107.56ON718461172e-05
Smik_10.251.128ON772751172e-05
NCAS0B065502.231ON906381172e-05
YMR019W (STB4)2.565ON9493571172e-05
KNAG0I005601.128ON663531162e-05
NDAI0B038502.231ON930381162e-05
CAGL0A00451g4.113ON1107451162e-05
YIL130W (ASG1)2.231ON964371162e-05
Smik_9.392.231ON1012371162e-05
Suva_9.592.231ON926371162e-05
Skud_9.372.231ON954371153e-05
KNAG0E017602.231ON902381153e-05
Suva_13.1862.565ON8941111153e-05
Ecym_53972.231ON826381143e-05
CAGL0G08844g2.231ON847381144e-05
Suva_8.3877.56ON759511144e-05
Smik_13.1832.565ON9112941144e-05
Skud_15.5027.56ON759381134e-05
Smik_15.5157.56ON759381134e-05
NCAS0G011006.279ON9352021135e-05
NDAI0A034204.113ON1108381135e-05
NCAS0A035804.113ON1113631135e-05
Kpol_1071.107.56ON698361126e-05
KLLA0D11286gna 2ON6782301127e-05
TBLA0E019007.56ON840521118e-05
SAKL0B01870gsingletonON10091121101e-04
TPHA0N004407.56ON757901101e-04
KAFR0B028208.283ON664361101e-04
YJL206C1.128ON758451091e-04
KLLA0F02387g7.56ON727521091e-04
Skud_13.1732.565ON9201211091e-04
TPHA0E012905.322ON852661091e-04
NDAI0F012206.279ON9601781091e-04
SAKL0H00660gsingletonON912721092e-04
SAKL0H00682gna 3ON922721092e-04
TPHA0F008304.113ON1192841092e-04
YGL013C (PDR1)4.113ON1068821092e-04
KNAG0G021308.283ON6323711072e-04
ZYRO0D06688g8.283ON595501072e-04
KNAG0E004507.56ON710381073e-04
Suva_1.147.17ON1045741073e-04
KLLA0C14212gna 3ON10401481073e-04
Smik_11.3261.199ON865791063e-04
ZYRO0C18150g1.128ON571411063e-04
NCAS0A03570na 4ON978511064e-04
TDEL0H043407.17ON989751054e-04
Skud_5.331singletonON170881005e-04
TPHA0C010808.283ON5913601045e-04
Smik_7.2774.113ON1069441046e-04
KAFR0F034104.113ON995381046e-04
KNAG0C059804.113ON968551046e-04
KLTH0D02222gna 5ON847411046e-04
AFL033W6.154ON382411036e-04
KAFR0C03730singletonON791811046e-04
Skud_10.101.128ON833451037e-04
NDAI0B015402.565ON803371037e-04
ZYRO0C00726g7.17ON1035671038e-04
CAGL0M03025g8.845ON12541661020.001
KLLA0A06039g1.199ON657471010.001
YBR240C (THI2)6.154ON450491010.001
ZYRO0G22550gsingletonON724391010.001
Smik_5.9singletonOFF5636890.001
YBL005W (PDR3)4.113ON976411010.001
ZYRO0G10252g4.113ON1036401010.001
KLLA0A09119g4.113ON1082771010.001
Kwal_47.175064.113ON924451010.001
Skud_1.107.17ON1040671010.002
Smik_18.3singletonON704481000.002
TPHA0N002307.17ON1232811010.002
SAKL0D01342g8.845ON1270511010.002
Suva_7.2684.113ON1000441000.002
YAL051W (OAF1)7.17ON1047671000.002
KNAG0D035204.113ON1030471000.002
Smik_12.1578.283ON64446990.002
Kpol_2001.161.199ON80234990.002
Smik_2.1154.113ON97141990.002
KNAG0D034504.121ON688272990.002
KNAG0E002107.17ON94884990.003
KLTH0E07854g4.113ON93849990.003
TDEL0H039507.56ON66238980.003
TBLA0C062306.60ON79538980.003
KLLA0E13993gsingletonON67842980.003
Suva_16.25singletonON14377920.003
Suva_6.2851.128ON786354980.003
SAKL0D14542gna 6ON94678980.003
ZYRO0E08272g6.279ON794170970.004
KLTH0F03014gsingletonON61241970.004
Kpol_1023.415.322ON81559970.004
CAGL0E05434g7.56ON81644970.004
NDAI0E038507.56ON76845970.004
KLLA0F22990g1.380ON125349970.004
NDAI0A010401.199ON99570970.004
KLLA0D12672g6.279ON865182970.004
KNAG0E041507.17ON113672970.005
ZYRO0D04422g7.56ON76436960.005
KLTH0E08140g4.121ON632185960.005
Smik_3.209singletonON83241960.005
Ecym_42868.283ON62738960.005
CAGL0L09691g2.654ON82446960.005
TDEL0B005308.845ON130148960.005
Skud_2.1064.113ON101072960.006
AGR061C8.283ON61251960.006
NCAS0B051108.283ON62744950.006
KLTH0D01804g7.56ON65245950.006
KAFR0E013005.322ON82770960.006
CAGL0F09229gna 7ON83548960.006
YKR064W (OAF3)1.199ON86391950.007
KLTH0H01672gna 8ON70138950.007
Kwal_26.7095na 5ON83871950.007
Skud_3.181singletonON83141950.007
Suva_2.1214.113ON97145950.007
TBLA0E007007.17ON127469950.007
TBLA0C033905.322ON110652950.007
KLLA0C18953gna 9ON70345950.007
Ecym_72354.113ON94339950.008
Kwal_23.35142.340ON579281940.008
SAKL0D14520g7.17ON98371940.009
Kpol_1033.158.283ON59439940.009
KLTH0B09262gsingletonON82034940.010
KLTH0E05786gna 7ON81732940.010
ZYRO0G15136g1.277ON102744940.010
NDAI0C034505.59ON776232940.010
Smik_1.137.17ON104667940.010
Skud_11.3001.199ON86582930.011
Kpol_1061.424.113ON112941930.011
YKL015W (PUT3)2.654ON97940930.011
TBLA0C040004.121ON672311930.011
KLLA0A03443g7.17ON97539930.012
ADR365W7.56ON70136930.012
TDEL0H007901.199ON82775930.012
Kwal_56.230583.264ON775119930.013
NDAI0A087907.17ON105973930.013
CAGL0L03377g1.277ON120943930.013
Kwal_47.17681na 10ON854217930.013
KLLA0C03201g1.128ON65081920.014
Skud_2.3726.154ON45249920.014
KLTH0G13200g8.283ON566105920.014
Kwal_56.24566na 8ON75538920.014
ABL099W3.264ON80044920.014
SAKL0G09768g5.322ON77746920.015
KLLA0C19228gsingletonON59130920.015
SAKL0B10538g7.56ON70138920.015
KLTH0H02684g6.279ON749193920.015
SAKL0H16544g8.283ON59937920.016
TBLA0G005106.60ON93564920.016
ZYRO0G14278g8.845ON125040920.017
Smik_2.3836.154ON44849910.017
KLLA0A02585gna 11ON37045910.017
AAL057C5.322ON80951910.018
SAKL0D01100g4.113ON94061920.018
KAFR0E023305.59ON704210910.019
NCAS0H034202.654ON90240910.019
KNAG0H002502.654ON89639910.019
Smik_15.5477.17ON99565910.020
Kwal_26.68057.17ON94481910.020
Kwal_23.6425na 12ON73545910.020
KLLA0D10153gsingletonON65541910.020
TBLA0A04280singletonON89276910.021
KNAG0M006206.154ON45948900.021
Ecym_7440na 13ON89852910.022
KLTH0E00440gsingletonON68832910.022
KLTH0B10076gsingletonON68832910.022
TBLA0C040504.113ON120748910.022
KAFR0C039002.654ON81837910.022
TBLA0H006808.423ON88093910.023
TBLA0C011201.380ON148643910.023
NCAS0D04860singletonON70141900.024
KLLA0F04213g3.264ON76847900.025
Suva_15.425singletonON64439900.025
TBLA0A012101.380ON142243900.026
Ecym_33922.654ON84744900.027
SAKL0D00264g8.879ON84852900.027
CAGL0B03421g1.380ON135543900.030
SAKL0B10648gna 14ON732125900.030
Suva_16.596.279ON895188900.032
KLLA0F19602g8.283ON60345890.032
SAKL0C09944g3.109ON106147890.033
NCAS0A016304.113ON104391890.034
NDAI0I021906.61ON73550890.034
SAKL0G19470g2.654ON83180890.035
NDAI0D035504.113ON111858890.036
SAKL0B06732gna 13ON87836890.037
TDEL0D00260singletonON64732880.039
KLTH0C03762g8.845ON120650890.039
ZYRO0G17512gsingletonON52330880.040
KAFR0B039508.845ON124643890.040
Skud_7.627na 15ON47486880.044
TDEL0D051503.109ON99645880.044
SAKL0B04620gna 11ON36236870.045
NCAS0C003908.845ON116475880.045
Ecym_32005.322ON82546880.046
KLTH0C10098g6.60ON77143880.051
TDEL0B063602.547ON98197880.052
KLTH0E14454gna 13ON90239880.052
YCR106W (RDS1)na 16ON83240880.052
KNAG0C011601.199ON83532880.052
Smik_16.20na 15ON47338870.054
NCAS0C047803.109ON91452870.057
YMR280C (CAT8)8.845ON143352880.058
TDEL0B004808.879ON83545870.058
NCAS0I002707.17ON94477870.058
Suva_4.4996.154ON45048870.059
SAKL0C00242gna 7ON83372870.060
ADR404Cna 6ON87542870.061
KAFR0G005701.199ON86283870.062
Ecym_22636.154ON50843870.062
KLTH0D03564g1.277ON86241870.062
ACL096W2.654ON83541870.062
TPHA0A045403.109ON117849870.065
CAGL0F02519g1.128ON83250870.066
KLTH0H16170gna 17ON61941870.066
SAKL0A00704gna 12ON71842870.067
Smik_6.4526.279ON878323870.067
Ecym_51313.264ON77044870.069
Ecym_46168.845ON157737870.070
Kpol_1042.76.61ON78358860.073
NDAI0C002602.654ON104177860.077
Suva_13.3482.340ON60834860.078
Smik_13.4938.845ON143352860.078
KLLA0E18129g2.654ON86546860.078
TBLA0G00490singletonON91858860.078
Ecym_83278.642ON41254850.078
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.6537
         (552 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...  1149   0.0  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...   647   0.0  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...   629   0.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...   609   0.0  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...   594   0.0  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...   583   0.0  
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    89   9e-18
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    82   1e-15
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    63   1e-09
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    61   5e-09
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    60   1e-08
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    54   6e-07
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   7e-07
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    54   1e-06
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    53   1e-06
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    52   2e-06
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    52   2e-06
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    52   3e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    52   3e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    52   3e-06
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    52   4e-06
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    51   6e-06
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    50   1e-05
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    50   1e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    50   1e-05
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    50   1e-05
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    50   1e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    50   1e-05
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      50   2e-05
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    50   2e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   2e-05
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    50   2e-05
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    49   2e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    49   2e-05
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    49   2e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    49   2e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    49   2e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    49   2e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    49   3e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   3e-05
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    49   3e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    49   3e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   4e-05
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    49   4e-05
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    49   4e-05
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    48   4e-05
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    48   4e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    48   5e-05
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    48   5e-05
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    48   5e-05
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    48   6e-05
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    48   7e-05
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    47   8e-05
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    47   1e-04
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    47   1e-04
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    47   1e-04
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    47   1e-04
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    47   1e-04
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    47   1e-04
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    47   1e-04
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    47   1e-04
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    47   2e-04
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    47   2e-04
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    47   2e-04
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    47   2e-04
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    46   2e-04
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    46   2e-04
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    46   3e-04
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    46   3e-04
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    46   3e-04
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    45   3e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    45   3e-04
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    45   4e-04
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    45   4e-04
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    43   5e-04
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    45   5e-04
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    45   6e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    45   6e-04
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    45   6e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    45   6e-04
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    44   6e-04
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               45   6e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    44   7e-04
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    44   7e-04
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   8e-04
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    44   0.001
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    44   0.001
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    44   0.001
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    44   0.001
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    39   0.001
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    44   0.001
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    44   0.001
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    44   0.001
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    44   0.001
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    44   0.002
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    43   0.002
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    44   0.002
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    44   0.002
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    43   0.002
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    43   0.002
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    43   0.002
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    43   0.002
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    43   0.002
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    43   0.002
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     43   0.002
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    43   0.003
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    43   0.003
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    42   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    42   0.003
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    42   0.003
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.003
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    42   0.003
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    42   0.003
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    42   0.004
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    42   0.004
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    42   0.004
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    42   0.004
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      42   0.004
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    42   0.004
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    42   0.004
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    42   0.004
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    42   0.005
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    42   0.005
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    42   0.005
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    42   0.005
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    42   0.005
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    42   0.005
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    42   0.005
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    42   0.006
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    42   0.006
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    41   0.006
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    41   0.006
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    42   0.006
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.006
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    41   0.007
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    41   0.007
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.007
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    41   0.007
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    41   0.007
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    41   0.007
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    41   0.007
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    41   0.007
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    41   0.008
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    41   0.008
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    41   0.009
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    41   0.009
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    41   0.010
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    41   0.010
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    41   0.010
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      41   0.010
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    41   0.010
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    40   0.011
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    40   0.011
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    40   0.011
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    40   0.011
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    40   0.012
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    40   0.012
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    40   0.012
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    40   0.013
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    40   0.013
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    40   0.013
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    40   0.013
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    40   0.014
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    40   0.014
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    40   0.014
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    40   0.014
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    40   0.014
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    40   0.015
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    40   0.015
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    40   0.015
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    40   0.015
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    40   0.016
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    40   0.016
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    40   0.017
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    40   0.017
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    40   0.017
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    40   0.018
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    40   0.018
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    40   0.019
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    40   0.019
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    40   0.019
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.020
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    40   0.020
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    40   0.020
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    40   0.020
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    40   0.021
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.021
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    40   0.022
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    40   0.022
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    40   0.022
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    40   0.022
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    40   0.022
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    40   0.023
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.023
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               39   0.024
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    39   0.025
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    39   0.025
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    39   0.026
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    39   0.027
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    39   0.027
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    39   0.030
SAKL0B10648g Chr2 complement(917905..920103) [2199 bp, 732 aa] {...    39   0.030
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    39   0.032
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    39   0.032
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    39   0.033
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    39   0.034
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    39   0.034
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    39   0.035
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    39   0.036
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    39   0.037
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.039
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    39   0.039
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    39   0.040
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    39   0.040
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.044
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    39   0.044
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    38   0.045
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      39   0.045
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    39   0.046
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    39   0.051
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    39   0.052
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    39   0.052
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    39   0.052
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    39   0.052
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    38   0.054
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               38   0.057
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    39   0.058
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    38   0.058
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    38   0.058
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    38   0.059
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    38   0.060
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    38   0.061
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    38   0.062
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    38   0.062
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    38   0.062
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.062
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    38   0.065
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    38   0.066
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    38   0.066
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    38   0.067
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    38   0.067
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    38   0.069
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    38   0.070
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    38   0.073
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    38   0.077
Suva_13.348 Chr13 complement(577455..579281) [1827 bp, 608 aa] {...    38   0.078
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    38   0.078
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    38   0.078
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                38   0.078
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    37   0.078
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    38   0.079
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    38   0.079
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    38   0.084
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    37   0.086
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    38   0.087
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    38   0.087
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    38   0.088
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    38   0.091
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    38   0.092
KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON} conser...    37   0.094
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    38   0.094
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    38   0.094
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    37   0.095
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    37   0.095
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    38   0.095
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    38   0.096
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    37   0.096
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    37   0.100
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    37   0.10 
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    37   0.10 
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    37   0.10 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    37   0.10 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    37   0.10 
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    37   0.11 
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    37   0.11 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    37   0.11 
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    37   0.11 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    37   0.11 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    37   0.11 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    37   0.11 
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    37   0.11 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    37   0.12 
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    37   0.12 
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    37   0.12 
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    37   0.12 
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    37   0.12 
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    37   0.13 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     37   0.13 
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    37   0.13 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    37   0.13 
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     37   0.13 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    37   0.14 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    37   0.14 
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               37   0.14 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.14 
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    37   0.14 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    37   0.15 
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    37   0.15 
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    37   0.15 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    37   0.15 
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    37   0.15 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    37   0.15 
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    37   0.15 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    37   0.16 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    37   0.16 
Smik_13.373 Chr13 complement(581854..583680) [1827 bp, 608 aa] {...    37   0.17 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    37   0.17 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    37   0.17 
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    37   0.17 
KLLA0F22880g Chr6 (2123577..2127071) [3495 bp, 1164 aa] {ON} som...    37   0.18 
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    37   0.18 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    37   0.19 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    36   0.19 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.19 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    37   0.19 
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    36   0.19 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.20 
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    37   0.20 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    37   0.20 
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    37   0.21 
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    36   0.21 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    37   0.21 
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    37   0.21 
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    37   0.21 
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    37   0.22 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    36   0.22 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    36   0.22 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    36   0.22 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     36   0.22 
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    36   0.23 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    36   0.23 
NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa] {O...    36   0.23 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    36   0.23 
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    36   0.23 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    36   0.24 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   36   0.24 
Suva_15.245 Chr15 complement(416757..419414) [2658 bp, 885 aa] {...    36   0.24 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    36   0.24 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    36   0.24 
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    36   0.24 
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    36   0.24 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    36   0.24 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    36   0.24 
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    36   0.25 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    36   0.25 
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    36   0.25 
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    36   0.25 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    36   0.26 
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    36   0.26 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.26 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    36   0.26 
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    36   0.27 
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    36   0.28 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     36   0.29 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       36   0.30 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    36   0.30 
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    36   0.31 
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             36   0.32 
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    36   0.33 
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    36   0.33 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   0.33 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    36   0.33 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    36   0.34 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    36   0.34 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    36   0.34 
TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON} Anc_5.3...    36   0.34 
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              36   0.35 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.35 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    35   0.35 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    35   0.37 
YMR168C Chr13 complement(597332..599158) [1827 bp, 608 aa] {ON} ...    35   0.37 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    36   0.38 
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    36   0.38 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    35   0.39 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               35   0.41 
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    35   0.42 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    35   0.42 
TBLA0A02950 Chr1 complement(709449..712349) [2901 bp, 966 aa] {O...    35   0.43 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    35   0.43 
Kpol_1043.23 s1043 complement(44809..46680) [1872 bp, 623 aa] {O...    35   0.43 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    35   0.43 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    35   0.44 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    35   0.44 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    35   0.45 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    35   0.46 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    35   0.47 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    35   0.47 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    35   0.47 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    35   0.49 
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    35   0.49 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    35   0.50 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    35   0.51 
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    35   0.51 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    35   0.51 
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    35   0.52 
TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {O...    35   0.52 
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    35   0.52 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    35   0.53 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    35   0.53 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    35   0.53 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    35   0.53 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    35   0.54 
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    35   0.54 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    35   0.55 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    35   0.56 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    35   0.56 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    35   0.57 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    35   0.57 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     35   0.58 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    35   0.59 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    35   0.60 
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    35   0.60 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   0.60 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    35   0.60 
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    35   0.61 
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    35   0.61 
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    35   0.61 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    35   0.62 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    35   0.62 
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    35   0.63 
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    35   0.63 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    35   0.63 
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    35   0.63 
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 34   0.63 
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    35   0.64 
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    35   0.66 
Skud_13.333 Chr13 complement(571674..573500) [1827 bp, 608 aa] {...    35   0.67 
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    34   0.67 
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    35   0.67 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    35   0.69 
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    35   0.70 
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    35   0.71 
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    35   0.71 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   0.72 
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    35   0.73 
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    35   0.74 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    35   0.75 
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    35   0.76 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   0.76 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    34   0.77 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    35   0.77 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    35   0.78 
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    35   0.80 
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    35   0.81 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    35   0.81 
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    35   0.82 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    35   0.83 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    35   0.85 
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    35   0.86 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    35   0.86 
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    34   0.86 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    34   0.86 
AER026C Chr5 complement(684478..685482) [1005 bp, 334 aa] {ON} S...    34   0.86 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    34   0.90 
SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON} cons...    34   0.90 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    34   0.90 
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    34   0.92 
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    34   0.92 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    34   0.93 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    34   0.94 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    34   0.94 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    34   0.96 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   0.97 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    34   0.97 
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    34   0.97 
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    34   0.98 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    34   0.98 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    34   0.99 
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    34   1.0  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    34   1.0  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    34   1.0  
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    34   1.0  
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    34   1.0  
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    34   1.1  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    34   1.1  
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    34   1.1  
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    34   1.1  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    34   1.1  
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    34   1.1  
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    34   1.1  
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    34   1.1  
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    34   1.1  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    34   1.2  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    34   1.2  
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      34   1.2  
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    34   1.2  
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    34   1.2  
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    34   1.2  
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    34   1.2  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    34   1.2  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    34   1.3  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    34   1.3  
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    34   1.3  
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    34   1.3  
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    34   1.3  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    34   1.3  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    34   1.3  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    34   1.3  
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    33   1.4  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    34   1.4  
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    34   1.4  
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    34   1.4  
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    34   1.4  
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    34   1.4  
Kpol_1005.2 s1005 complement(1473..3992) [2520 bp, 839 aa] {ON} ...    34   1.4  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    34   1.4  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     33   1.5  
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    33   1.5  
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    33   1.5  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    33   1.5  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   1.5  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    33   1.6  
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    33   1.6  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    33   1.6  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    33   1.6  
TDEL0C02910 Chr3 complement(512082..514307) [2226 bp, 741 aa] {O...    33   1.6  
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    33   1.6  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    33   1.6  
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    33   1.6  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    33   1.7  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    33   1.7  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    33   1.7  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    33   1.7  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   1.7  
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    33   1.8  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    33   1.8  
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    33   1.8  
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    33   1.8  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    33   1.8  
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    33   1.9  
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    33   1.9  
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    33   1.9  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    33   1.9  
TPHA0D01900 Chr4 complement(395128..397812) [2685 bp, 894 aa] {O...    33   1.9  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    33   2.0  
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    33   2.0  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    33   2.0  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    33   2.0  
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    33   2.0  
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    33   2.1  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    33   2.1  
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    33   2.1  
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    33   2.1  
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    33   2.2  
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    33   2.2  
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    33   2.2  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   2.2  
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    33   2.2  
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    33   2.2  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    33   2.2  
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    33   2.3  
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    33   2.3  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    33   2.3  
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    33   2.3  
NCAS0D00890 Chr4 (166411..168324) [1914 bp, 637 aa] {ON} Anc_2.3...    33   2.3  
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    33   2.3  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    33   2.4  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    33   2.5  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    33   2.5  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    33   2.6  
Ecym_2265 Chr2 (521409..523064) [1656 bp, 551 aa] {ON} similar t...    33   2.6  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    33   2.7  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    33   2.7  
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    33   2.8  
Kwal_14.2619 s14 (835443..838946) [3504 bp, 1167 aa] {ON} YLR256...    33   2.8  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    33   2.8  
SAKL0D05236g Chr4 complement(414228..415826) [1599 bp, 532 aa] {...    33   2.9  
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    33   2.9  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    33   2.9  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    33   2.9  
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    33   3.0  
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    33   3.1  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    33   3.1  
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    33   3.2  
KLTH0H11704g Chr8 complement(1003625..1007182) [3558 bp, 1185 aa...    33   3.3  
KNAG0B01720 Chr2 complement(314126..315787) [1662 bp, 553 aa] {O...    32   3.3  
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    33   3.4  
KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON} conser...    32   3.5  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    32   3.5  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    32   3.5  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    32   3.5  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    32   3.5  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    32   3.5  
TBLA0H00520 Chr8 complement(101556..102506) [951 bp, 316 aa] {ON}      32   3.6  
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    32   3.6  
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    32   3.6  
TDEL0F02240 Chr6 complement(409453..411393) [1941 bp, 646 aa] {O...    32   3.6  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    32   3.6  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    32   3.7  
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    32   3.7  
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    30   3.7  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    32   3.8  
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    32   3.8  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...    32   3.8  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    32   3.8  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               32   3.9  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    32   3.9  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    32   3.9  
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    32   3.9  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    32   4.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...    32   4.0  
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    32   4.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...    32   4.1  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    32   4.1  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    32   4.1  
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    32   4.2  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    32   4.3  
SAKL0F13354g Chr6 (1055553..1057775) [2223 bp, 740 aa] {ON} simi...    32   4.3  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    32   4.4  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   4.4  
NDAI0H03240 Chr8 complement(775826..777718) [1893 bp, 630 aa] {O...    32   4.6  
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    32   4.6  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    32   4.7  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    32   4.8  
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    32   4.9  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               32   5.0  
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    32   5.1  
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    32   5.2  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    32   5.3  
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    32   5.3  
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    32   5.4  
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    32   5.4  
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    32   5.4  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    32   5.4  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    32   5.4  
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    32   5.5  
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    32   5.5  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    32   5.5  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    32   5.8  
KLLA0D07029g Chr4 (602763..604367) [1605 bp, 534 aa] {ON} simila...    32   5.8  
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    32   5.9  
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    32   5.9  
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    32   6.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...    32   6.3  
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    32   6.4  
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    32   6.4  
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    32   6.5  
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    32   6.6  
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    32   6.6  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    30   6.8  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    32   6.8  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    32   6.9  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    32   7.0  
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     31   7.1  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    32   7.3  
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    31   7.5  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    31   7.6  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    32   7.6  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    31   7.7  
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    31   7.9  
CAGL0A04543g Chr1 (448806..449897) [1092 bp, 363 aa] {ON} simila...    31   8.1  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    31   8.2  
CAGL0F05357g Chr6 (541830..543635) [1806 bp, 601 aa] {ON} some s...    31   8.6  
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    31   8.7  
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    31   8.9  
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    31   8.9  
KLTH0F09702g Chr6 (840760..842589) [1830 bp, 609 aa] {ON} simila...    31   9.0  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    31   9.3  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    31   9.4  
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    31   9.5  
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    31   9.7  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    31   9.7  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    31   9.8  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    31   9.9  

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/552 (100%), Positives = 552/552 (100%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60
           MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK
Sbjct: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60

Query: 61  RPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQS 120
           RPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQS
Sbjct: 61  RPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQS 120

Query: 121 VNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFR 180
           VNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFR
Sbjct: 121 VNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFR 180

Query: 181 QSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTFSSQPS 240
           QSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTFSSQPS
Sbjct: 181 QSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTFSSQPS 240

Query: 241 IEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRA 300
           IEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRA
Sbjct: 241 IEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRA 300

Query: 301 NSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELARMIPT 360
           NSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELARMIPT
Sbjct: 301 NSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELARMIPT 360

Query: 361 TSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDRSVVLQ 420
           TSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDRSVVLQ
Sbjct: 361 TSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDRSVVLQ 420

Query: 421 IINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIFDSIVK 480
           IINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIFDSIVK
Sbjct: 421 IINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIFDSIVK 480

Query: 481 ILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDALLDPSN 540
           ILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDALLDPSN
Sbjct: 481 ILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDALLDPSN 540

Query: 541 SLNLMHQEYSIL 552
           SLNLMHQEYSIL
Sbjct: 541 SLNLMHQEYSIL 552

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/553 (56%), Positives = 400/553 (72%), Gaps = 11/553 (1%)

Query: 8   VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF----YEKRPS 63
           VP  KR R RKAC+PCRQRKR+CD   PCGMC SY Y C YD+   P +       + P 
Sbjct: 8   VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPD 67

Query: 64  PKQSTSP---STIQKKEVERPSML---SPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLE 117
             +S SP     + K    R  +L   + C++++G+FD +KSRYM L SAVAF R LG+E
Sbjct: 68  STRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAFARSLGIE 127

Query: 118 LQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPS 177
           LQS NPPHLHSFAWNCG+R EE S +H  L ++I+K++   FT +YF  +HP+FD++DP 
Sbjct: 128 LQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPVFDVVDPE 187

Query: 178 QFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTFSS 237
            F++S++SYW     VSAF AV+GG++ALGS FS   GH REL+IVQYAK++LEDPTFS 
Sbjct: 188 HFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVLEDPTFSR 247

Query: 238 QPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLP 297
            PS EQ+SAWVLR++YLRAT RPH AWLASC+T+HL EA+ALHHEV+ VEL T ND  LP
Sbjct: 248 LPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVEL-TANDKALP 306

Query: 298 PRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELARM 357
           PR   + ERARRLFWCAW IN+I+SY+YGRS  +L  ISCKL  +S  NYTA++V+LA +
Sbjct: 307 PRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQLVDLALI 366

Query: 358 IPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDRSV 417
           IP  +  +   ++VA L++A+  VY+  D H FLSL KADLC+SFYRRLRL N+ LD  V
Sbjct: 367 IPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNYTLDSEV 426

Query: 418 VLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIFDS 477
           V Q+  +   ALSAA DLV +   WWNVLS  F Y CVLLAI++ +SL+NVA AK+IFD 
Sbjct: 427 VFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKAKNIFDR 486

Query: 478 IVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDALLD 537
           IV  L+TH+A EAQ T KLLL+DS+KKK++E+  LE AD+ G A    ++ +IDWD LLD
Sbjct: 487 IVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEIDWDVLLD 546

Query: 538 PSNSLNLMHQEYS 550
           PS++L+LM Q++S
Sbjct: 547 PSHALHLMQQDFS 559

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/550 (56%), Positives = 395/550 (71%), Gaps = 10/550 (1%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF--- 57
           M ++G++    KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y + DGPL+    
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60

Query: 58  --YEKRPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLG 115
              E+ P   ++     +        S  S   +   I D +KSRY   HSAVAFPR LG
Sbjct: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120

Query: 116 LELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIID 175
           LEL+S NPP LH FAW+CGIRPEE  + H  L++I++K++  R + VYF VVHP+FDI+D
Sbjct: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180

Query: 176 PSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTF 235
           P Q  ++++ YW G    S + AVI GV+ALGSFF  + GH RE+DI+QYAK IL+DPTF
Sbjct: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240

Query: 236 SSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAP 295
           S  PS+EQISAWVLR+IYLRATARPHVAWLASC+T+HL EA  LHHE+D+ +LA  N+ P
Sbjct: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300

Query: 296 LPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELA 355
           L  R   V E  RRLFW AW INTI+SY+YGRS VTLN+I+CK +KE+  NYT  +V LA
Sbjct: 301 L-KRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359

Query: 356 RMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDR 415
           +++P  S  ++    V  L++A+  V+++ D HPFLSLTKAD+C SFYRRLRLLNH+LD+
Sbjct: 360 QLVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDK 415

Query: 416 SVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIF 475
           SVV QII+IG +AL+AA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VAAA    
Sbjct: 416 SVVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTL 475

Query: 476 DSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDAL 535
           D+I ++L THIA EAQ TAKLLL DS+KKK++EI  LE A  +  AP T +  DIDWDAL
Sbjct: 476 DNITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDAL 535

Query: 536 LDPSNSLNLM 545
           LDPS++L+ M
Sbjct: 536 LDPSDTLSFM 545

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/553 (55%), Positives = 394/553 (71%), Gaps = 19/553 (3%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60
           MV++G++    KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y DVDG       
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDG------S 54

Query: 61  RPSPKQSTSPSTIQKKEVERPSML--------SPCSSERGIFDPSKSRYMSLHSAVAFPR 112
             SP+   +P     +    P++L        +   + + I DP KSRY   HSAVAFPR
Sbjct: 55  STSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPR 114

Query: 113 YLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFD 172
            LGLEL+S NPP LHSFAW+CGIRPEEN  SH  L+ +++K++  R + VYF VVHP+FD
Sbjct: 115 CLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFD 174

Query: 173 IIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILED 232
           ++DP Q  ++++ YW G   +  + AVI GV+ALGSFF  + GH RE+D+VQYAK IL+D
Sbjct: 175 VVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDD 234

Query: 233 PTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRN 292
           PTF   P++EQ+SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LHHE+D+ +L   +
Sbjct: 235 PTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTS 294

Query: 293 DAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMV 352
           + PL  R   V E  RRLFWCAW INTI+SY+YGRS VTLN+I+CK +KE+  N+T  +V
Sbjct: 295 NVPL-RRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLV 353

Query: 353 ELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHV 412
            LA++IP    C +  +    L++A+  V+K+ + HPFLSLTK+D+C S YRRLRLLNH+
Sbjct: 354 ALAQLIP--QDCVN--ANATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHI 409

Query: 413 LDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAK 472
           LD+SVVLQII+IG +ALSAA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VAAA 
Sbjct: 410 LDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAM 469

Query: 473 SIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDW 532
              D+I ++L THIA EAQ TAKLLL DSMKKK++EI  LE A  +     T +  DIDW
Sbjct: 470 RTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDW 529

Query: 533 DALLDPSNSLNLM 545
           D LLDPS++LN M
Sbjct: 530 DVLLDPSDTLNFM 542

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/554 (55%), Positives = 393/554 (70%), Gaps = 17/554 (3%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60
           M + G+    +KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y  +DG +     
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY--IDGRVPSASP 58

Query: 61  RPSPKQSTSPST---------IQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFP 111
           +      TSP T         I + E  +P      +S+  I DP+KSRY   HSAVAFP
Sbjct: 59  QVQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQ-NIVDPTKSRYTIQHSAVAFP 117

Query: 112 RYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMF 171
           R LGLEL+S NPP LHSFAW+CGIRPEEN  SH  L+++++K++  R + VYF VVHP+F
Sbjct: 118 RCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIF 177

Query: 172 DIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILE 231
           D+++P Q  ++++ YW G      + AVI GV+ALGSFF  + GH RE+DIVQYAK IL+
Sbjct: 178 DVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILD 237

Query: 232 DPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATR 291
           DPTFS  P++EQ+SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LHHE+D+ ++A  
Sbjct: 238 DPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAIS 297

Query: 292 NDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEM 351
           N+ P P R   V E  RRLFWCAW INTI+SY+YGRS VTLN+I+CK +KE+  N+TA +
Sbjct: 298 NNVP-PKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHL 356

Query: 352 VELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNH 411
           V LA +IP  S      +  A L++A+  V+++ + HPFLSLTK D+C S YRRLRLLNH
Sbjct: 357 VALAHLIPQDSV----NANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNH 412

Query: 412 VLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAA 471
           +LD++VVLQII+IG +ALSAA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VA A
Sbjct: 413 ILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATA 472

Query: 472 KSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDID 531
               D+I +IL T IA EAQ TAKLLL DSMKKK++EI  LE A  +     T +  DID
Sbjct: 473 MKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDID 532

Query: 532 WDALLDPSNSLNLM 545
           WDALLDPS++LN M
Sbjct: 533 WDALLDPSDTLNFM 546

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/555 (54%), Positives = 388/555 (69%), Gaps = 19/555 (3%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG------P 54
           M ++  ++P  KR RVRKAC+PCR+RKRKC+   PC MC SYGY C Y D D       P
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 55  LSFYEKRPSPKQST--SPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPR 112
           +   ++ P   +S   + S I   EV   S+ +   + + I DP KSRY   HSAVAFPR
Sbjct: 61  VQKLDELPHAPESKPFAASNIHGNEVS--SVDTQTVTNQSITDPVKSRYTIQHSAVAFPR 118

Query: 113 YLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFD 172
            LGLEL+S NPP LHSFAW+CGIRPEEN +SH  L+ +I+K++  R + VYF VVHP+FD
Sbjct: 119 CLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFD 178

Query: 173 IIDPSQFRQSLDSYWGGARNVSAFD--AVIGGVVALGSFFSRNFGHARELDIVQYAKDIL 230
           ++DP Q  ++++ YW G  N+S F+  AVI GVVALGSFF  + GH RE+D+VQYAK IL
Sbjct: 179 VVDPKQLAKNVEEYWAG--NISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGIL 236

Query: 231 EDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELAT 290
           +DPTFS  P++E +SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LH ++DK E + 
Sbjct: 237 DDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSM 296

Query: 291 RNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAE 350
            +   L  R     E  +RLFWCAW INTI+SY+YGRS V LN+I+CK ++E+  +YT  
Sbjct: 297 TSGVTL-RRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIH 355

Query: 351 MVELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLN 410
           +V LA+ IP  +  +D    +  L+ A+  ++K+ + HPFL LTK D+C S YRRLRLLN
Sbjct: 356 LVALAQTIPQGTVNTD----LTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLN 411

Query: 411 HVLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAA 470
           HVLD+SVVLQII+IG +ALSAA  LV+   +WWNVLST F Y CVLLAID+P+SLS+VAA
Sbjct: 412 HVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAA 471

Query: 471 AKSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDI 530
           A    D+I ++L THIA EAQ TAKLLL DSMKKK++EI  LE A  +        S DI
Sbjct: 472 AMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDI 531

Query: 531 DWDALLDPSNSLNLM 545
           DWDAL DPS +L  M
Sbjct: 532 DWDALFDPSGTLGFM 546

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 158/387 (40%), Gaps = 83/387 (21%)

Query: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD--DVDGPLSFYEKRP 62
           G D    +RLRVRKAC  C++RK KCD   PC  CT     C Y   D   P+S    +P
Sbjct: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPIS----KP 68

Query: 63  SPKQSTSPSTIQKKEVERPSML-----------------------SPCSSERGIFDPSKS 99
            P +S    +I    ++  S L                       S   S    F   K 
Sbjct: 69  KPGRSLDKESIANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPWQTFSLDKY 128

Query: 100 RYMSLHSAVAFPRYLGLEL-QSVNP----------PHLHSFAWNC--GIRPEENSTSHPD 146
           R+   +  +  P YLG  L QS+ P          P + ++ WN   G   +  S S  D
Sbjct: 129 RFHRRYQNL-LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLD 187

Query: 147 LANI---ISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSA--FDAVIG 201
           + N    +  D  N+    YF+ ++P+F I+    F Q  ++ +   R  S+  F +++ 
Sbjct: 188 IINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLY 247

Query: 202 GVVALGSFFSRNFGHAR-------ELD------------IVQYAKDILEDPTFSSQPSIE 242
            ++A    F   +  ++       +LD            +  +A +I+   +F  + S E
Sbjct: 248 LILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWE-SFE 306

Query: 243 QISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANS 302
            I +W+L + YLR   R    W A    + + +  AL+  +++            P+ ++
Sbjct: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALY--LNRF-----------PQRHT 353

Query: 303 VCE--RARRLFWCAWCINTIISYEYGR 327
           + E  + +  FW  + ++ +IS++ GR
Sbjct: 354 LYEETKVKNCFWSCFIMDKVISFQMGR 380

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/379 (24%), Positives = 144/379 (37%), Gaps = 66/379 (17%)

Query: 2   VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY--DDVDGPLSFYE 59
           VAT        R+RVRKAC  C++RK KC+   PC  C  +G  C Y  + V  P S   
Sbjct: 14  VATLQQDTGRPRIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHYKVEPVTRPASAAL 73

Query: 60  KRPSPKQSTSPSTIQKKEVERPSMLSPC-SSERGIFDPSKSRYMSLHSAVAFPRYLGLEL 118
           K  +P  + +   + +          P  +S    F P K R+   H  +  P YLG  L
Sbjct: 74  KAGAPGPAGTLPALSQVPAPSDFATGPAPASPWQRFSPGKYRFHRRHQNLV-PYYLGQAL 132

Query: 119 QSVNP-----------PHLHSFAWNC--GIRPEENSTSHP--------DLANIISKDDCN 157
            S  P           P L  + WN   G   ++ ST           DLA  + +    
Sbjct: 133 ISSLPPALVQKYALRAPRLQFYGWNMSGGHYLKQGSTFGAPQGTVWRWDLAVELQRQILE 192

Query: 158 RFTDVYFEVVHPMFDIIDPSQFRQS-----LDSYWGGARNVSAFDAVIGGVVALGSFFSR 212
           +    +F+ V+    I+    F Q      LD   G   +   F+A++  + A+   FS 
Sbjct: 193 KCASFFFQHVNRFVSIVHEQAFWQQFRGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSY 252

Query: 213 NFG----------------------HARELD--IVQYAKDILEDPTFSSQPSIEQISAWV 248
           +                        H R L+  + + A  +    +F  + S E I AW+
Sbjct: 253 SGAGASVCEALTAAEVTWLDLHLTRHGRHLEETLFERAYAVTTRLSFEWE-SFELIQAWL 311

Query: 249 LRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERAR 308
           L ++YLR   R    W A    + +    +L+           N  P    A   C RAR
Sbjct: 312 LAAVYLRTCHRQVSCWQALSRAVQMCNGMSLY----------LNRFPEKHTAYDEC-RAR 360

Query: 309 RLFWCAWCINTIISYEYGR 327
             +W  + ++ +IS++ GR
Sbjct: 361 NCYWACFVLDRLISFQMGR 379

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2.565
           YMR019W
          Length = 608

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 84/379 (22%), Positives = 152/379 (40%), Gaps = 57/379 (15%)

Query: 15  RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPSTIQ 74
           RVR AC  C++RK KCD   PC  C      C+Y  V         +   +     S + 
Sbjct: 8   RVRAACAVCQRRKLKCDGKQPCSRCARTDRICRYAKV---------QVQTQMPARASVVP 58

Query: 75  KKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVNP----------- 123
           +  V  P  L   S   G F  SK R+   +  V  P Y    + +  P           
Sbjct: 59  RANV--PVGLGRGSPWLG-FSFSKFRFHRRYQDV-LPFYFCESVLAQLPESVVAAEDLQL 114

Query: 124 PHLHSFAWNCG--------IRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIID 175
           P + ++ WN          ++P   S + P L  +            YF+ V+P+F I++
Sbjct: 115 PSVQNYGWNLAGGAFLAFALQP---SATRPPLREL------RPLVQHYFDHVNPLFSIVN 165

Query: 176 PSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHAR--ELDIVQYAKDILEDP 233
              F     S W  A + ++    IG ++A+ +   R     R  E  +  ++  ++ + 
Sbjct: 166 ERVFW----SQWDSAADANSLFNAIGYLMAITAERYRCGPPPRVDETALFNHSYAVVSEF 221

Query: 234 TFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRND 293
           +F  + S+E I +W+L + YLR   R    + A    + +    +L+ E    ++    +
Sbjct: 222 SFEWE-SVELIQSWLLIAAYLRCCYRQTSCYAALARAVAMCRGMSLNLEAKPEQVDAEGE 280

Query: 294 APLPPRANSVCERARRLFWCAWCINTIISYEYGR--SC-VTLNKI---SCKLLKESTKNY 347
                 A     +    FW  + ++ I S++ G+  SC +++ K+     +   E  +  
Sbjct: 281 Q---TGALHSTGKYYHCFWTVYTVDKIFSHQLGKVGSCPISITKLKPPGPQQQDEWFQGG 337

Query: 348 TAEMVELARMIPTTSQCSD 366
           + EM++LA +I    QC +
Sbjct: 338 SLEMLQLALIIDELQQCGE 356

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 91/432 (21%), Positives = 151/432 (34%), Gaps = 143/432 (33%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF--YEKRPSPKQSTS 69
           +RLRV+KAC  C++RK KCD   PC        NC   +VD    +  +  R  P+  T+
Sbjct: 8   QRLRVQKACDICKRRKVKCDGLSPCS-------NCIRHNVDCTYDYRTFASRKKPRFITN 60

Query: 70  --------------PSTIQKKEV----ERPSMLSPCSSERG------------------- 92
                         P +   K V    +   +L   SS R                    
Sbjct: 61  VLSSSRESSVASSIPLSSNGKSVFIEDQTAKLLLELSSNREHSSNSSLYVNDEKQLSSIR 120

Query: 93  ------------------IFDPSKSRYMSLHSAVAFPRYLGLELQSVNPP---------- 124
                              F   K R+   +  V  P YLG  L S  PP          
Sbjct: 121 RDYIIHGPEIDNQKSPWFTFSRDKYRFHRRYQNV-LPYYLGRSLLSQLPPDSIKSFNLEV 179

Query: 125 -HLHSFAWNCG---------IRPEENSTSHPDLA----NIISKDDCNRFTDVYFEVVHPM 170
             + ++ WN                +S ++ DL     N +     N+  + +F  ++  
Sbjct: 180 PRIQNYGWNLSGGHYIKASTFSDSNDSNNNGDLFFNFDNSMHLSIVNKLLNFFFNEINKS 239

Query: 171 FDIIDPSQFRQSLDSYW---GGARNVSA--FDAVIGGVVALG---------------SFF 210
             I+D S F +  ++ +   G   N S   F +++  V+A+                 FF
Sbjct: 240 LSILDYSTFWKQYNNGFLQQGKQNNNSTKLFTSILYLVLAIALRFKDGELQAPNVEEPFF 299

Query: 211 SR------NFGHARELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAW 264
           S       N  H +E  +  Y+  I+   TF  + S E + +W+L + YLR   R    W
Sbjct: 300 SEEELLFLNKTHDKEGKLFNYSYSIVSKLTFEWE-SFELLQSWLLITFYLRTCHRQIACW 358

Query: 265 --------LASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWC 316
                   +   M++HL +   +H E D++                   +A   FW  + 
Sbjct: 359 SALGKAVTMCKGMSLHLNQLPEIHSENDRI-------------------KAWNCFWAVFI 399

Query: 317 INTIISYEYGRS 328
           ++ +IS++ GR+
Sbjct: 400 MDKLISFQIGRA 411

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          KRLRV +AC  CRQRK +CD   PC  CT Y YNC Y+    P S   KR   K+S  P
Sbjct: 24 KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTYN----PTSRTRKRVRAKESAQP 78

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 99/249 (39%), Gaps = 47/249 (18%)

Query: 158 RFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGAR--NVSAFDAVIGGVVALGSFFSRNFG 215
           +F D YF   H  +  I    F   +  Y    R  ++  +  ++  V+ALG +     G
Sbjct: 204 KFIDAYFSQYHTTYPFIHKETF---MAQYKDQLRPSSMDIWQILLNTVLALGCWCIN--G 258

Query: 216 HARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHL 273
            + ++DI  Y  AK  L    F +  S+  + A  L S Y++   +P+  W    +   +
Sbjct: 259 ESSDIDIYYYQNAKSYLSSVVFETG-SVSLVVALTLLSSYVQKRNKPNSGWNYLGLATRM 317

Query: 274 VEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGR--SCVT 331
             +  LHHE  K+E              ++ E+ RR++W  + ++  +S  YGR  +   
Sbjct: 318 AISLGLHHEFPKME-------------ETLLEQRRRVWWGTYTLDCAVSITYGRPINLPP 364

Query: 332 LNKISCKL------------------LKESTKNYTAEMVELARMI----PTTSQCSDPAS 369
           LN I   L                  L E+TK         +RM+    PT  +C   + 
Sbjct: 365 LNNIDVGLPSNIHEGQVVEYPTYYSGLIEATKFAQLASEIFSRMVSKPCPTAVECLQLSD 424

Query: 370 QVAALIEAI 378
           ++   +E +
Sbjct: 425 KINTFVEQL 433

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 16 VRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
          V++AC  CR+RK +C    P C  C  + + C Y
Sbjct: 5  VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCY 38

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 6   ADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
           A V + KR RV +AC  CR++K KCD   PC  CT Y Y C YD
Sbjct: 58  ASVTQKKRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSYD 101

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS 69
          R  RLRVRKAC  C++RK KCD   PC  C  +G  C+Y  + G +    +R     S +
Sbjct: 7  RRNRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKY--ISGTVRRRYRRDIGNSSGA 64

Query: 70 PSTIQKKEVERPSMLSPCSSERGIFDPS 97
             I       PS L+P SS    F+ S
Sbjct: 65 SILI-------PSRLTPSSSTALNFNGS 85

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 108/291 (37%), Gaps = 85/291 (29%)

Query: 100 RYMSLHSAVAFPRYLGLELQSVNP-----------PHLHSFAWNCG----IRPEENSTSH 144
           RY +L      P YLG  L S  P           P + ++ WN      +R +++S + 
Sbjct: 171 RYQNL-----LPFYLGASLMSEIPQHAVESHRLKQPRIQNYGWNMSGGHYLRHDKSSKAR 225

Query: 145 P-----------------DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW 187
                             D  N +     N+    YF+ ++P   I+  S F Q  ++ +
Sbjct: 226 ARARARAEGANLDPEGFFDFENPVHLSVVNKLLKFYFKEINPPMSIVHESMFWQQFNNRF 285

Query: 188 GGARNVS-----AFDAVIGGVVALG------------------------SFFSRNFGHAR 218
               N        F +++  ++A+                         SFF R     R
Sbjct: 286 LPHTNFKDSSSKLFRSMLYLILAITLRFREGFMENTEGSNEFLFTWEELSFFQR---QHR 342

Query: 219 ELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATA 278
           E  + +YA  ++   TF  + S E I +W+L + Y R   R    W A    +++    +
Sbjct: 343 EEAMFKYAYSVITQLTFEWE-SFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNGMS 401

Query: 279 LHHEVDKVELATRNDAPLPPRANSVCE--RARRLFWCAWCINTIISYEYGR 327
           L+  +++            PR +S  +  RA   FW  + ++ +IS++ GR
Sbjct: 402 LY--LNRF-----------PRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 13/74 (17%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS 69
          +NKR RV +AC  CR++K KCD   PC  CT Y Y C Y+           +P+ + +TS
Sbjct: 10 QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN-----------QPTKRSNTS 58

Query: 70 PSTI--QKKEVERP 81
           ST   Q    +RP
Sbjct: 59 ASTQSPQSANQQRP 72

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          P++KR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 4  PQSKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 44

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          +NKR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 4  QNKRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYN 43

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (65%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCD   PC  CT Y YNC Y+
Sbjct: 28 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTYN 65

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          +NKR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 5  QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 44

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          +NKR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 5  QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 44

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 109/272 (40%), Gaps = 52/272 (19%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGY--NCQYDDVDGPLSFYEKRPSPKQSTS 69
           KR R+ K+C  C   K KC+   PC  C + G    C Y    G L  ++   S  +ST+
Sbjct: 13  KRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVGLIDECIYGFDKGELQNHDS-TSHSESTT 71

Query: 70  PSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMS---LHSAVAFPRYLGLELQSVNPPHL 126
           PS         P +  P SS  G     K+   +   L S   +P +      SVN  ++
Sbjct: 72  PS---------PKL--PLSSNSGKVRKIKTTNKTSSPLKSKYLYPFFTN----SVNDENI 116

Query: 127 HSFAWN----CGIRPEENSTSH-----PDLANIISKDDCNRF----------TDVYFEVV 167
            S A N       +  +N+ +      P L  I  +D  N             D YFE +
Sbjct: 117 SSVASNDTEELSSKMSKNAITTFDRFVPHLFAITLEDIINLIPDSLEVALSQIDTYFETI 176

Query: 168 HPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGS-FFSRNFGHARELDI---- 222
           HP+  ++D S  RQ L   +   +  S  D  I  ++ + S FF  ++       I    
Sbjct: 177 HPIIPVLDRSLVRQKLIGIYNSIQ--SGTDLSISNLLLIMSIFFCSSYSIVASSIIPDLL 234

Query: 223 -----VQYAKDILEDPTFSSQPSIEQISAWVL 249
                 Q  K +LE   F ++P++E + ++++
Sbjct: 235 LCNKYYQSHKYLLELSVFPTRPTLESLQSFLI 266

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
           Anc_2.565
          Length = 759

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 81/415 (19%), Positives = 148/415 (35%), Gaps = 118/415 (28%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD---------------DVDG- 53
           + +R+RV++AC  C++RK KCD   PC  C     +C+Y+               D+D  
Sbjct: 24  KKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYNNSSNTTKKEPNDPPADIDAA 83

Query: 54  ------PLSFYEKRPSPKQS---------------------TSPSTIQKKEVERPSMLSP 86
                 P +    + + +QS                        +++   +   P +   
Sbjct: 84  ESSTMSPPNLLHPQLNKEQSEDNMAVLLLDLAKKLKQKKNIKDTTSLGNDDTIPPRVTKD 143

Query: 87  CSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVNPPHL-----------HSFAWNCG- 134
            +S    F   K R+   +  V  P   G  L S  PP L            ++AWN   
Sbjct: 144 TNSPWQSFSYDKYRFHRRYQNV-LPNKFGKSLLSALPPQLIQENNLETPRIQNYAWNMSG 202

Query: 135 ------IRPEENSTS--HPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSY 186
                  +  EN++S    +  N +      +    YF+ ++  + II    F    ++ 
Sbjct: 203 GHYLKFEQMHENNSSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQFNNG 262

Query: 187 W---GGARNVSA--FDAVIGGVVALGSFFSRNFGHA--------RELDIVQ--------- 224
           +   G   N SA  F +++  V+ +   F      +        +E ++V          
Sbjct: 263 FLQQGKQNNKSAKLFTSMLYLVLTISIRFYEGLPASSLDQLFTPQEQELVHRQRILRNEE 322

Query: 225 ----YAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAW--------LASCMTMH 272
               +A  I+   TF  + S E I +W+L + YLR   R    W        + + M+++
Sbjct: 323 YMFGHAYSIVSKLTFEWE-SFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNGMSLY 381

Query: 273 LVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGR 327
           L     +H   D+V                   +A   FW  + ++ +IS++ GR
Sbjct: 382 LNRFPEVHSTYDEV-------------------KAWHCFWSCFIMDKLISFQLGR 417

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (65%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCDS  PC  CT Y Y C Y+
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTYN 47

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
           enhancer activator required for full levels of Ty
           enhancer-mediated transcription; C6 zinc cluster
           DNA-binding protein
          Length = 759

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 3   ATGADVPRNK-RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
            TGA+   N    R R AC  CR R++KCD GFPCG C+     C  +D D
Sbjct: 52  GTGANTLTNGGSTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLS 56
          RLRV KAC+ CR++KR+CD   PC  C      C+Y +   P S
Sbjct: 25 RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTARPRS 68

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS 69
           R  R +V KAC  CR+RK KC+  FPC  C  Y   C +    G    +  +   K S  
Sbjct: 33  RKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTSRQGG---HRIKNLQKGSLE 89

Query: 70  PSTIQKKEVERPSMLSPCSSE 90
            +T+Q KE    S  S C+S+
Sbjct: 90  GATVQVKEETDCSSASLCNSQ 110

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 58 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 95

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 12/82 (14%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS-P 70
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y+           +PS + ++S  
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN-----------QPSKRTNSSVT 58

Query: 71 STIQKKEVERPSMLSPCSSERG 92
           ++    +   +MLS  + + G
Sbjct: 59 GSMSATNISSQNMLSTLNIQSG 80

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 7  DVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          D P+ KRL    AC  CR+R++KCD  FPC  C   G NC  ++ D
Sbjct: 28 DYPKRKRL----ACSNCRRRRKKCDLNFPCANCIRLGLNCNVNEED 69

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%)

Query: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSP 64
           G +  +  R R  +AC+ CR+RK +C    PC +C +  + C+YD      S +++  S 
Sbjct: 43  GTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKYDRPPRNSSVFDREVSD 102

Query: 65  KQSTSPSTIQKKEVE 79
             S+ P +I  +E E
Sbjct: 103 DSSSYPQSIPHQEGE 117

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 66

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/357 (19%), Positives = 133/357 (37%), Gaps = 89/357 (24%)

Query: 94  FDPSKSRYMSLHSAVAFPRYLG-----------LELQSVNPPHLHSFAWNCG-------- 134
           F   K R+   +  +  P YLG           +E   +  P + ++ WN          
Sbjct: 311 FSLDKYRFHRRYQNI-LPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHYLKYK 369

Query: 135 --IRPEENSTSHP----DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW- 187
              R +E +  H     D  + +     N+    YF+ ++P+F II  + F Q  ++ + 
Sbjct: 370 GDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYNNKFL 429

Query: 188 --GGARNVSA--FDAVIGGVVALGSFFSRNFGH--------------------------- 216
             G   N SA  F +++  +++    F    GH                           
Sbjct: 430 RQGKQNNSSANLFTSMLYLILSTTLRFRE--GHLDGQKGQGTYSNTSLNITFEEKSILIK 487

Query: 217 --ARELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLV 274
             + E ++ +YA  I+   TF  + S E I +W+L + Y R   R    W A    +++ 
Sbjct: 488 KPSIEENLFKYAYLIINTLTFEWE-SFELIQSWLLITFYFRTCYRQTACWNALSQAVNMC 546

Query: 275 EATALHHEVDKVELATRNDAPLPPRANSVCE--RARRLFWCAWCINTIISYEYGR----- 327
              +L+  ++K            P  +S  +  +A   FWC + ++ +IS++ GR     
Sbjct: 547 NGMSLY--LNKF-----------PEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLS 593

Query: 328 -----SCVTLNKI-SCKLLKESTKNYTAEMVELARMIPTTSQCSDPASQVAALIEAI 378
                 C  +N + S K L+E    +  E  ++  +    +Q     +Q   L E +
Sbjct: 594 LPASEMCEQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETV 650

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 13  RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
           RLRV+KAC  C++RK KCD   PC  C+ +   C+YD
Sbjct: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 1  MVATGADVPRNKRL---RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          +V +   V R  +L   RVR AC  CR++KRKCD   PC  CT   Y C Y +
Sbjct: 13 LVLSANSVTRQLQLKEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIYKN 65

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 31 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 68

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 26/45 (57%)

Query: 6  ADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          A  P  +R +V KAC  CR+RK KC+   PC  CT YG  C Y D
Sbjct: 17 AQKPSTRRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTD 61

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR RV +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 66

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 18/111 (16%)

Query: 13  RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP-S 71
           RLRV+KAC  C++RK KCD   PC  C+ +   C+YD          +R   +Q+TSP  
Sbjct: 25  RLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRYD-----FKVTNRRRRRRQATSPIQ 79

Query: 72  TIQKKEVERPSMLSP------------CSSERGIFDPSKSRYMSLHSAVAF 110
            + K+  E   + S              SS  G    S S Y +L S + F
Sbjct: 80  NVNKEYTEADGVFSRDISASVNVPSDCLSSSAGNSPYSNSHYSNLQSTLPF 130

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 103/301 (34%), Gaps = 90/301 (29%)

Query: 94  FDPSKSRYMSLHSAVAFPRYLG-----------LELQSVNPPHLHSFAWNCG-------- 134
           F   K R+   +  +  P YLG           +E  ++  P + ++ WN          
Sbjct: 254 FSLDKYRFHRRYQNI-LPYYLGASILKDISPQAIEYANLKRPRVQNYGWNLSGGHYLKYK 312

Query: 135 --IRPEENSTSHPDLANIISKDD------CNRFTDVYFEVVHPMFDIIDPSQFRQSLDSY 186
              R ++    H   +   + DD       ++    YF  ++P+F II  + F Q   + 
Sbjct: 313 EEFRRQDKVIRHE--SKFFNFDDPVHLSLIHKLLTYYFNEINPVFSIIHEATFWQQYKNK 370

Query: 187 W---GGARNVSA---------------------FDAVIGGVVALGSFFSRNFGHARELD- 221
           +   G   N SA                      D   G      S F   F     L+ 
Sbjct: 371 FLQQGKQNNSSAKLFTSMLYLILSTTLRFKEGHLDNQEGEEKHKDSSFDITFEEESVLNG 430

Query: 222 -------IVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAW--------LA 266
                  + +YA  I+   TF  + S E I +W+L + Y R   R    W        + 
Sbjct: 431 KPFIEEMMFEYAYSIINTLTFEWE-SFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMC 489

Query: 267 SCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYG 326
           + MT++L +   +H   D+                    +A   FWC + ++ +IS++ G
Sbjct: 490 NGMTLYLNKFPEIHSTYDE-------------------SKAWHCFWCCFIMDKLISFQTG 530

Query: 327 R 327
           R
Sbjct: 531 R 531

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR R+ +AC  CR++K KCD+  PC  CT Y Y C Y+
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTYN 51

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          KR +V +AC  CR++K KCD   PC  CT Y Y C Y+
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTYN 49

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 3   ATGADVPRN-KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
            T  + P N    R R AC  CR R++KCD GFPCG C+     C  +D D
Sbjct: 52  GTVINTPDNASNTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 111/294 (37%), Gaps = 76/294 (25%)

Query: 94  FDPSKSRYMSLHSAVAFPRYLG-----------LELQSVNPPHLHSFAWNCG----IRPE 138
           F   K R+   +  +  P YLG           +E   +  P + ++ WN      ++ +
Sbjct: 272 FSLDKYRFHRRYQNI-LPYYLGASILMDLSPETIEYAKLKRPRVQNYGWNLSGGHYLKYK 330

Query: 139 ENSTSH----PDLANIISKDD------CNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW- 187
           E   SH     + +   + DD       N+    YF+ ++P+F II  + F Q  ++ + 
Sbjct: 331 EEFKSHNKQISNESKFFNFDDPVHLFLVNKLLRYYFDEINPVFSIIHEATFWQQYNNKFL 390

Query: 188 --GGARNVSA--FDAVIGGVVALGSFFSRNFGH--------------------------- 216
             G   N SA  F +++  +++    F    GH                           
Sbjct: 391 RQGKQNNSSAKLFTSMLYLILSTTLRFRE--GHLDGQKGEGINSESSLNITLEEESVLVK 448

Query: 217 --ARELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLV 274
             + E  + +YA  I+   TF  + S E I +W+L + Y R   R    W A    +++ 
Sbjct: 449 RPSIEEKMFKYAYSIINTLTFEWE-SFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMC 507

Query: 275 EATALHHEVDKVELATRNDAPLPPRANSVCE-RARRLFWCAWCINTIISYEYGR 327
              +L+                P   +S  E +A   FWC + ++ +IS++ GR
Sbjct: 508 NGMSLYLN------------KFPEIHSSYDESKAWHCFWCCFIMDKLISFQMGR 549

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 13  RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS-PS 71
           RLRV+KAC  C++RK KCD   PC  C+ +   C+YD          +R   +Q+TS   
Sbjct: 39  RLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRYD-----FKATNRRKKRRQATSLIQ 93

Query: 72  TIQKKEVERPSMLS 85
            + K+ +E    LS
Sbjct: 94  NVDKEYIETDVALS 107

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 15  RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           R R AC  CR R++KCD GFPCG C+     C  +D D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 15  RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           R R AC  CR R++KCD GFPCG C+     C  +D D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 89/202 (44%), Gaps = 25/202 (12%)

Query: 146 DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDA---VIGG 202
           D  ++ S+   +RF D YF+  HP F ++      ++L   +    N  A D    +   
Sbjct: 256 DKYSLSSRATTSRFIDSYFQNFHPFFPLLH----SETLLMLYNNQINSVAKDQWQILFNT 311

Query: 203 VVALGSFFSRNFGHARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARP 260
           V+A+G++     G + ++D+  Y  AK  L         S+  + A  L S Y +   +P
Sbjct: 312 VLAIGAWCLE--GDSTDIDLFYYQNAKSHLTGAKIFETGSVTLVIALHLLSQYTQWRQKP 369

Query: 261 HVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTI 320
           + ++     ++ +  +  LH E+           PL  + NSV E+ RR++W  +     
Sbjct: 370 NTSFNFHGHSIRMAISLGLHKEL-----------PLNFKDNSVKEQRRRIWWYIYSQEFH 418

Query: 321 ISYEYGRS---CVTLNKISCKL 339
           ++  YGR     + LN+I+  L
Sbjct: 419 LALSYGRPLQFLMDLNEITIAL 440

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          R +V KACL CR+RK KC   FPC  C +Y   C +D+
Sbjct: 10 RKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVFDE 47

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPST 72
          R +V KAC  CR+RK KC   +PC  C +Y   C +DD+        K  S   ST   T
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDL--------KEDSSNPSTVGGT 81

Query: 73 IQK 75
           QK
Sbjct: 82 TQK 84

>Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON}
          (22248..24344) [2097 nt, 699 aa]
          Length = 698

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 17 RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          R AC  CR+R++KCD G+PCG C      C  +DVD
Sbjct: 8  RLACSNCRRRRKKCDLGYPCGTCERLKLVCNVNDVD 43

>KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {ON}
           conserved hypothetical protein
          Length = 678

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 89/230 (38%), Gaps = 43/230 (18%)

Query: 13  RLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLS------------FYE 59
           R R  K+C+ C   KRKCD   P C  C      C+Y   +  L              ++
Sbjct: 19  RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYFTEEHVLERCLQRQSNLRSVIHQ 78

Query: 60  KRPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQ 119
           K P+ + ST+  TI + +    + L+P SSE      +++  + ++S   + +Y+ L L 
Sbjct: 79  KAPASRSSTN-ETISENDTLPTTELNPSSSE----TEARNFKLIVNSTGEYSKYISLSLF 133

Query: 120 SVNPPH------------------LHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTD 161
             + P                   +  F++  G      +T+   L  + SK  C+R   
Sbjct: 134 PFSDPSQIVSYIVDRVPQDQDKYVIFDFSFVSG----RLNTAADILKMLPSKVQCDRLVA 189

Query: 162 VYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFS 211
            +F  + P   I+D  +F       W   +N   +D +   +V     FS
Sbjct: 190 YFFNNIAPFIPILDQEEFEIKYKDLW---KNFKTYDDLNNLMVLFAILFS 236

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           M  T   +P    ++ R AC  CR+R++KCD  +PCG C  Y  +C  ++ D
Sbjct: 75  MNPTTTILPSTTGVKRRLACSSCRRRRKKCDMQYPCGNCVHYKDSCNINEED 126

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 47/112 (41%), Gaps = 25/112 (22%)

Query: 6   ADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSP 64
            D PR+  ++V  AC  C  +K KCD GFP C  C   G  C+Y+        +EK  + 
Sbjct: 62  VDRPRSFNIKVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCKYN--------FEKYSNS 113

Query: 65  KQSTSPSTIQKKEVE---------RPSMLSPCSSE-------RGIFDPSKSR 100
                     ++EVE         R  ++ PC SE       RG F  S S+
Sbjct: 114 AAKDQIIFDLEREVEYWRSKSLGVRELLVDPCLSEKTESANKRGKFGASNSK 165

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 6   ADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPK 65
           A++ +N   R R AC  CR+R++KCD  +PCG C+  G  C  ++ D   +   +  S  
Sbjct: 38  AELKKNDGKR-RLACSNCRKRRKKCDVEYPCGGCSRLGLECNINEEDLRKT---RHSSSH 93

Query: 66  QSTSPSTIQKKEVERPSMLSPCSSERGIFD 95
             T  + I   E +   M+S  SS    FD
Sbjct: 94  VKTLEAHISNLEKDIQRMVSIFSSNASEFD 123

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 17 RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          R AC+ CRQR+RKCD   PC +C  +G  C +   D
Sbjct: 16 RLACITCRQRRRKCDMQEPCSICIKFGTRCVFTGED 51

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
          Putative protein of unknown function; similar to
          transcriptional regulators from the Zn[2]-Cys[6]
          binuclear cluster protein family; mRNA is weakly cell
          cycle regulated, peaking in S phase; induced rapidly
          upon MMS treatment
          Length = 758

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          G +  +  + R  +AC+ CR+RK +C    PC +C +  Y C+YD
Sbjct: 32 GTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKYD 76

>KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 727

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          M +  +  P  KRL    AC  CR+R++KCD  +PCG C   G  C  + VD
Sbjct: 26 MDSEASSEPPAKRL----ACANCRRRRKKCDLEYPCGRCQELGLGCNINKVD 73

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 12/121 (9%)

Query: 2   VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD-----------D 50
           VA  +      RLRV+KAC  C++RK KCD   PC  C  +   C+Y+            
Sbjct: 39  VAAASKENSRGRLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRYEFKATNRRRRRRQ 98

Query: 51  VDGPLSFYEKRPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDP-SKSRYMSLHSAVA 109
              P+    +  +    T P  +  K     +  S C S      P S S Y +L S + 
Sbjct: 99  ATSPIQNVNEEYTEIDETFPKDVLSKSNTNINPPSDCLSSSAENSPYSNSHYQNLQSTLP 158

Query: 110 F 110
           F
Sbjct: 159 F 159

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 85/205 (41%), Gaps = 48/205 (23%)

Query: 157 NRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW---GGARNVSA--FDAVIGGVVALGSFFS 211
           N+    YF+ ++P+F II  + F Q  ++ +   G   N SA  F +++  +++    F 
Sbjct: 366 NKLLRYYFDKINPLFSIIHEATFWQQYNNKFLRQGKQNNSSAKLFTSILYLILSTTLRFM 425

Query: 212 R---NFGHARE------LDIV------------------QYAKDILEDPTFSSQPSIEQI 244
               N G   E      L+I                   +YA  I+   TF  + S E I
Sbjct: 426 EGHLNNGKREENHSDSCLNITFEEESVLNRKPLIEERMFKYAYSIISTLTFEWE-SFELI 484

Query: 245 SAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVC 304
            +W+L + Y R   R    W A    +++    +L+  ++K            P  +S  
Sbjct: 485 QSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMSLY--LNKF-----------PEIHSTY 531

Query: 305 E--RARRLFWCAWCINTIISYEYGR 327
           +  +A   FWC + ++ +IS++ GR
Sbjct: 532 DESKAWHCFWCCFIMDKLISFQMGR 556

>TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON}
          Anc_5.322 YHR056C
          Length = 852

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYG-YNCQYDDVDG----PLSFYEKRPS 63
          R +++R   AC+ CR+RK  CD   P CG C   G Y+C + DV G     +S YE++ +
Sbjct: 4  RGRKMRKPPACVQCRRRKIGCDRVKPVCGNCNKSGKYDCFFPDVPGMYTPSVSNYERKTT 63

Query: 64 PKQSTS 69
          PK S +
Sbjct: 64 PKVSKA 69

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 76/178 (42%), Gaps = 17/178 (9%)

Query: 152 SKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFS 211
           S++  +RF D YF   HP   II    F    ++    + +   +  +   V+A+G++  
Sbjct: 283 SRNTTSRFVDSYFTNFHPYCPIIYSDTFLMIYNNQIA-SDSKEQWQLLFNTVLAIGAWCL 341

Query: 212 RNFGHARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCM 269
              G + ++D   Y  AK  L    F S  SI  + A+ L S Y++   +P+ A+     
Sbjct: 342 E--GDSTDIDQFYYNNAKSHLTSQVFESG-SISNVIAFHLLSKYIQWREKPNTAFNYHGH 398

Query: 270 TMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGR 327
           ++ L  +  LH            D P  P    + E+ RR++W  +     +S  YGR
Sbjct: 399 SIRLALSLGLHK-----------DLPTAPGNELIKEQRRRIWWVIYTHEFHLSLSYGR 445

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          KR R    C  CR+RK KCD   P C  C   G  C YD        +E++P+PK  T  
Sbjct: 10 KRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVYD--------FEQQPTPKNPTKS 61

Query: 71 S---TIQKKEVE 79
          S      +KE+E
Sbjct: 62 SETIAFLQKELE 73

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 12/72 (16%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGM-CTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          KR R+   CL CR+RK KCD   PC + C   G  C YD         E++P+P++S+  
Sbjct: 17 KRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYD--------IERQPAPRKSSKV 68

Query: 71 S-TIQ--KKEVE 79
          S TI+  ++E+E
Sbjct: 69 SETIELLQRELE 80

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 7  DVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD--------DVDGPLSFY 58
          +  + +R +V KAC  CR+RK KC+   PC  CT+Y   C Y         D  G  +  
Sbjct: 15 NTAKKQRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIYSIPDSNSQTDKLGRANTI 74

Query: 59 EKR--PSPKQSTSPS-TIQKKEVE 79
          +K     P+ +TSP+  IQKK ++
Sbjct: 75 KKNKVKKPQNTTSPNDGIQKKTIK 98

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 3/82 (3%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS 69
           R  R +V KAC  CR+RK KC+  FPC  C  Y   C +    G       +   K S  
Sbjct: 36  RKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFSTRQGGARI---KNLHKTSLE 92

Query: 70  PSTIQKKEVERPSMLSPCSSER 91
            +T+Q KE    S  S  + +R
Sbjct: 93  GTTVQVKEETDSSSTSFSNPQR 114

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/371 (19%), Positives = 135/371 (36%), Gaps = 85/371 (22%)

Query: 17  RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD-----GPLSFYEKRPSPKQSTSPS 71
           R ACL CR +++KC+   PC  C   G  C +   D       +S+         +   S
Sbjct: 18  RLACLHCRHKRKKCNMKSPCSNCQRAGMKCIFTHEDLRSKRKSVSYLTTLEEHIATLESS 77

Query: 72  TIQKKEVERPSMLSPCSSER-------GIFDPSKSRYMSLHSAVAF-------PRYLGLE 117
            ++ +E       +P  +ER        +F+ SK    +  S +++       P  L L 
Sbjct: 78  IVKARE-------APTEAERVDALRLISLFEDSKENSATGMSPLSYETSRDVTPSNLILS 130

Query: 118 LQSVNPPHLHSFAWN-------CGIRPEENSTSH-------PDLANIISKDDCNRFTDVY 163
              V  P +H+   N         I+ + N  ++         + N+       R   ++
Sbjct: 131 QNHVAAPKVHTLETNSIYPTNSLSIKAQRNHATNEARIQAQATIRNLARSPPILRSLSIF 190

Query: 164 FEVVHP-MFDIIDPSQFRQSLDSYWG--GARNVSAFDAVIGGVVALGSFFSRNFGHAREL 220
           F+ ++P  +  I    F   L +++G    ++    + ++  + ALG+  +       E 
Sbjct: 191 FKWLYPGHYMFIHRETF---LSAFFGDESTKDYYCSEELVFAISALGAKAAMVTDELHEK 247

Query: 221 DIVQY--AKDILEDPTF----------SSQPSIEQISAWVLRSIYLRATARPHVAWLASC 268
             V Y  AK I+    F          +S   +  I   +  + Y  A+A   +AW  S 
Sbjct: 248 SEVYYHRAKQIVLTKVFQLVDRSLAESTSSSKLAIIQTLLCLAFYDVASAENSMAWYLSG 307

Query: 269 MTMHLVEATALH-----------HEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCI 317
           +   +     LH            E+ K++ A R+                R++W  +  
Sbjct: 308 LAFRIAHEIGLHLSPEAWNHVYEDELSKMDFAVRS----------------RIYWGCYLA 351

Query: 318 NTIISYEYGRS 328
           + +IS  +GRS
Sbjct: 352 DHLISVLFGRS 362

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595
          aa] {ON} similar to uniprot|P43634 Saccharomyces
          cerevisiae YLR098C CHA4 Zinc-finger protein with
          Zn[2]-Cys[6] fungal- type binuclear cluster domain
          DNA-binding transcriptional activator or CHA1
          Length = 595

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           +  D P N R   + AC  CR+R+RKC+S  PC  C  YG  C   D D
Sbjct: 5  GSSPDEPSNSR---KLACQNCRKRRRKCNSEIPCSNCVKYGIECVPVDQD 51

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
          Anc_7.56 YOR337W
          Length = 710

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          + R +C  CR+R++KCD GFPCG CT     C  ++ D
Sbjct: 35 KKRLSCSNCRKRRKKCDLGFPCGNCTRLEIECNVNEDD 72

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPS 63
            +++   KR R+   C  CR+ K KCD   P CG CT +G  C YD          K+P+
Sbjct: 51  NSEMQNRKRNRISFVCQACRKSKTKCDREKPECGRCTKHGLKCVYD--------VSKQPA 102

Query: 64  PKQSTSPSTIQKKE 77
           P+  +  + I + E
Sbjct: 103 PRIPSKDAIISRLE 116

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 58/148 (39%), Gaps = 16/148 (10%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPS 71
           KR RV   C  CR+RK +CD G PC  C +    C Y       S  E     K S +  
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVY-------SISEMNNGNKVSATQV 119

Query: 72  TIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVNPPHLHSFAW 131
             +      P+  +   +   I DP+ S  + L    A   +   + +S+ PP       
Sbjct: 120 LAETSGTALPNSTADIVAT-AISDPALSNLLPLQQLSAMLPHFQQQSKSIKPP----MGS 174

Query: 132 NCGIRPEE----NSTSHPDLANIISKDD 155
              ++P E    +ST H D   I+  ++
Sbjct: 175 AVPLQPPEVDISSSTVHADAMRIVKLEE 202

>Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG--YNCQY-DDVDGPLSF---------YE 59
          KR R+   C  C++RK KCD   PCG CT  G   +C Y +D  G L             
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCTRLGDADSCIYLNDNAGKLESGSTLNGIEPVR 70

Query: 60 KRPSPKQSTSPSTIQKKEV 78
          K+ +P + TSP  I+K+++
Sbjct: 71 KQTNPVEGTSPGFIKKRKL 89

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 24/41 (58%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          R KRLRV  AC  CR +K+KCD   PC +C +    C Y D
Sbjct: 18 RPKRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSD 58

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG--PLSFYEK 60
          K+LR  +AC  CR+RK KC    PC  C  YG  C ++ V+G  P++F  K
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFEPVNGMTPMNFSSK 60

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa]
          {ON} Anc_7.17 YOR363C
          Length = 989

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEK 60
          ++ G +    +R R+   C  CR+ K KCD   P CG C  +G  C YD         EK
Sbjct: 27 LSPGFETHVKRRNRISFVCQACRRSKTKCDREKPRCGRCQQHGLQCIYD--------VEK 78

Query: 61 RPSPKQSTSPSTIQK 75
          + +PK  +  +TI +
Sbjct: 79 QAAPKNPSKDATIAR 93

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD-GPLSFYEKRP---SPK 65
          R +  RV KAC  CR++K KCDS  PC  C      C+Y +    PL  + K     S  
Sbjct: 8  RRQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRYKNQPCEPLEAFFKYTGSLSND 67

Query: 66 QSTSPSTIQKKEVERPSMLSPCSSERGI 93
                TI+K + + PS  +P S ++G+
Sbjct: 68 LDDVKCTIEKLKTQLPSS-APASLQKGL 94

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 139/360 (38%), Gaps = 49/360 (13%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFY-- 58
           M   G  V +  R   + AC  CR+R+RKC+   PC  C  +  +C   + D   + Y  
Sbjct: 1   MSPEGFRVTKTPR---KLACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTA 57

Query: 59  -------EKRPSPKQSTSPSTIQKKEVERPSML--------SPCSSERGIFDPSKSRYMS 103
                  EK    + + + S  ++K ++   +L        +  +S   +    K    +
Sbjct: 58  SYVKSLEEKIAYLESNLTESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKN 117

Query: 104 LHSAVAFPRYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVY 163
            ++ V  P    L   S+ P  +HS + +      E   +  +L N+       R    +
Sbjct: 118 EYNLVENP----LRSSSIYP--MHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFF 171

Query: 164 FEVVHPM-FDIIDPSQFRQSLDSYWGGARNVSAF--DAVIGGVVALGSFF--SRNFGHAR 218
           F+ ++P  +  I    F   L S++G     S +  + ++  + ALG+    S +  + R
Sbjct: 172 FKWLYPAHYFFIHRETF---LSSFFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYGR 228

Query: 219 ELDIVQYAKDI-------LEDPTFS-SQPS--IEQISAWVLRSIYLRATARPHVAWLASC 268
             +  Q +K I       LED +F+ S PS  +  I   +  + Y        +AW  S 
Sbjct: 229 STEFYQTSKSIVLKKVFQLEDSSFADSTPSSKLAIIQTLLCLAFYDIGNGENPMAWYLSG 288

Query: 269 MTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRS 328
           +   +     L  + D       ND      +    E   R++W  +  + +IS  +GR+
Sbjct: 289 LAFRIAHEIGLQLDPDAWSNVYENDL-----SKIDFEVRSRIYWGCYIADHMISILFGRT 343

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG 53
          R  R +V KAC  CR+RK KC+  FPC  C  Y   C +    G
Sbjct: 33 RKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTTRQG 76

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          R++VR+AC  CR+RK KC    PC  C +Y  +C Y +
Sbjct: 16 RIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIYSE 53

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF 57
          A G   P ++R +   AC  CR+RK KC   +PC  C +Y   C+Y D    + F
Sbjct: 11 ADGVQKPAHRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEYVDKAAQVKF 65

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          +  RLR+   C  CR+RK KCD   P CG C   G  C YD
Sbjct: 22 KKSRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYD 62

>AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YBR240C (THI2)
          Length = 382

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          R  R+R    C  CR +KR+CD G P C +C  +G  C YD
Sbjct: 14 RKPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDACSYD 54

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 11 NKRL--RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPL---SFYEKRPSPK 65
          NKR   RV +AC  CR+RK KC+   PC  C +    C YD +   +   + Y+     +
Sbjct: 13 NKRSSHRVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHYDGIQVDMVKNNLYKDEEDVR 72

Query: 66 QSTSPSTIQKKEVERPSMLSP 86
          +   P     K +E+ S  +P
Sbjct: 73 KCLRPLVQSIKNLEKLSFANP 93

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
          YJL206C (REAL)
          Length = 833

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          G +  +  R R  +AC+ CR+RK +C    PC +C +  + C+YD
Sbjct: 19 GTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKYD 63

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          +RLRV++AC  C++RK KCD   PC  C     +C Y
Sbjct: 17 QRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTY 53

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 81/216 (37%), Gaps = 48/216 (22%)

Query: 146 DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW---GGARNVSA---FDAV 199
           D  NII      +    YF+ ++  F+II  S F    ++ +      +N+ +   F ++
Sbjct: 275 DFENIIHLSIIRKLLTFYFKEINKPFNIIHESMFWDQYNNVFIQQEKQKNIESTKLFKSM 334

Query: 200 IGGVVALGSFFSRNFGHARELDI--------------------------VQYAKDILEDP 233
           +  ++     F   F    + DI                            Y+  I+   
Sbjct: 335 LYLIIITTLRFQEGFLEENDNDIPHTKLTKEEKIILESLKSEKALEDSMFNYSYSIISKL 394

Query: 234 TFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRND 293
           TF  + S E I +W+L + YLR   R   +W A    ++L    +LH           N+
Sbjct: 395 TFEWE-SFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMSLH----------LNE 443

Query: 294 APLPPRANSVCERARRL--FWCAWCINTIISYEYGR 327
               P  +S  E ++    FW  + I+  IS++ GR
Sbjct: 444 F---PHIHSKYEESKLFHCFWACFIIDKFISFQLGR 476

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
           KR R+   C  CR+ K KCD   P CG C  +G  C YD         EK+ +P+  +  
Sbjct: 52  KRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVYD--------VEKQAAPRNPSKD 103

Query: 71  STIQKKE 77
           +TI + E
Sbjct: 104 ATIARLE 110

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 67/166 (40%), Gaps = 31/166 (18%)

Query: 15  RVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPSTI 73
           RV +AC  CR +K KCD   P C  C   G+ C+  D     SF    P     T    +
Sbjct: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSF----PRGYTETLEERV 110

Query: 74  QKKEVERPSMLSPCSSERGIF---------DPSKSRY---MSLHSAVAFPRYLGLELQSV 121
           ++ E E   +++ C+S+ G            PSK +    M   S   F   + L+LQ  
Sbjct: 111 RELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENMELQLQQS 170

Query: 122 NPPHLHSFAWNCGIRPEENSTSH--PDLANIISKDDCNRFTDVYFE 165
                     +CG     +   H  P ++NII   D N  TDV FE
Sbjct: 171 --------CSSCGNSDPNHRCVHLKPVVSNIIV--DSN--TDVSFE 204

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY-DDVD 52
          VP  KR R    CL CR+RK KCD G P C  C   G  C Y +D D
Sbjct: 9  VPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTD 55

>YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}
          THI2Transcriptional activator of thiamine biosynthetic
          genes; interacts with regulatory factor Thi3p to
          control expression of thiamine biosynthetic genes with
          respect to thiamine availability; acts together with
          Pdc2p to respond to thiaminediphosphate demand,
          possibly as related to carbon source availability; zinc
          finger protein of the Zn(II)2Cys6 type
          Length = 450

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          VA+ + VP  K  R    C  CR +KR+CD   P C +C  +G NC YD
Sbjct: 13 VASSSKVPPTKG-RTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYD 60

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG 53
          +V++AC  CR+RK +CD   PC  C S    C Y D  G
Sbjct: 8  KVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYHDSAG 46

>Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)
          [168 bp, 56 aa] {OFF} YOR380W (HSP)
          Length = 56

 Score = 38.9 bits (89), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          RV+  C+  R+RK+  +  F C MC  +GY C Y D
Sbjct: 2  RVQNICVQIRERKKTYNDRFSCEMCFGHGYVCNYID 37

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
          PDR3Transcriptional activator of the pleiotropic drug
          resistance network, regulates expression of ATP-binding
          cassette (ABC) transporters through binding to
          cis-acting sites known as PDREs (PDR responsive
          elements); post-translationally up-regulated in cells
          lacking a functional mitochondrial genome
          Length = 976

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          V ++ R +V  AC+ CR+RK KC   +PC  C SY   C +
Sbjct: 3  VKKSTRSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVF 43

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          PRNK   V +AC  CR+RK KC   +PC  C +Y   C Y
Sbjct: 9  PRNK---VNRACYNCRRRKIKCTGKYPCSSCEAYQCECLY 45

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 4/77 (5%)

Query: 3   ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRP 62
             G   PR K   V +AC  CR++K KC    PC  C +YG  C Y      ++   K+ 
Sbjct: 41  GNGTGKPRRK---VSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVA-KGKKK 96

Query: 63  SPKQSTSPSTIQKKEVE 79
           + K  +S  T +K  V+
Sbjct: 97  TAKSDSSAFTKEKLSVQ 113

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 4  TGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          +G  V + KR +V +AC  CR+RK KC    PC  C +Y   C Y
Sbjct: 3  SGNRVVKKKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTY 47

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
           KR R+   C  CR+ K KCD   P CG C  +G  C YD          K+P+P+  +  
Sbjct: 58  KRNRISFVCQACRKSKTKCDREKPECGRCIKHGLKCVYD--------VSKQPAPRIPSKD 109

Query: 71  STIQKKE 77
           + I + E
Sbjct: 110 AIISRLE 116

>Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON}
          YKL222C (REAL)
          Length = 704

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTS-YGYNCQYDD 50
          G +  R  R +  K+CL CR RK KCD G P CG C+S +  +C Y+D
Sbjct: 9  GNNGGRQTRKKPAKSCLFCRLRKLKCDRGRPSCGSCSSRHQKSCNYED 56

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 9/81 (11%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQST 68
           R KR R+   C  CR+ K KCD   P C  C  +G  C YD         E +  PK  +
Sbjct: 42  RKKRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVYD--------IEFQVKPKTPS 93

Query: 69  SPSTIQKKEVERPSMLSPCSS 89
             + I++ E +  +  S C S
Sbjct: 94  KTAIIKRLEADLQNYKSQCMS 114

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 2   VATGADVPRN-KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           V +GAD P +    RV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 72  VTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG 53
          R  R +V KAC  CR+RK KC+  FPC  C  Y   C +    G
Sbjct: 33 RKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTFTTRHG 76

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
           KR R+   C  CR+ K KCD   P CG C  +G  C YD          K+P+P+  +  
Sbjct: 58  KRNRILFVCQACRKSKTKCDREKPECGRCVKHGLKCVYD--------VSKQPAPRIPSKD 109

Query: 71  STIQKKE 77
           + I + E
Sbjct: 110 AIISRLE 116

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
           A   + PRNK   VR+AC  CR+RK KC    PC  C +YG  C +
Sbjct: 20 TAGKINKPRNK---VRRACNNCRKRKIKCTGLHPCASCEAYGCPCIF 63

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 7  DVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          +VPR ++L    AC  CR+R+RKCD   PC  C  +  +C +   D
Sbjct: 35 NVPRKRKL----ACQSCRRRRRKCDMEKPCSNCIKFQTDCVFAQQD 76

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
          (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG 43
          R KR R+   C  C++RK KCD G PC  CT  G
Sbjct: 9  RKKRHRITVVCTNCKKRKSKCDRGKPCSNCTRIG 42

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          V ++ R +V  AC+ CR+RK KC   +PC  C SY   C +
Sbjct: 3  VKKSTRSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVF 43

>KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121
          Length = 688

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 106/272 (38%), Gaps = 53/272 (19%)

Query: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTS--YGYNCQYDDVDGPLSFYEKRP 62
           G+   +  R+R  K+C  C   K KCD G PC  C S      C Y         + +  
Sbjct: 47  GSRTKKITRVRTIKSCKYCYTHKLKCDKGTPCSRCLSMEMANECTYG--------FNRTN 98

Query: 63  SPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVN 122
              +S +P +   K  E+   +     E  ++   KS+Y        +P +      S+N
Sbjct: 99  GATRSAAPLSKVAKGGEK---MWNVIDESALY---KSKYF-------YPFFTS----SIN 141

Query: 123 PPHLHSFAWN------CGIRPEENSTSHPDLANIISKDDCNRF----------TDVYFEV 166
              L + A+         +R E  +    D   + S++  N F           + +FE 
Sbjct: 142 DRILSAEAYGKIALSENFVRNEITNFDRLDTCRLSSEEIFNLFPSGKSVARAQVESFFEN 201

Query: 167 VHPMFDIIDPSQFRQSLDS---YWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIV 223
           +HP+  II   +    LD+   Y    + VS  D ++   +   S ++ N       D++
Sbjct: 202 IHPVIPIISKQKLLLKLDNLYKYLESDKQVSVLDVLLLAAIFFCSAYA-NVASGIIPDLL 260

Query: 224 ----QYA--KDILEDPTFSSQPSIEQISAWVL 249
                YA  K +L+   F  +P+IE + A+VL
Sbjct: 261 LCNKYYAAYKSLLDVTGFPMRPNIEPLQAFVL 292

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
          YOR363C
          Length = 948

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 35/84 (41%), Gaps = 15/84 (17%)

Query: 3  ATGADV------PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPL 55
           TG DV       + KR R+   C  CR  K KCD   P CG C   G  C YD +    
Sbjct: 6  VTGPDVVVKAPSQKRKRNRLSYVCKACRTAKAKCDKEKPQCGRCYKLGVECVYDTI---- 61

Query: 56 SFYEKRPSPKQSTSPSTIQKKEVE 79
               +  PK ST  + I+  E E
Sbjct: 62 ----IQTGPKYSTKETKIRILENE 81

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          ++A+G  V + KR +V +AC  CR+RK KC    PC  C +Y   C Y+
Sbjct: 6  ILASG--VIKKKRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTYN 52

>TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.56
          YOR337W
          Length = 662

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          R R AC  CR+R++KCD  +PCG C      C  ++ D
Sbjct: 35 RKRLACSNCRRRRKKCDLTYPCGNCQRLSLECNVNEED 72

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
          KR ++ KAC+ CR+RK KCD   P C  C+S   NC Y
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIY 43

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
          {ON} some similarities with uniprot|P07272
          Saccharomyces cerevisiae YLR014C PPR1 Zinc finger
          transcription factor containing a Zn(2)-Cys(6)
          binuclear cluster domain positively regulates
          transcription of genes involved in uracil biosynthesis
          activity may be modulated by interaction with Tup1p
          Length = 678

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          + +R     AC  C++R+++CD GFP CG C + G  C + D
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 40.0 bits (92), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 13/77 (16%)

Query: 16  VRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPSTIQK 75
           V++AC  CR R+ KCD   PCG C     NC Y               P +   P +I+ 
Sbjct: 37  VKQACDCCRVRRVKCDGKGPCGRCLQRDLNCTY-------------LQPLRKRGPKSIRS 83

Query: 76  KEVERPSMLSPCSSERG 92
           + +++ + +   S   G
Sbjct: 84  RSLKKIACVQRVSENNG 100

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 76/354 (21%), Positives = 135/354 (38%), Gaps = 52/354 (14%)

Query: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD-----------DVDG 53
           G +  +  R R  +AC+ CR+RK +C    PC  C +    C YD           ++  
Sbjct: 52  GTNELKPTRGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTYDRPPRKPPVFGRELSD 111

Query: 54  PLSFYEKRPSP----KQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVA 109
             S Y +  S     + ++S STI  + +   +++ P +  + +  PS +  + L +  A
Sbjct: 112 DNSLYSQGTSQQGDVRTTSSQSTIDYRSIVE-AIIPPEALHQIVTSPSFNNEIFLETVKA 170

Query: 110 FPRYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHP-DLA-NIISKD-DCNRFTDVYFEV 166
           +     L++ S+      S   N   R + N    P D+A   I K  DC     V F  
Sbjct: 171 YSLQGQLDVNSI---IRESLPKNTPWRIKTNIPLPPRDIALKFIQKTWDC---ACVLFRF 224

Query: 167 VH--PMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFF-----SRNFGHARE 219
            H   +  I+D     + L   +   +  +    +I  V+A+G+ F     S++    RE
Sbjct: 225 YHRPTIISILDSIYAAEKLGKEYTPEQVKTK--PLIYSVLAVGALFSKDDLSKDSNATRE 282

Query: 220 LDIVQYAKDILEDP---TFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEA 276
               +  +  LE      FS+   I  I A  + +I+L+ +A     +    + +     
Sbjct: 283 FYTDEGYRYFLEAKRSLDFSNITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALK 342

Query: 277 TALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAW----CINTIISYEYG 326
             LH +          D           E  +RLFW  +     +N I+ +  G
Sbjct: 343 EGLHRKSSITGPTAIQD-----------ETKKRLFWSVYKLDLYMNCILGFPSG 385

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
          {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
          lactis KLLA0A03421g and weakly similar to YAL051W
          uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate- activated transcription factor acts alone and
          as a heterodimer with Pip2p activates genes involved in
          beta- oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 946

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPS 63
          GA + + KR ++   C  CR+ K KCD   P C  C   G+ C YD         E +P+
Sbjct: 15 GAAIGK-KRNKLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQCIYD--------LELQPT 65

Query: 64 PKQSTSPSTIQK--KEVE 79
          PK  +  +TI +  KE+E
Sbjct: 66 PKNPSKDATITRLQKELE 83

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 75/170 (44%), Gaps = 21/170 (12%)

Query: 150 IISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSF 209
           + S++  +++   YF+  H  + +ID   F +  D+   G R V  +  +   V+A+G++
Sbjct: 207 LCSRNVTSKYVKAYFDNFHIYYPLIDTHIFLKLYDNQ-AGLRYVDQWQILFNTVLAIGAW 265

Query: 210 FSRNFGHARELDIVQYA--KDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLAS 267
            S   G + + D+  Y+  K  L+   F +  S+  + A+ L S Y      P+  +L  
Sbjct: 266 SSE--GESTDADLFYYSNVKSHLKPKVFEAG-SVTLVIAFHLLSRYAEWRQNPNTGYLYH 322

Query: 268 CMTMHLVEATALHHEVDKVELATRNDAPLPPRA--NSVCERARRLFWCAW 315
              + +  +  LH +             LPP    + + ER RR++ C +
Sbjct: 323 GHALRMAISLGLHRD-------------LPPEGIPDVIKERRRRIWTCLY 359

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 12 KRLR-VRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
          KRL  +  AC  CRQ+K +C    P C  C   G+ C Y
Sbjct: 2  KRLNTIDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCY 40

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGY--NCQYD 49
           KR   R+AC+ C+ +K KCD  +PCG C   G    C Y+
Sbjct: 7  GKRKVGRRACMLCKLKKLKCDGNYPCGRCAKSGVPSECGYE 47

>Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON}
          (88566..91013) [2448 nt, 816 aa]
          Length = 815

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCT-SYGYNCQYDDVDGPLSFYEKRPSPKQ 66
          R ++++   AC+ CR+RK  CD G P CG C  S+  +C Y DV G  ++    P+P++
Sbjct: 5  RGRKMKKPPACVQCRRRKIGCDRGKPICGNCAKSHKTDCFYPDVPG--AYVTSSPAPEK 61

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 9   PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           P  KRL    AC  CR+R++KCD  +PC  C   G  C  ++ D
Sbjct: 69  PTKKRL----ACSNCRRRRKKCDLQYPCFTCDKLGLECNINEED 108

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          +P+ KRL    AC  CR+R++KCD  +PC  C     +C  ++ D
Sbjct: 51 LPKRKRL----ACTNCRKRRKKCDLSYPCASCVRLRIDCNVNEED 91

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMC--TSYGYNCQY 48
           TG    + KR RV  +C  CR+RK KCD G P C  C  T  G+ C Y
Sbjct: 8  GTGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHY 56

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {ON}
           Anc_1.199
          Length = 995

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 13/70 (18%)

Query: 9   PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFY-----EKRPS 63
           P  KR R    C  C++RK KCD   PCG C   G        DG   FY     + +PS
Sbjct: 61  PSRKRHRSTVVCTNCKKRKSKCDRSRPCGTCKRLG--------DGNSCFYIPEVPKVKPS 112

Query: 64  PKQSTSPSTI 73
             + +S S I
Sbjct: 113 KSRKSSISNI 122

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 74/182 (40%), Gaps = 16/182 (8%)

Query: 146 DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVA 205
           D   +  ++  + + D YF+  H ++ ++    F    +       NV  +  ++  V+A
Sbjct: 375 DSVYLAKRETISAYIDAYFKHYHALYPLVSKEMFFAQYNDQ-IKPENVEIWHILLNAVLA 433

Query: 206 LGSFFSRNFGHARELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWL 265
           LGS+ S +      L   Q A   L      +  S +   A +L + Y++   +P+ AW 
Sbjct: 434 LGSWCSNSCSSHHTL-YYQNALSYLSTAVLETG-STDLTIALILLTHYVQKMHKPNTAWS 491

Query: 266 ASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEY 325
              +  H+  +  LH ++     +T +D  L           R L+W  +C    +S E 
Sbjct: 492 LIGLCSHMATSLGLHRDLPN---STIHDQQL----------RRVLWWTIYCTGCDLSLET 538

Query: 326 GR 327
           GR
Sbjct: 539 GR 540

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 16  VRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
           + +AC  CR++K KC    P C  C  Y  +C Y
Sbjct: 91  MHQACDACRKKKWKCSKTVPTCTNCLKYNLDCVY 124

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 7   DVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPK 65
           ++   KR R+   C  CR+ K KCD   P C  C   G  C YD+        E++P P+
Sbjct: 37  NIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDE--------ERQPRPR 88

Query: 66  QSTSPSTIQKKE 77
                +TI K E
Sbjct: 89  IPNKDATIAKLE 100

>ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
           Mutants are defective in Ty1 Enhancer- mediated
           Activation Ty1 enhancer activator and to YLR098C
           uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
           Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain DNA-binding transcriptional
           activator or CHA1
          Length = 764

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 17  RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
           R AC  CR+R++KCD  FPCG C      C  +  D
Sbjct: 70  RLACSNCRRRRKKCDLNFPCGNCIKLKLTCNINGED 105

>KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conserved
           hypothetical protein
          Length = 632

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 73/185 (39%), Gaps = 28/185 (15%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG------YNCQYDDVDG-PLSFYEKRPSP 64
           KR R  K+C  C + K KC+   PC  C   G      Y  + D+VD  PLS  E     
Sbjct: 5   KRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGFKKDEVDAKPLSSTETFKPK 64

Query: 65  KQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVNPP 124
            Q    S+   K       LS  ++E  + +         H A   P    ++   V   
Sbjct: 65  DQVLKTSSTHPKTKPYYPYLSGANAEEVLSNR--------HQAHKNPTDACMKRNEVT-- 114

Query: 125 HLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRF--TDVYFEVVHPMFDIIDPSQ-FRQ 181
           + + F   C         S  ++A++I     + F   DVYF  +HP+  ++D  + FRQ
Sbjct: 115 NFNKFDVKC--------MSVEEVASLIPPSQASTFLVVDVYFHKIHPIIPVLDREEVFRQ 166

Query: 182 SLDSY 186
             + Y
Sbjct: 167 IEEVY 171

>Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W
          (REAL)
          Length = 832

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          ++R R+R  CL C++ KRKCD   P C  C  +   C+Y+D
Sbjct: 6  SRRSRLRLVCLQCKRIKRKCDKVRPVCSRCQQHSLECKYED 46

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
          Ashbya gossypii AGR061C
          Length = 627

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          +++ AC  CR+R+RKCD   PC  C  +G  C   D D
Sbjct: 9  KLKLACQSCRKRRRKCDLQMPCLNCQKFGVECLPIDQD 46

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          +T +D P  KR+    ACL CRQ+  KC  G PC  C      C+Y
Sbjct: 15 STSSDPPTEKRV----ACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 4   TGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           T  +   N  LRV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
           (REAL)
          Length = 1010

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 8   VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQS 67
           V ++ R +V  AC+ CR+RK KC    PC  C SY   C +     P      +P P  +
Sbjct: 44  VKKSTRSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLPQGKDAPQPFPA-A 102

Query: 68  TSPSTIQKKEVE 79
           T+PS+    +V+
Sbjct: 103 TAPSSSSHPDVD 114

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          + +G+D+   K+L++  AC  CR+R+RKCD   PC  C  +G  C   D D
Sbjct: 1  MQSGSDL---KKLKL--ACQTCRKRRRKCDLQVPCVNCQKFGVECLPVDQD 46

>NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884
          bp, 627 aa] {ON} Anc_7.56 YOR337W
          Length = 627

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 12 KRLRV---RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          KRLR    + AC  CR+ +RKCD+G PC  C  +   C Y   D
Sbjct: 18 KRLRKILKKLACQHCRKIRRKCDTGSPCANCMKFETECVYTGHD 61

>KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 652

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQ 47
          ++G+ +   KRL    AC  CR+R++KCD G+PC  C     +C 
Sbjct: 21 SSGSPLLSQKRL----ACSNCRRRRKKCDMGYPCASCVKMKLDCN 61

>KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON}
          Anc_5.322 YHR056C
          Length = 827

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMC-TSYGYNCQYDDVDGPLSFYEKRPSPKQS 67
          R +++R   AC+ CR+RK  CD   P CG C  S   +C Y DV G       R  P  S
Sbjct: 4  RGRKMRKPPACVQCRKRKIGCDRVKPMCGNCRKSNRGDCFYPDVPG-------RYVPSSS 56

Query: 68 TSPSTIQKKE 77
          ++ ST++K +
Sbjct: 57 STKSTVEKSD 66

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGP--LSFYEK 60
          RV +AC  CR+RK KCD   PC  C +    C Y+ V  P   SFY +
Sbjct: 16 RVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIYNGVAFPHVKSFYHR 63

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 20/91 (21%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG--YNCQY----------- 48
          +   + V   KR R+   C  C++RK KCD   PCG C   G   +C Y           
Sbjct: 1  MGYDSQVRTKKRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESS 60

Query: 49 ---DDVDGPLSFYEKRPSPKQSTSPSTIQKK 76
             +D D PL    K+ +P +  SP  I+K+
Sbjct: 61 PSLNDAD-PL---RKQSTPAERISPGFIKKR 87

>KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa]
          {ON} conserved hypothetical protein
          Length = 701

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNC 46
          R KR R R  C  CR R++KCD   P CG CT +   C
Sbjct: 23 RPKRNRSRAGCFTCRLRRKKCDEVHPKCGTCTKHVLKC 60

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 10/71 (14%)

Query: 9  PRNKRLRVRKA--CLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPK 65
          P  K+ R+R++  C  C++RK KCD   P CG C+     C YD       F E +   +
Sbjct: 17 PEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD-------FQENKDGRR 69

Query: 66 QSTSPSTIQKK 76
              P T+Q++
Sbjct: 70 GLPGPGTLQEQ 80

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
          (REAL)
          Length = 831

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          ++R R+R  CL C++ KRKCD   P C  C  +   C+Y+D
Sbjct: 6  SRRSRLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYED 46

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNC----QYDDVDG 53
          R +V  AC+ CR+RK KC    PC  C SY   C    +Y  +DG
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVFLRKYLSLDG 52

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
           KR R+   C  CR+ K KC+   P C  C   G  C YD         E +P PK     
Sbjct: 66  KRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFCVYD--------VETQPPPKNLNKL 117

Query: 71  STIQKKEVE 79
            TIQ+   E
Sbjct: 118 QTIQRLNEE 126

>TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa]
          {ON} Anc_5.322 YHR056C
          Length = 1106

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMC---TSYGYNCQYDDVDGPLSF 57
          R +R+R   AC+ CR+RK  CD   P CG C   TS G  C Y DV G + +
Sbjct: 6  RGRRMRRPPACVQCRRRKIGCDRARPVCGNCAKNTSRG-ECIYPDVPGQIDY 56

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 703

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 6  ADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG--YNCQY 48
           ++  N   + ++AC  C++RK++C  G PC  C   G    C+Y
Sbjct: 4  TEIELNGNAKSKRACETCKRRKKRCSGGLPCEYCVKIGNPQGCEY 48

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          +  +L++++AC  CR+RK KC    PC  C +Y   C Y
Sbjct: 6  KKSQLKIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVY 44

>Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C
           (CEP3) - contains an N-terminal Zn2Cys6 type zinc finger
           domain, a C-terminal acidic domain and a putative coiled
           coil dimerization domain [contig 252] FULL
          Length = 579

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 98/281 (34%), Gaps = 61/281 (21%)

Query: 15  RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPSTIQ 74
           + R  C+ C +RK KCD   PC  C   G                      Q       +
Sbjct: 7   KTRTPCVVCTKRKVKCDRNIPCSNCVKRG----------------------QQELCIASE 44

Query: 75  KKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQSVNPPHLHSFAWNCG 134
           + +++R S   P   ERG  D     +   H  V        EL       L    W   
Sbjct: 45  RTKLDRSSRSPPL--ERGKLDFQLMWHAYGHWVV--------ELGIFQNDLLAHDVWEDR 94

Query: 135 IRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDII--DPSQFRQSLDSYWGGARN 192
           I   E + SH         D+  +  D   E + P+F  I  D S     L+ +W G + 
Sbjct: 95  INSNELTLSH---------DNSFKLLDFAAENLGPLFFGIVSDVSDLYFKLEEHWFGPKT 145

Query: 193 VSAF--DAVIGGVVALGSFF------------SRNFGHARELDI-VQYAKD---ILEDPT 234
             +   +AV+  +  L  F+            S+ + + R + +  QY  +   +L    
Sbjct: 146 GDSLFTEAVLSSIFTLAIFYMPLEALTEIAGDSQEWNNQRRMRLYTQYCNETIGLLHQAQ 205

Query: 235 FSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVE 275
           F S+P I  +  +++ +     T +P +A       +HL +
Sbjct: 206 FLSKPDIRTLQTYLILASTPFPTLKPSLANSILTQCLHLAK 246

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 33/71 (46%), Gaps = 11/71 (15%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          KR R+   C  CR+ K KCD   P C  C   G  C YD         E++  P+  +  
Sbjct: 20 KRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIECVYD--------IEQQTQPRNPSKD 71

Query: 71 STIQ--KKEVE 79
          +TI   KKEVE
Sbjct: 72 ATIGRLKKEVE 82

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785
          bp, 594 aa] {ON} complement(32885..34586,34699..34781)
          [1785 nt, 595 aa]
          Length = 594

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 14 LRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          L+ + AC  CR+R+RKC+   PC  C  +G  C   ++D
Sbjct: 23 LKRKLACQGCRKRRRKCNFEVPCSNCIKFGSECVSVNLD 61

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          R  +ACL CR+RK KC    PC  C +Y   C Y
Sbjct: 13 RAARACLNCRRRKVKCSGQSPCANCRNYNCACTY 46

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 18 KACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          +AC+ CR+RK KC+   PC  C + G  C YD
Sbjct: 49 QACISCRRRKVKCNGCRPCSSCKTNGLECAYD 80

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
          {ON} weakly similar to uniprot|P46954 Saccharomyces
          cerevisiae YJL089W SIP4 Possibly involved in Snf1p
          regulated transcriptional activation shows homology to
          DNA binding domain of Gal4p has a leucine zipper motif
          and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          + +NK++R  +AC  CR +K KCD   P C  CT   + C+  D
Sbjct: 26 IAKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSD 69

>NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59
          Length = 776

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 95/232 (40%), Gaps = 38/232 (16%)

Query: 151 ISKDDCNRFTDVYFEVVHPMFDIIDPSQF-------------RQSLDSYWGGARNVSAFD 197
           I +   +RF   YF+  H +F +ID   F              +++D+  G   N+  F 
Sbjct: 322 IGRSLLDRFIAAYFKHNHRLFPMIDKIAFLNDVSKISDFESLEKNIDT--GSEYNILIFK 379

Query: 198 AVIGGVVALGSFFSRNFG--HARELDIVQYAKDILEDPTFS---SQPSIEQISAWVLRSI 252
             +  ++A+G    R  G  +  E D+ ++    L    FS      +IE +   +L  I
Sbjct: 380 IYM--IMAIGCTTLRRAGMLNVEEEDLSEHL-SYLAMKKFSYVIQLQNIETVRCLLLLGI 436

Query: 253 YLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFW 312
           Y     R   +W  S + M L  A  L+  +   ++   +   +  R         R+FW
Sbjct: 437 YSFFEPRGSSSWTISGLIMRLTIALGLNKALTPKKMKLLSAIEMEAR--------NRVFW 488

Query: 313 CAWCINTIISYEYGR-SCVTLNKISCKL---LKESTKN---YTAEMVELARM 357
            A+C   ++S   GR S +  ++I+  L   L +  K+    T  M+EL ++
Sbjct: 489 SAYCFERLVSTSLGRFSAIDDDEITIGLPRPLYDGEKDEIEVTRTMIELRKI 540

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
           KR R+   C  CR+ K KCD   P C  C  +G  C YD          K+P+P+  +  
Sbjct: 58  KRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVYD--------VSKQPAPRIPSKD 109

Query: 71  STIQKKE 77
           + I + E
Sbjct: 110 AIISRLE 116

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG--YNCQY------DDVDGP----LSFYE 59
          KR R+   C  C++RK KCD   PCG C   G   +C Y          GP    +   E
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRIKPCGTCVRLGDMDSCVYLSDRLGQRETGPTLTGIDHLE 70

Query: 60 KRPSPKQSTSPSTIQKKEVERP 81
          K+    + T P  I+K+   +P
Sbjct: 71 KQIRRAEETGPGFIRKRRFAQP 92

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG 53
          R +V +AC  CR+RK KC   +PC  C +Y   C +   D 
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIFTSSDS 73

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          P+ ++ R   ACL CR+R  KC  G PC  C +    C+Y
Sbjct: 23 PQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEY 62

>TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {ON}
           Anc_4.121
          Length = 672

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 113/311 (36%), Gaps = 36/311 (11%)

Query: 7   DVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG------YNCQYDDVDGPLSFYEK 60
           D P+ KR R  K CL C + K KCD   PC  C ++       Y    D++   LS  E+
Sbjct: 2   DKPKIKRRREIKTCLRCYKHKLKCDKSIPCSNCKNFDTQELCVYGFTKDEITKILSKGER 61

Query: 61  RPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAF-PRYLG-LEL 118
                ++       K   +  S  +P  +      P K  Y S +S + +  +Y      
Sbjct: 62  AKQLSKNILTRIPDKNTKDISSTPTPPPTTETSSAPPKKLYKSSNSTLVYRSKYFHPFFT 121

Query: 119 QSVNPPHLHSFAWNCGIRPEE-----------NSTSHPDLANII-----SKDDCNRFTDV 162
            ++N   L S  ++  I  +E            ST+       I     S        D 
Sbjct: 122 STINDRLLTSDDYDEFILSKEFHGNPIRKFDRFSTTPLQFQETIQLLPNSIKTAQSIIDT 181

Query: 163 YFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHAREL-- 220
           YF+ +HP+   +D    + SL   +    N     ++    +    FF+ +F        
Sbjct: 182 YFDSIHPVLPFLDKKSIQASLQETYNSISNDEPV-SITTLTLLYAIFFTSSFATVASGVI 240

Query: 221 -DIVQYAK------DILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHL 273
            DI+   K       +L    F   P+IE + A+++ +  +       VA+  S M + +
Sbjct: 241 PDILICNKYYSAYSMLLPLAKFPFVPNIETLQAFIIVNFIIDPNMVEFVAY--SAMLVRI 298

Query: 274 VEATALHHEVD 284
            +   LH   D
Sbjct: 299 GQQLGLHKISD 309

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
          to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
          weakly similar to YAL051W uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 975

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          KR R+   C  CR+ K KCD   P CG C  Y   C YD
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVYD 65

>ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOR337W (TEA1)
          Length = 701

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 17 RKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          R AC  CR+R++KCD  +PC  C      C  +D D
Sbjct: 44 RLACTNCRRRRKKCDLNYPCSSCLRLKLECNVNDED 79

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG--YNCQY------DDVDGPLSFYEK 60
          P  KR R+   C  CR+RK KCD   PCG C   G    C Y      D     L   +K
Sbjct: 11 PVRKRNRLTVVCSNCRRRKSKCDRQTPCGNCVRLGDKDTCVYIKEAKGDRNSMDLRITKK 70

Query: 61 RPSPKQSTSPSTIQK 75
           P+ K+  S +  +K
Sbjct: 71 LPTSKRKNSVTNTKK 85

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 48/119 (40%), Gaps = 15/119 (12%)

Query: 3   ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKR 61
           ++GAD    KR   R  C  C++R+ KCD G P C  C      C           Y  R
Sbjct: 132 SSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC----------VYVIR 181

Query: 62  PSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLELQS 120
              ++    ST   K+  +P       SE+GI   + +    +  A+A P  L   LQ+
Sbjct: 182 TKNRKRRPKSTDNSKDTSKPGQRVQ-KSEKGILPRTNT---VVEKAIASPVSLQATLQN 236

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQST 68
           + KR R+   C  CR+ K KCD   P C  C   G  C YD          K+  PK+  
Sbjct: 43  KKKRYRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITCIYD--------VAKQEPPKRPN 94

Query: 69  SPSTIQK--KEVE 79
             +T+++  KE+E
Sbjct: 95  KSATLKRLQKELE 107

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD 50
          + R K+ R  +AC  CR +K KCD   PC  C   GYNC   D
Sbjct: 18 LTRTKK-RHSQACDRCRSKKIKCDGLQPCSNCAKIGYNCVTSD 59

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 80/217 (36%), Gaps = 48/217 (22%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGF--PCGMCTSYGYNCQYDDVD--------------- 52
           R ++ R  +AC  C  RK +CD+    PC  C ++G  C+  DV                
Sbjct: 9   RVRKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVKKVKRGRKSASAAGGA 68

Query: 53  --------------GPLSFYEKRPSPKQSTSPSTIQKKEVERPSMLSPCSSERGI-FDPS 97
                          PL   + + + ++ T   T+          L     E G+ FD  
Sbjct: 69  DGGHRPEDEGETAANPLGGGDTQENEEEQTVKETVSNGMPFGDEYLRGRGVEPGVFFDAE 128

Query: 98  KSRYMSLHSAVAFPRYLGLELQSVNPPHLHSFAWNCGIR---PEENSTSHPDLAN----- 149
           +     ++       +L + L   + P   +FA    +R   P     S P +AN     
Sbjct: 129 REDRDRVYVYFGSSSFLSM-LTGSSFPDGSNFASAQKLRSALPLSGEGS-PRVANLEMLR 186

Query: 150 ------IISKDDCNRFTDVYFEVVHPMFDIIDPSQFR 180
                 + SK  C+   D++F  +HP+  II+ ++FR
Sbjct: 187 ITGAFLLPSKLVCDELVDLFFRYIHPLMPIINQTEFR 223

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 13  RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPST 72
           R +V+ AC  C++RK +CD   PC  C +    C+Y     PL   +KR   K S   S 
Sbjct: 29  RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMKPLK--KKR---KVSFIRSN 83

Query: 73  IQKKEVERPSMLSPCSSERGI 93
           + K E++  S +    + +G+
Sbjct: 84  LSKNELKGGSSVISSQNAQGV 104

>Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON}
          YBR240C (REAL)
          Length = 452

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          +A  +  P  K  R    C  CR +KR+CD   P C +C  +G NC YD
Sbjct: 13 IALSSKAPPTKG-RTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYD 60

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, 566
           aa] {ON} highly similar to uniprot|Q04176 Saccharomyces
           cerevisiae YDR397C NCB2 Beta subunit of the NC2 dimeric
           histone-fold complex represses RNA polymerase II
           transcription through binding to TBP and inhibition of
           TFIIA and TFIIB homologous to the Dr1 subunit of the
           mammalian NC2 (negative cofactor2)[INTRON]
          Length = 566

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 11/105 (10%)

Query: 19  ACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD--------GPLSFYEKRPSPKQSTS- 69
           AC  CR+R+RKC+   PC  C  YG  C   + D          L   E + S  ++   
Sbjct: 17  ACQSCRKRRRKCNLESPCSNCQKYGVECVPINQDLRRRRHSAAYLRSLENKISQLEALVA 76

Query: 70  --PSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPR 112
              S   +K+   P+  +P +   G   P+ S  +S H ++  P 
Sbjct: 77  DLKSKKNQKKTSTPNAPAPGAQIGGSIYPTNSLTLSYHRSIKAPE 121

>Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON}
          [contig 161] FULL
          Length = 755

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNC 46
          R KR R R  C  CR R++KCD   P CG C+ +   C
Sbjct: 22 RPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 6   ADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
            D  R KR   R  C  C++R+ KCD G P C  C+     C+Y
Sbjct: 183 GDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNRECKY 226

>SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} similar
          to uniprot|Q06639 Saccharomyces cerevisiae YDR303C RSC3
          One of 15 subunits of the 'Remodel the Structure of
          Chromatin' (RSC) complex; essential gene required for
          regulation of ribosomal protein genes and the cell
          wall/stress response; highly similar to Rsc30p
          Length = 777

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQYDDVDG 53
          R ++++   AC+ CR+RK  CD   P CG C   G N C Y DV G
Sbjct: 6  RGRKMKKPPACVQCRKRKIGCDRAKPICGNCLRNGKNDCFYPDVPG 51

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 19 ACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          ACL C++RK+KCD   PC  CT     C Y
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIY 31

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
          to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer- mediated
          Activation Ty1 enhancer activator and to YLR098C
          uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
          Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain DNA-binding transcriptional
          activator or CHA1
          Length = 701

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD 52
          R R AC  CR+R++KCD  +PC  C      C  ++ D
Sbjct: 50 RKRLACSNCRRRRKKCDLNYPCSSCVRLRLQCNVNEED 87

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 26/193 (13%)

Query: 142 TSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNV-----SAF 196
           +S  DL+ + SK   + + + YF   H  F I+D S FR         A+ +      A+
Sbjct: 193 SSSEDLSILSSKQIMDEYVEAYFGQFHAAFPIVDESYFRLCY------AKKIIPTSEKAW 246

Query: 197 DAVIGGVVALGSFFSRNFGHARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYL 254
             ++  V+ALGS+     G    +DI  Y  AK  L    F +       S  +L + Y 
Sbjct: 247 QTLLYAVLALGSW--SVVGEDSNIDIEYYKSAKYHLCSSVFETGSHSLLASLVLLSN-YT 303

Query: 255 RATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCA 314
           +   +P+ +W    +   +  +  LH E+     + R D       NS  E  RR++W  
Sbjct: 304 QKRNKPNTSWNYLGLAASMAISLGLHREMRD---SARTD-------NSGLEIRRRMWWVL 353

Query: 315 WCINTIISYEYGR 327
           +  +  ++  +GR
Sbjct: 354 YGYDCSMAMTFGR 366

>SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp,
          599 aa] {ON} similar to uniprot|P43634 Saccharomyces
          cerevisiae YLR098C CHA4 Zinc-finger protein with
          Zn[2]-Cys[6] fungal- type binuclear cluster domain
          DNA-binding transcriptional activator or CHA1 and some
          similarities to YOR337W uniprot|P47988 Saccharomyces
          cerevisiae YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 599

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNC 46
          +NK L    AC  CR+RKRKC   FPC  C   G  C
Sbjct: 12 KNKGL----ACQSCRKRKRKCSLDFPCSNCVRRGIEC 44

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQYDDVDGPLSFYEKRPSPKQS 67
           R KR  + K CL CR++K KCD   P C  C +  +  C Y D +G     +  PS    
Sbjct: 72  RKKRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVDANGNPLVQDFHPSSDNL 131

Query: 68  TSPS 71
           TS S
Sbjct: 132 TSTS 135

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           + LRV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 96  QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135

>Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON}
          YBR240C (REAL)
          Length = 448

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          +A  +  P  K  R    C  CR +KR+CD   P C +C  +G NC YD
Sbjct: 13 LAVSSKAPPTKG-RTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYD 60

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 4  TGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          + A++P  KR RV KAC  CR+ K KCD   PC  C      C Y
Sbjct: 7  SSAELPTIKR-RVSKACDACRKSKTKCDGERPCSRCLKENKLCTY 50

>AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YDR303C
          (RSC3) and YHR056C (RSC30)
          Length = 809

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGY-NCQYDDVDG 53
          G D+ R ++++   AC+ CR+RK  CD   P CG C   G  +C Y D+ G
Sbjct: 2  GVDI-RGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFYPDIPG 51

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG----PLSFYEKRPSPKQSTSP 70
          +V +AC  CR+RK KC    PC  C +Y  +C+Y    G    P +   K+  P  +++P
Sbjct: 23 KVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGNGIIPATTPPKKSLPAHNSNP 82

Query: 71 S 71
          +
Sbjct: 83 T 83

>KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.59
           YHR178W
          Length = 704

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 83/210 (39%), Gaps = 38/210 (18%)

Query: 151 ISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDS-------YWGGARNVSAFDAVIGGV 203
           I ++  +RF   +F+  H +F +ID   F   + +           A N   F   +  +
Sbjct: 257 IDRNLLDRFIAAFFKHNHRLFPVIDKLSFIDRVSTIRVFDYELLNSAFNDDVFIFQLYMI 316

Query: 204 VALGSFFSRNFGHARELDIVQYAKDILEDPTFSSQP---------SIEQISAWVLRSIYL 254
           +A+G    R  G      +++  +++ E   F S           +IE I   +L  IY 
Sbjct: 317 MAIGCTTLRRAGM-----LLKDEEELSEHLAFLSMKKFRTVMALQNIETIKCLLLLGIYS 371

Query: 255 RATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSV----CERARRL 310
               +   +W  S + M LV A  L            N AP+  +  ++     E   R+
Sbjct: 372 FFEPKGSSSWTISGIIMRLVIALGL------------NRAPVSKKLKTMPAIEVESRYRV 419

Query: 311 FWCAWCINTIISYEYGR-SCVTLNKISCKL 339
           FW A+C   +IS   GR S +  ++IS  L
Sbjct: 420 FWSAYCFERLISTCLGRMSAIDDDEISVPL 449

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 17 RKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
          + +C  CR+ K+KC    P CG C   G  C Y
Sbjct: 12 KYSCSRCRKLKKKCPREVPVCGHCVRVGAECSY 44

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          P +KR     AC+ CR+R  KC  G PC  C  +   C+Y
Sbjct: 18 PSSKRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEY 57

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
           +  R R+  AC+ CR+R  KC  G PC  C +    C+Y
Sbjct: 66  KANRSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEY 104

>Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa]
          {ON} YOR363C (REAL)
          Length = 995

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 9/65 (13%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          KR R+   C  CR+ K KCD   P CG CT     C YD          ++P+P+     
Sbjct: 17 KRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYD--------VARQPAPRNPNKD 68

Query: 71 STIQK 75
          +TI +
Sbjct: 69 ATIAR 73

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
          (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 11/81 (13%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEK 60
          V T       +R R+   C  CR+ K KCD   P C  C  +G  C YD         ++
Sbjct: 11 VKTTQSAHSGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVYD--------VDR 62

Query: 61 RPSPKQSTSPSTIQ--KKEVE 79
          +  PK     +TI   K+EVE
Sbjct: 63 QTPPKTPNKDATIARLKREVE 83

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 6  ADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQY 48
          A++   KR +  K CL CR+RK KCD   P CG C S G   C Y
Sbjct: 22 AELGSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTECVY 66

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 4/41 (9%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          RNK  R   +CL C++RK+KCD   P C  C   GY C Y+
Sbjct: 5  RNKPTR---SCLMCQRRKKKCDRKAPSCSACLKKGYECIYN 42

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 17/76 (22%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY------------DDVDGPLSFY 58
          K+ R  K CL CR+RK KCD   P C  C      C Y            D +D P S  
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQQHPSCMRCIKSSTLCTYTYSTPVSDDSLPDSLDTPKSMS 66

Query: 59 EKRPSPKQSTSPSTIQ 74
          +    PK+S  P+T Q
Sbjct: 67 Q----PKKSVMPTTDQ 78

>KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON}
          Anc_6.154 YBR240C
          Length = 459

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          ++  D+ +  R R    C  CR +KR+C+   P C +C  +G +C YD
Sbjct: 9  SSTTDMKKASRARTFTGCWACRLKKRRCNLEKPICSLCVRHGDHCSYD 56

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 5/52 (9%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSP 64
          R RV KAC  CR +K KC+   PC  C  +   C Y  V        +RP P
Sbjct: 20 RKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAYTHV-----IKRRRPVP 66

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMC 39
          +PR K +   KAC+ C+QRK+KC    PC  C
Sbjct: 1  MPRKKMM---KACIKCKQRKKKCSGQLPCDYC 29

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMC 39
          +PR K +   KAC+ C+QRK+KC    PC  C
Sbjct: 1  MPRKKMM---KACIKCKQRKKKCSGQLPCDYC 29

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          M    A  PR+K   V KAC  CR+RK KC    PC  C +Y   C +
Sbjct: 1  MAVKHATRPRSK---VSKACDNCRRRKIKCSGERPCAGCKTYNCECIF 45

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          K+ R + ACL CR+R  KC +G PC  C      C+Y
Sbjct: 26 KQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEY 62

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 15  RVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDG----PLSFYEKRPSPKQSTS 69
           + +  C  C++R+ KCD G P C  C +    C Y  V       +S  E  P+P   TS
Sbjct: 101 KSKNGCANCKRRRVKCDEGKPTCQKCLNMKLQCVYLPVTARNKPKISQVETLPNPSIMTS 160

Query: 70  PSTIQKKE---VERPSMLSPCSSERGIFDPSKS 99
            STI   E    E    +   SS+  IF P+K+
Sbjct: 161 NSTINSNEKIKSESDIKVKDNSSQNTIF-PNKT 192

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1486

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN--CQY 48
          P+ KR R+  +C  CR+RK KCD   P C  CT  G +  C Y
Sbjct: 8  PKRKRNRIPLSCTICRKRKVKCDKTHPYCVQCTKTGMSHLCHY 50

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQYDD 50
          KR RV K+C  CR RK KCD   P C  C  +G   C+YDD
Sbjct: 18 KRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDD 58

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 3   ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
           +T AD    KR   R  CL C++R+ KCD G P C  C      C Y
Sbjct: 138 STDADGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKCVY 184

>Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098C
          (REAL)
          Length = 644

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49
          N+   V  AC  CR+RKRKCD   PC  C+    +C YD
Sbjct: 3  NRSPYVTLACNTCRKRKRKCDGRKPCYYCSRGKTHCVYD 41

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 9   PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN--CQY 48
           P+ KR R+  +C  CR+RK KCD   P C  CT  G +  C Y
Sbjct: 107 PKRKRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHY 149

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          G +  R KR  +  ACL CR+R  +C  G PC  C S    C+Y
Sbjct: 44 GGNKERKKRAPL--ACLRCRKRHVRCPGGNPCSKCVSANIACEY 85

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51
          M    +D+ + +R +    C  CR RK KCD G P C  C   G+ C   D+
Sbjct: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYG--YNCQY 48
          P+ KR R+  +C  CR+RK KCD   P C  CT  G  + C Y
Sbjct: 12 PKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHY 54

>SAKL0B10648g Chr2 complement(917905..920103) [2199 bp, 732 aa] {ON}
           conserved hypothetical protein
          Length = 732

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 11/125 (8%)

Query: 229 ILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVEL 288
           I  D TF  +P +E   A +L SI        + AW+     + +++A     E D+   
Sbjct: 126 IFNDYTFLLRPDLEVAQALLLLSIVKWGHNEYYAAWMLHGSAVRMIQAL----EFDEHFQ 181

Query: 289 ATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYT 348
           +    +P       + E   R FWCA+C++ IIS    R C  +++     L +S +++ 
Sbjct: 182 SRAKYSPF------LQELKVRTFWCAFCLDRIISTGENR-CFIVSEYENMTLPKSDRDFI 234

Query: 349 AEMVE 353
              +E
Sbjct: 235 KSAME 239

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 78/188 (41%), Gaps = 23/188 (12%)

Query: 146 DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDA---VIGG 202
           D  ++ S+   +RF   Y +  HP   I+      Q+L   +     +++ D    +   
Sbjct: 229 DRYSLASRSTTSRFIQSYLDNFHPYCPIV----HSQTLMMLYNNQIEIASKDQWQILFNS 284

Query: 203 VVALGSFFSRNFGHARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARP 260
           V+++G++     G + ++D+  Y  AK  L    F +  SI  + A  L S Y +   RP
Sbjct: 285 VLSIGAWCVE--GESTDIDLFYYQNAKSHLTSKVFEAG-SITLVIALHLLSRYTQWRQRP 341

Query: 261 HVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTI 320
           + ++     +M +            + L    D P      S+ E+ RR++W  +     
Sbjct: 342 NTSYSYHGFSMRMA-----------ISLGLNKDLPSSFNDTSILEQRRRIWWSLYNWEFH 390

Query: 321 ISYEYGRS 328
           ++  YGRS
Sbjct: 391 LTLLYGRS 398

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNC 46
          ++T  D  R ++  +  AC  CR ++RKCD   PC  C  YG  C
Sbjct: 1  MSTITDGKRKRKAHL--ACQNCRIKRRKCDMERPCSNCLKYGIEC 43

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 7   DVPRNKRLRVRKACLPCRQRKRKCDSGFP----CGMCTSYGYNCQYD 49
           DV    + RV KAC  CR+RK KCD   P    C  CT +   C +D
Sbjct: 126 DVSGAPKKRVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAECTFD 172

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 19/91 (20%)

Query: 10  RNKRLR-----VRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSP 64
           ++KR+R     V KAC  CR+RK KC    PC  C +Y   C Y          +KR + 
Sbjct: 33  KDKRVRKPTNKVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYST--------QKRKTS 84

Query: 65  KQSTSPSTIQKK------EVERPSMLSPCSS 89
           K++ +    Q +       VE  S  + CSS
Sbjct: 85  KRNNTAKMEQPEIPNGPNSVETNSSYTSCSS 115

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGY-NCQYDDVDGPLS 56
          P+ +R ++ K+C+ CR+RK KCD   P CG C      +C Y D + P++
Sbjct: 13 PKKRRKQI-KSCMFCRKRKLKCDKAKPMCGQCKERKLPDCLYTDFNFPVN 61

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
           {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
           YKL015W PUT3 Positive regulator of PUT (proline
           utilization) genes zinc-finger transcription factor of
           the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTS 69
           R ++ R   AC+ CR+R  KC  G PC  C +    C+Y + +  L    K     QS  
Sbjct: 38  RKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIEPNKKLIVSMKYLQKLQS-D 96

Query: 70  PSTIQKKEVERPSMLSPCSS 89
            + ++K+ ++  +++S  +S
Sbjct: 97  LAEMKKENIKLQNLVSTINS 116

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 2  VATGADVP-RNKRLR-----VRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG 53
           +T   VP + K++R     V KAC  CR+RK KC    PC  C +Y   C Y    G
Sbjct: 39 TSTSLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQRG 96

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          R RV KAC  CR +K KC+    C  C  YG  C Y
Sbjct: 9  RRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTY 44

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG 43
          K  RV KAC  C+ RK++C    PC  CT  G
Sbjct: 2  KEKRVSKACDVCKHRKKRCTGELPCDYCTRIG 33

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 2   VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           ++  A V  +   RV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 56  ISPTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 17 RKACLPCRQRKRKCDSGFPCGMCTSYGYNC 46
          R AC  CRQ+++KCD   PC  CT     C
Sbjct: 5  RLACQNCRQKRKKCDLELPCSRCTRLKVEC 34

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 78/197 (39%), Gaps = 29/197 (14%)

Query: 154 DDCNRFTDVYFEVVHPMFDIIDPSQF----RQS-----LDSYWGGARNVSAFDAVIGGVV 204
           D+ ++ TD+   VV   F  + P+QF    R++     L     G   +S  + ++  V 
Sbjct: 83  DELHKDTDIRQSVV-LFFKWLYPNQFVFIFREAFLVAFLREQQEGHEYIS--EELVYAVA 139

Query: 205 ALGSFFSRNFG--HARELDIVQYAKDIL-------EDPTFSSQPSIEQISAWVLRSIYLR 255
           ALG+  ++     +AR  +  Q AKD         ED   SS P +  I   +  + Y  
Sbjct: 140 ALGASLNKRSDPLYARAQEYYQLAKDKTLAKVFQQEDNDKSSLPKLVLIQTLLCLAFYEI 199

Query: 256 ATARPHVAWLASCMTMHLVEATALH-----HEVDKVELATRNDAPLPPRANSVCERARRL 310
                 +AW  S +   +V    LH       ++K E   R    L      V     R+
Sbjct: 200 RVGNNELAWYFSGLAFRIVHEIGLHLHSSSWSINKEEHEQRTSENLSQYDTEV---RSRI 256

Query: 311 FWCAWCINTIISYEYGR 327
           +W  +  + +IS  +GR
Sbjct: 257 YWGCYLADHLISQLFGR 273

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          P +   RV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 12/86 (13%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSP 70
          NK+   ++AC  CR R+ KCD   PC  C  +  +C Y      L  + KR  PK   S 
Sbjct: 4  NKQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTY------LQPFRKR-GPKSIRSR 56

Query: 71 STIQKKEVE-----RPSMLSPCSSER 91
          S  +  EV+     +  M  P +S++
Sbjct: 57 SLRRIAEVQMTCENKSVMAGPVTSKK 82

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 15  RVRKACLPCRQRKRKCDSGFP----CGMCTSYGYNCQY---DDVD 52
           RV +AC  CR+RK KCD   P    C  CT Y  NC +   DDV+
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVE 157

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          + RV KAC  CR+ K KCD   PC  C S    C Y
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTY 39

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 14  LRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSPKQSTSPST 72
           LR+ +AC  CR +K +CD   P C  C   G+ C+  D     SF    P     T    
Sbjct: 75  LRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSF----PRGYTETLEEK 130

Query: 73  IQKKEVERPSMLSPC 87
           +++ E E   +L+ C
Sbjct: 131 VRELENENRRLLAIC 145

>Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}
          similar to Ashbya gossypii AAL057C
          Length = 825

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQYDDVDG 53
          R ++++   AC+ CR+RK  CD   P CG C   G N C Y D+ G
Sbjct: 6  RGRKMKKPPACVQCRKRKIGCDRVKPICGNCLRNGKNDCFYPDIPG 51

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 10  RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQYDD 50
           R +R +V K+C  CRQRK KCD   P CG C     + C Y D
Sbjct: 58  RRRRRKVIKSCTFCRQRKMKCDQQKPMCGSCVERKLSECIYTD 100

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
           {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 12  KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYN---CQYDDV---DGPLSFYEKRPSPK 65
           KR +  +AC  CR+RK KCD     G+CTS   N   C +D V    GP   Y +  S  
Sbjct: 41  KRTKASRACDQCRKRKIKCDFSEEKGICTSCSKNADRCAFDRVPLKRGPSKGYVRGHSRT 100

Query: 66  QSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYM 102
           +S    T Q+   + P   SP S    +  P  ++Y+
Sbjct: 101 RSV---TSQQDGTDVP---SPPSRSNSVLLPPLAQYL 131

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 19/39 (48%)

Query: 13 RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDV 51
          R RV KAC  CR +K KCD   PC  C      C Y  V
Sbjct: 7  RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGYTYV 45

>YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}
          RDS1Putative zinc cluster transcription factor;
          involved in conferring resistance to cycloheximide
          Length = 832

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          K+ R+R  CL C++ KRKCD   P C  C      C+Y++
Sbjct: 7  KKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYEE 46

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG 43
          KR R    C  CR+RK +CD   PC  CT +G
Sbjct: 14 KRKRPTVVCTNCRRRKSRCDRERPCNTCTRFG 45

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
          YGR288W (REAL)
          Length = 473

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          N++  V++AC  CR R+ KCDS  PC  C     +C Y
Sbjct: 4  NRQTCVKQACDCCRVRRVKCDSKRPCSSCLQNNLSCTY 41

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP----CGMCTSYGYNCQY 48
           MV     +   K+ RV KAC  CR+RK KCD   P    C  C  Y  NC +
Sbjct: 88  MVHKPTKITSGKK-RVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTF 138

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 1   MVATGADVPRNKRL-RVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           M+ T +  P +  + R+ +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 50  MIKTASPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 101

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51
          V + KR +    C  CR RK KCD   P CG C   G +C   D+
Sbjct: 16 VQKGKRAKTFTGCWTCRSRKVKCDLQRPNCGRCEKSGLDCGGYDI 60

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 11/77 (14%)

Query: 6  ADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDVDGPLSFYEKRPSP 64
          + V + KR R+   C  CR+ K KCD   P C  C+ +   C YD          K+ +P
Sbjct: 26 SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLECVYD--------VTKQHAP 77

Query: 65 KQSTSPSTIQ--KKEVE 79
          +     +T+   ++EVE
Sbjct: 78 RNPNKAATMARLRREVE 94

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
          YBR240C (REAL)
          Length = 450

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 3  ATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
           T +  P   + R    C  CR +KR+CD   P C +C  +G  C YD
Sbjct: 12 VTLSSKPSPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYD 59

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 12/72 (16%)

Query: 15 RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEKRPS---PKQSTSPS 71
          +V +AC  CR+RK KC    PC  C  Y   C+Y           KRP+   P  + +  
Sbjct: 21 KVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEYK---------AKRPAAKLPFYNNNDK 71

Query: 72 TIQKKEVERPSM 83
           IQK +  R S+
Sbjct: 72 VIQKIDALRASV 83

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 875

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          P   + ++   C+PCR+ K KCD   P C  C   G  C YD
Sbjct: 13 PNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYCGYD 54

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa]
          {ON} Anc_1.199 YKR064W
          Length = 862

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYN--CQYDDVDGPLSFYEKRPSPKQSTS 69
          +R R    C  CR+RK +CD   PC  C   G +  C+Y++   P        S + S +
Sbjct: 10 RRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNP-----NTSSIRVSFA 64

Query: 70 PST--IQKKEVERPSMLSPCSSE 90
          P    ++K++   PS L   SS+
Sbjct: 65 PKIERVKKQDKFIPSTLFGSSSK 87

>Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar to
          Ashbya gossypii AFL033W
          Length = 508

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 8  VPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          +P++K  R    C  CR +KR+CD   P C +CT +G +C YD
Sbjct: 31 LPKSK-ARSFTGCWACRFKKRRCDERRPFCSLCTKHGDSCSYD 72

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 862

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 11 NKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
          +K  R+ +AC  CR +K KCD   P C  CT  G++CQ  D
Sbjct: 20 SKHARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSD 60

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 10 RNKR--LRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
          RNKR   R   ACL CR+R  +C  G PC  C      C+Y
Sbjct: 49 RNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEY 89

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 7   DVPRNKRLRVRKACLPCRQRKRKCD-----SGFPCGMCTSYGYNCQYDD 50
           D PR+ + RV +AC  CR+RK KCD     +   C  C  Y   C + +
Sbjct: 240 DNPRSAKKRVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSECTFKN 288

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 2  VATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDV 51
          + T   V R +RL   +AC  C++RK KC  G PC  C      C Y ++
Sbjct: 20 MTTNQLVARTQRLS--RACDLCKKRKTKCQGGNPCQSCRKANIQCIYREI 67

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49
          RN+RL V   C  CR RK KCD   P C  C  +G  C Y+
Sbjct: 8  RNRRLHV---CDACRIRKLKCDKAKPNCSRCAKHGLECIYN 45

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTS 41
          MV + A V R KR +V K+CL CR+RK KCD   P C  C +
Sbjct: 1  MVDSQASVIR-KRRKVIKSCLFCRKRKLKCDHKKPKCSTCAA 41

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 125/323 (38%), Gaps = 82/323 (25%)

Query: 142 TSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDA--- 198
           T+  D  ++ S+   +RF   Y    HP   I+      Q+L   +     +++ D    
Sbjct: 226 TAITDRYSLGSRSTTSRFIQSYLNNFHPYCPIVH----SQTLMMLYNNQVEIASKDQWQI 281

Query: 199 VIGGVVALGSFFSRNFGHARELDIVQY--AKDILEDPTFSSQPSIEQISAWVLRSIYLRA 256
           +   ++++G++     G + ++D+  Y  AK  L    F S  SI  + A  L S Y + 
Sbjct: 282 LFNSILSIGAWCIE--GESTDIDLFYYQNAKSHLTGKVFES-GSITLVIALHLLSRYTQW 338

Query: 257 TARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWC 316
             + + ++     ++ +            + L    D P   + +SV E+ RR++W  + 
Sbjct: 339 RQKTNTSYNFHSFSLRMA-----------LSLGLNRDLPSSFKDSSVLEQRRRIWWSVYT 387

Query: 317 INTIISYEYGRSCVTL-NKIS----------------------------------CKLLK 341
               ++  YGRS   + N IS                                  C+L K
Sbjct: 388 WEFHLALLYGRSIQFIKNTISFPSSVDDMQRTTSNPTIYHGTIETARLLQVFARICELDK 447

Query: 342 ESTKNYT-----------AEMVELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPF 390
            ST   +            E+ E++R +P   Q   P++ +A L++           HP+
Sbjct: 448 TSTTENSPMSAKKCLAICNEIEEVSRQMPQFLQMDIPSTTLANLLKQ----------HPW 497

Query: 391 LSLTKADLCHSFYRRLRLLNHVL 413
           LS T+  L    +R+L L+ +VL
Sbjct: 498 LSFTRFKLK---WRQLSLIIYVL 517

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 6   ADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQY 48
           A V   KR   R  C  C++R+ KCD G P C  C+    +C Y
Sbjct: 136 ASVKSGKRKYSRNGCTECKRRRMKCDEGKPVCWQCSRLNRSCVY 179

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 15  RVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           RV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160

>Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON}
          (12882..15233) [2352 nt, 784 aa]
          Length = 783

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 19 ACLPCRQRKRKCDSGFP-CGMCTSYGY-NCQYDDVDGPLSFYEKRPSPKQSTSPSTIQ 74
          +CL CR+RK +C    P C  C + G+  C+Y   D P S  +   SP  + SPS++Q
Sbjct: 24 SCLFCRKRKLRCGQEKPMCSTCQTRGFATCEYLVADSPDS-SKAGTSPGSNKSPSSVQ 80

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
           YKL015W
          Length = 1041

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 15  RVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDD----VDGPLSFYEKRPSPKQSTSP 70
           R   AC+ CR+R  KC +G PC  C      C+Y +    +   LS+ +         S 
Sbjct: 35  RKSNACIQCRRRHVKCPNGNPCLRCVKSKLQCEYSEPSRKIVVSLSYLQNLQD-----SI 89

Query: 71  STIQKKEVERPSMLSPC 87
            T++K  ++  S LS C
Sbjct: 90  ITLKKNNLKLQSQLSTC 106

>Suva_13.348 Chr13 complement(577455..579281) [1827 bp, 608 aa]
          {ON} YMR168C (REAL)
          Length = 608

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 10 RNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG 43
          R  +L+ +  CL C +RK KCD   PCG C   G
Sbjct: 4  RTTQLKSKHPCLVCTRRKVKCDRMVPCGNCRKRG 37

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 1   MVATGADVPRNKRL-RVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50
           M+ T +  P +  + R+ +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 50  MIKTTSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 101

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 6  ADVPRNKRLRVRK---ACLPCRQRKRKCDSGFPCGMCTSYGYNCQY 48
           ++  +K+ +V++   AC  CR+R  KC  G PC  C   G  C+Y
Sbjct: 29 VELLNDKKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEY 74

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYN-CQY--------DDVDGPLS 56
          PR KR    K+C  CR+RK KCD   P C  C +  +  C Y        +D+D P+S
Sbjct: 24 PRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAINNPENDLDRPMS 81

>Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar to
          Ashbya gossypii ACR107W
          Length = 412

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 5  GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTS--YGYNCQYDDVDGPLS 56
          G  VP  +R +V KAC+ CR+    CD   PC  C     G+ CQ + V   +S
Sbjct: 8  GEYVPAKRRRKVSKACVFCRRSHMICDDQRPCSRCIKRDIGHLCQSEKVHAIIS 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,996,644
Number of extensions: 2357893
Number of successful extensions: 8131
Number of sequences better than 10.0: 711
Number of HSP's gapped: 8287
Number of HSP's successfully gapped: 732
Length of query: 552
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 437
Effective length of database: 40,294,809
Effective search space: 17608831533
Effective search space used: 17608831533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)