Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_23.28495.251ON40940919410.0
KLTH0G07524g5.251ON44540718950.0
SAKL0G11484g5.251ON45641718430.0
KAFR0H036305.251ON44840718350.0
Ecym_82505.251ON45641518180.0
ACR050C5.251ON47541318170.0
Kpol_1032.875.251ON46442218120.0
TPHA0B025505.251ON46342318100.0
TBLA0C030405.251ON46840218000.0
CAGL0E06490g5.251ON47243117920.0
TDEL0E037505.251ON47143517880.0
Skud_11.825.251ON46842817860.0
NCAS0F023005.251ON47443217850.0
ZYRO0A10560g5.251ON46842717840.0
KLLA0E13773g5.251ON47543617770.0
YKL145W (RPT1)5.251ON46742717700.0
Smik_11.915.251ON46842817640.0
Suva_11.805.251ON47143117460.0
KNAG0H023005.251ON47743517440.0
NDAI0C037805.251ON38538516880.0
Suva_7.2274.57ON4053118051e-104
Skud_7.2364.57ON4053118021e-103
Smik_7.2354.57ON4053118011e-103
YGL048C (RPT6)4.57ON4053118011e-103
KLLA0A04752g4.57ON4043117981e-102
CAGL0D06292g4.57ON4003137871e-101
Kwal_26.74744.57ON4053017861e-101
ZYRO0G22330g4.57ON4053117861e-101
Kpol_1041.424.57ON4033127851e-101
KLTH0D03806g4.57ON4053017851e-101
NCAS0A058804.57ON4073127841e-100
AGL043C4.57ON4053017821e-100
KNAG0D032004.57ON4003157811e-100
SAKL0H23672g4.57ON4083017811e-100
KAFR0F031004.57ON4053127801e-100
TBLA0B098804.57ON4013127791e-100
NDAI0D028504.57ON4053127781e-100
TPHA0F004404.57ON4033127771e-99
TDEL0E056604.57ON4063007744e-99
KLLA0C09592g8.708ON4343247173e-90
KLTH0D11990g8.708ON4333247149e-90
Skud_15.4258.708ON4373247122e-89
AAL113W8.708ON4323247113e-89
NCAS0A101803.216ON4373177104e-89
KNAG0G027208.708ON4443227106e-89
YOR259C (RPT4)8.708ON4373247096e-89
Kwal_26.89128.708ON4343247088e-89
SAKL0H05764g8.708ON4213247069e-89
Smik_15.4428.708ON4373247062e-88
Ecym_23658.708ON4273247042e-88
NCAS0B011508.708ON4263247042e-88
NDAI0A072903.216ON3763176993e-88
Suva_8.3088.708ON4373247035e-88
TDEL0A065308.708ON4353247035e-88
YDL007W (RPT2)3.216ON4373177027e-88
KAFR0A040108.708ON4243247008e-88
KAFR0F024403.216ON4363177011e-87
Suva_4.2463.216ON4373177011e-87
Smik_4.2293.216ON4373177011e-87
NDAI0E010208.708ON4433247011e-87
Kpol_1064.228.708ON4323226992e-87
TPHA0D014708.708ON4553267012e-87
Kwal_27.110323.216ON3763306942e-87
CAGL0K08910g8.708ON4363246982e-87
KNAG0K015303.216ON4353176982e-87
Kpol_1010.743.216ON4373176983e-87
SAKL0C11440g3.216ON4363306983e-87
TBLA0D012408.708ON4433226974e-87
TDEL0D040603.216ON4373306966e-87
CAGL0I04884g3.216ON4333176956e-87
ZYRO0A04224g3.216ON4373176958e-87
TPHA0A042703.216ON4373176931e-86
Skud_4.2473.216ON4373176931e-86
Ecym_52863.216ON4373176931e-86
TBLA0F006903.216ON4343156913e-86
AEL011W3.216ON4373176913e-86
KLLA0E21209g5.428ON4323086904e-86
NCAS0F033305.428ON4343856904e-86
TPHA0H017705.251ON4343086895e-86
SAKL0G02376g5.428ON4343906895e-86
Ecym_55275.428ON4323086895e-86
KLTH0G16698g3.216ON4553176881e-85
ZYRO0F11946g8.708ON4443246852e-85
KNAG0C049605.428ON4233726824e-85
KLTH0F16214g5.428ON4343086835e-85
CAGL0A02750g5.428ON4293086825e-85
YOR117W (RPT5)5.428ON4343086826e-85
Smik_15.2955.428ON4343086826e-85
Suva_8.1705.428ON4343086826e-85
KLLA0F14707g3.216ON4343176819e-85
Kwal_55.214535.428ON4343086801e-84
KAFR0E038905.428ON4343086791e-84
Skud_15.2805.428ON4343086791e-84
Kpol_1062.335.428ON4343086792e-84
AER254W5.428ON4603086803e-84
TDEL0E019705.428ON4343086774e-84
NDAI0B056205.428ON4823086805e-84
TBLA0A037405.428ON4343086756e-84
ZYRO0F09900g5.428ON4343086695e-83
Kpol_543.175.486ON4282786451e-79
NDAI0A042905.486ON4262936417e-79
ZYRO0D11528g5.486ON4532926437e-79
NCAS0A119805.486ON4262796401e-78
KLLA0C06534g5.486ON4282626401e-78
Ecym_45485.486ON4252626382e-78
Smik_4.6685.486ON4282936372e-78
YDR394W (RPT3)5.486ON4282796373e-78
TPHA0J028605.486ON4312636373e-78
CAGL0K09526g5.486ON4312636363e-78
Skud_4.6685.486ON4282796364e-78
TBLA0D018605.486ON4292796364e-78
AFR394W5.486ON4722596395e-78
KAFR0E035805.486ON4252796355e-78
KNAG0C045905.486ON4323096348e-78
Suva_2.5715.486ON4282796331e-77
SAKL0G03828g5.486ON4252626321e-77
TDEL0A035005.486ON4262796131e-74
KLTH0G02662g5.486ON4252626084e-74
TBLA0J006407.288ON8522315267e-59
TDEL0H015607.288ON8382315259e-59
NCAS0E035807.288ON6012315151e-58
TBLA0C048407.288ON8472315222e-58
SAKL0F09834g7.288ON8422315213e-58
KLLA0F05676g7.288ON8302315214e-58
KLTH0A05324g7.288ON8322315204e-58
KNAG0B029407.288ON8382315205e-58
NCAS0A137607.288ON8252315196e-58
NDAI0A030407.288ON8422315197e-58
NDAI0A022807.288ON8252315189e-58
Smik_4.1117.288ON8352315181e-57
Kpol_1020.97.288ON8122315161e-57
Kwal_23.59967.288ON8312315171e-57
KAFR0L011907.288ON8242315162e-57
Ecym_80377.288ON8362315162e-57
CAGL0J09350g7.288ON8302315162e-57
Suva_4.1197.288ON8362315162e-57
Skud_4.1297.288ON8352315152e-57
YDL126C (CDC48)7.288ON8352315152e-57
AFR158W7.288ON8322315152e-57
ZYRO0C09262g7.288ON8302315143e-57
Kpol_2000.157.288ON8232315125e-57
TPHA0A032607.288ON8262315127e-57
NCAS0E040505.34ON13292794946e-54
ZYRO0D07414g5.34ON14202694893e-53
KAFR0D019005.34ON12612694876e-53
TDEL0G005905.34ON12942674832e-52
Kwal_47.18848singletonOFF3021564532e-52
KLTH0B09130g5.34ON13332794832e-52
TPHA0L022105.34ON14002704822e-52
NDAI0B007805.34ON13482794813e-52
TBLA0C068505.34ON14262694813e-52
KNAG0K002805.34ON14082714814e-52
Kpol_513.195.34ON13772704805e-52
KLLA0A09823g5.34ON13192714805e-52
ZYRO0D15290g7.168ON7272644728e-52
Ecym_12587.168ON7472644739e-52
ABR139W5.34ON12702684771e-51
KLTH0F13904g7.168ON7392634711e-51
Ecym_47695.34ON13392694762e-51
KNAG0L010607.168ON7132614702e-51
SAKL0H01276g5.34ON13372364734e-51
AAR025C7.168ON7262644674e-51
Kwal_23.42535.34ON13292794725e-51
KNAG0B061604.259ON7722624667e-51
CAGL0G00528g5.34ON13172714708e-51
Smik_16.385.34ON13892344708e-51
Skud_13.2452.472ON8242574679e-51
Kpol_401.37.168ON7862644661e-50
Skud_7.6035.34ON13862344701e-50
TBLA0I011902.472ON8352654652e-50
TDEL0A024802.472ON8162574642e-50
Kwal_26.77492.472ON8142574642e-50
Kpol_483.204.259ON7832614615e-50
Klac_YGOB_Anc_7.168b7.168ON7792634605e-50
SAKL0F03894g7.168ON7422634596e-50
Ecym_74002.472ON8042564616e-50
Suva_13.2662.472ON8232574616e-50
KLTH0D05412g2.472ON8132574616e-50
NCAS0J015504.259ON7722424607e-50
YGR270W (YTA7)5.34ON13792344637e-50
NDAI0E035807.168ON7822644599e-50
Suva_7.5665.34ON13982364621e-49
KAFR0A058904.259ON7722824572e-49
KAFR0A007402.472ON7842574562e-49
YMR089C (YTA12)2.472ON8252574563e-49
Smik_13.2732.472ON8272574563e-49
CAGL0J01353g2.472ON8272554554e-49
CAGL0C02585g4.259ON7713124535e-49
NCAS0E020207.168ON7732644535e-49
NDAI0H022102.472ON8032574545e-49
NCAS0A078202.472ON7912574536e-49
Kpol_467.232.472ON8592574538e-49
YLR397C (AFG2)4.259ON7802674528e-49
TDEL0H027707.168ON7442644518e-49
SAKL0E03014g2.472ON8302574539e-49
SAKL0H02750g4.259ON7763044519e-49
TPHA0C015207.168ON7842644511e-48
Suva_5.1097.168ON7612594511e-48
TPHA0B007304.259ON7763114511e-48
TBLA0D044907.168ON7822944511e-48
KLLA0B03234g4.259ON8042454502e-48
KLLA0F13706g2.472ON8422574502e-48
ABL041W2.472ON8182564492e-48
KNAG0C033207.430ON7662544465e-48
CAGL0H09416g7.168ON7502644455e-48
NDAI0J023204.259ON7782424456e-48
TPHA0G031302.472ON7922664457e-48
KAFR0G028007.168ON7832644457e-48
Smik_5.1387.168ON7602594448e-48
NCAS0A146407.430ON7502544439e-48
Skud_5.1217.168ON7622594431e-47
KAFR0K020607.430ON7262544421e-47
YLL034C (RIX7)4.23ON8373294432e-47
KLLA0E06711g7.430ON7692544422e-47
Smik_12.4844.259ON7802664422e-47
Skud_12.4824.259ON7772714422e-47
ZYRO0F13024g7.430ON7402544412e-47
YER017C (AFG3)7.168ON7612594412e-47
ZYRO0G03212g2.472ON8302554413e-47
Suva_10.5144.259ON7802674403e-47
KNAG0E025502.472ON8452574414e-47
NCAS0A029404.23ON8573324414e-47
TDEL0E011104.259ON7782784395e-47
ZYRO0G08008g4.23ON8263134396e-47
Ecym_62184.23ON8382574388e-47
SAKL0H25630g4.23ON8302574389e-47
SAKL0F13376g7.430ON7412544369e-47
NDAI0A013907.430ON7122554359e-47
Skud_12.334.23ON8373104381e-46
Suva_16.3517.430ON7472544361e-46
CAGL0K05093g7.430ON7452544361e-46
Smik_12.224.23ON8372734371e-46
Ecym_71237.430ON7272554351e-46
TDEL0C029307.430ON7402544351e-46
Suva_10.384.23ON8372574361e-46
Smik_16.2657.430ON7472544342e-46
YPR024W (YME1)7.430ON7472544342e-46
Skud_16.3097.430ON7472544332e-46
AGL274W7.430ON7322544323e-46
KLLA0E00837g4.23ON8142574333e-46
Kwal_23.41944.259ON7742774324e-46
CAGL0D02838g4.23ON8343064334e-46
KLTH0D14586g4.259ON7742424315e-46
KLTH0C05742g7.430ON7442544305e-46
TDEL0G016804.23ON8063144325e-46
TBLA0F014707.430ON8022544308e-46
KNAG0E010404.23ON7852574291e-45
TBLA0E014504.23ON8613134291e-45
TBLA0A063804.259ON8082844282e-45
NDAI0D048904.23ON8703164282e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.2849
         (409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   752   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   734   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   714   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   711   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   704   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   704   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   702   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   701   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   697   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   694   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   693   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   692   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   692   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   691   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   689   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   686   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   684   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   677   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   676   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   654   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   314   e-104
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   313   e-103
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   313   e-103
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   313   e-103
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   311   e-102
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   307   e-101
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   307   e-101
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   307   e-101
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   306   e-101
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   306   e-101
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   306   e-100
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   305   e-100
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   305   e-100
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   305   e-100
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   305   e-100
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   304   e-100
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     304   e-100
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   303   1e-99
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   302   4e-99
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   280   3e-90
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   279   9e-90
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   278   2e-89
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   278   3e-89
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   278   4e-89
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   278   6e-89
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   277   6e-89
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   277   8e-89
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   276   9e-89
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   276   2e-88
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   275   2e-88
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    275   2e-88
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   273   3e-88
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   275   5e-88
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   275   5e-88
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   275   7e-88
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   274   8e-88
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   274   1e-87
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   274   1e-87
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   274   1e-87
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    274   1e-87
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   273   2e-87
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   274   2e-87
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   271   2e-87
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   273   2e-87
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   273   2e-87
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   273   3e-87
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   273   3e-87
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   273   4e-87
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   272   6e-87
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   272   6e-87
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   272   8e-87
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   271   1e-86
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   271   1e-86
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   271   1e-86
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   270   3e-86
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   270   3e-86
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   270   4e-86
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    270   4e-86
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   270   5e-86
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   270   5e-86
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   270   5e-86
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   269   1e-85
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   268   2e-85
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   267   4e-85
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   267   5e-85
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   267   5e-85
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   267   6e-85
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   267   6e-85
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   267   6e-85
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   266   9e-85
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   266   1e-84
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   266   1e-84
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   266   1e-84
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   266   2e-84
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   266   3e-84
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   265   4e-84
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   266   5e-84
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   264   6e-84
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   262   5e-83
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   253   1e-79
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   251   7e-79
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   252   7e-79
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   251   1e-78
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   251   1e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   250   2e-78
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   249   2e-78
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   249   3e-78
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   249   3e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   249   3e-78
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   249   4e-78
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   249   4e-78
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   250   5e-78
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   249   5e-78
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   248   8e-78
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   248   1e-77
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   248   1e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   240   1e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   238   4e-74
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   207   7e-59
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   206   9e-59
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    202   1e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   205   2e-58
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   205   3e-58
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   205   4e-58
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   204   4e-58
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   204   5e-58
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            204   6e-58
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   204   7e-58
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   204   9e-58
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   204   1e-57
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   203   1e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   203   1e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   203   2e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   203   2e-57
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   203   2e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   203   2e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   202   2e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   202   2e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   202   2e-57
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   202   3e-57
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   201   5e-57
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   201   7e-57
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    194   6e-54
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   192   3e-53
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   192   6e-53
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   190   2e-52
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   179   2e-52
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   190   2e-52
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   190   2e-52
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   189   3e-52
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   189   3e-52
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   189   4e-52
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   189   5e-52
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   189   5e-52
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   186   8e-52
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   186   9e-52
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   188   1e-51
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   186   1e-51
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   187   2e-51
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   185   2e-51
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   186   4e-51
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   184   4e-51
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   5e-51
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   184   7e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   185   8e-51
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   185   8e-51
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   184   9e-51
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   184   1e-50
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   185   1e-50
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   183   2e-50
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   183   2e-50
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   183   2e-50
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   182   5e-50
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   181   5e-50
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   181   6e-50
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   182   6e-50
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   182   6e-50
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   182   6e-50
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   181   7e-50
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   182   7e-50
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    181   9e-50
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   182   1e-49
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   180   2e-49
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   180   2e-49
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   180   3e-49
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   180   3e-49
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   179   4e-49
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   179   5e-49
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    179   5e-49
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   179   5e-49
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   179   6e-49
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   179   8e-49
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   178   8e-49
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   178   8e-49
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   179   9e-49
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   178   9e-49
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   178   1e-48
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   178   1e-48
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   178   1e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   178   1e-48
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   177   2e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   177   2e-48
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   177   2e-48
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   176   5e-48
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   176   5e-48
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   176   6e-48
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   176   7e-48
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   176   7e-48
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   175   8e-48
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   175   9e-48
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   175   1e-47
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   174   1e-47
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   175   2e-47
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   174   2e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   174   2e-47
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   174   2e-47
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   174   2e-47
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   174   2e-47
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   174   3e-47
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   174   3e-47
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   174   4e-47
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     174   4e-47
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   173   5e-47
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   173   6e-47
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   173   8e-47
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   173   9e-47
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   172   9e-47
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   172   9e-47
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   173   1e-46
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   172   1e-46
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   172   1e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   172   1e-46
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   172   1e-46
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   172   1e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   172   1e-46
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   171   2e-46
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   171   2e-46
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   171   2e-46
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   171   3e-46
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   171   3e-46
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   171   4e-46
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   171   4e-46
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   170   5e-46
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   170   5e-46
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   171   5e-46
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   170   8e-46
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   169   1e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   169   1e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   169   2e-45
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   169   2e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   168   2e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   169   3e-45
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   168   4e-45
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   167   7e-45
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   167   1e-44
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   166   1e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   166   2e-44
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   166   2e-44
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   164   1e-43
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   163   2e-43
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   162   6e-43
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   162   1e-42
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   157   2e-42
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   159   8e-42
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     159   8e-42
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   159   9e-42
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   158   1e-41
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   155   1e-40
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   155   2e-40
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   154   4e-40
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   154   5e-40
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   153   6e-40
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   153   7e-40
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   153   9e-40
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   152   2e-39
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   152   2e-39
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   151   4e-39
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   150   1e-38
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   149   2e-38
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   149   2e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   148   2e-38
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   147   9e-38
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   147   1e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   138   2e-36
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   141   1e-35
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   140   2e-35
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   135   9e-35
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   132   3e-34
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   136   4e-34
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              131   4e-34
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   131   5e-34
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   134   2e-33
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   131   2e-33
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   131   2e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   131   2e-33
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   131   2e-33
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   129   2e-33
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              129   2e-33
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   130   2e-33
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   134   3e-33
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   134   3e-33
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   130   4e-33
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   130   4e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   130   4e-33
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   130   5e-33
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   130   6e-33
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   133   6e-33
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   130   6e-33
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   132   1e-32
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   129   1e-32
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   132   1e-32
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   129   1e-32
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   128   2e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   127   2e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   128   2e-32
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   127   2e-32
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   131   3e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   130   3e-32
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   126   3e-32
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   130   4e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   130   5e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   127   5e-32
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   130   5e-32
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   127   5e-32
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   130   6e-32
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   129   1e-31
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   129   1e-31
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   125   1e-31
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   129   1e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   129   2e-31
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   128   2e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   128   2e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   125   3e-31
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   124   5e-31
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   123   5e-31
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   127   6e-31
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   126   7e-31
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   126   8e-31
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   124   8e-31
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   126   1e-30
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   126   1e-30
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   125   2e-30
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   121   2e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   121   2e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   125   2e-30
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   125   3e-30
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   121   3e-30
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   120   4e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   124   4e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   124   4e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   124   5e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   124   6e-30
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   124   7e-30
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   120   7e-30
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   123   8e-30
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   123   1e-29
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   123   1e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   122   2e-29
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   122   2e-29
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   122   2e-29
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   122   2e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   121   6e-29
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    120   7e-29
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    120   9e-29
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   120   1e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   116   2e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    119   2e-28
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   119   2e-28
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   119   2e-28
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   119   3e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   118   3e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   118   3e-28
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   118   4e-28
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   118   5e-28
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   117   9e-28
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   113   2e-27
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   114   8e-27
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   113   2e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   112   3e-26
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   112   5e-26
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   112   5e-26
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   111   1e-25
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   108   2e-25
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   110   2e-25
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   109   3e-25
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   108   6e-25
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   108   7e-25
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   108   1e-24
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   107   3e-24
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   105   7e-24
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   105   9e-24
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   105   9e-24
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   105   1e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   102   1e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   104   2e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   104   2e-23
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   103   3e-23
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   103   4e-23
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   103   6e-23
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   102   9e-23
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...   102   1e-22
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   101   2e-22
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              101   2e-22
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...   101   3e-22
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...   100   3e-22
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    99   1e-21
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...    99   1e-21
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   5e-12
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    61   2e-09
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    60   3e-09
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   6e-08
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    56   7e-08
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    56   9e-08
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    55   1e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    55   2e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    54   4e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    54   4e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    53   6e-07
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    53   6e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    53   7e-07
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    52   2e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    52   2e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    52   2e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    51   3e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    51   3e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    51   3e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    51   4e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    50   4e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    50   5e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    50   5e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    50   6e-06
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    48   2e-05
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    45   2e-04
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    45   2e-04
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    45   2e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   6e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   7e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    44   7e-04
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    43   0.001
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    42   0.002
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    41   0.005
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    41   0.005
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    41   0.006
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    41   0.006
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    40   0.006
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    40   0.009
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    40   0.009
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.010
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.010
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.011
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.011
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    40   0.012
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    39   0.019
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    37   0.077
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    37   0.11 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    36   0.14 
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    36   0.14 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    36   0.15 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    36   0.16 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    36   0.20 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.21 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    36   0.21 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    35   0.23 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    35   0.25 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    35   0.26 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    35   0.28 
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    35   0.30 
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    35   0.32 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    35   0.33 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.40 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.40 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    35   0.45 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    35   0.49 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    35   0.51 
TPHA0O01320 Chr15 complement(260525..261832) [1308 bp, 435 aa] {...    34   0.51 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    34   0.55 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    34   0.56 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.67 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    34   0.71 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    34   0.73 
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    34   0.77 
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    34   0.97 
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    33   1.1  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.3  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.3  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   1.5  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.5  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   1.5  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   1.7  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   1.8  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    32   2.1  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    33   2.1  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    32   2.1  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    32   2.4  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    32   2.8  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    32   2.8  
KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1...    32   3.1  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    32   3.2  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.2  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    32   3.2  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   3.2  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    32   3.7  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   3.7  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   3.8  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   3.8  
Kpol_223.4 s223 (4546..6036) [1491 bp, 496 aa] {ON} (4546..6036)...    32   3.9  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    32   4.0  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   4.1  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   4.1  
Ecym_6343 Chr6 complement(660862..664419) [3558 bp, 1185 aa] {ON...    32   4.4  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    31   5.4  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   5.6  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   5.7  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   5.8  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    31   6.1  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   6.2  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   6.2  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   6.8  
Kwal_26.7842 s26 (536044..538146) [2103 bp, 700 aa] {ON} YMR078C...    31   6.9  
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    31   7.1  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    31   7.6  
SAKL0A03982g Chr1 complement(369575..373072) [3498 bp, 1165 aa] ...    31   8.0  
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...    30   9.0  
KNAG0K00810 Chr11 (150427..153351) [2925 bp, 974 aa] {ON} Anc_3....    30   9.5  
Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C...    30   9.5  
TDEL0A05830 Chr1 (1026554..1029124) [2571 bp, 856 aa] {ON} Anc_8...    30   9.6  

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/409 (90%), Positives = 372/409 (90%)

Query: 1   MKGAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQ 60
           MKGAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQ
Sbjct: 1   MKGAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQ 60

Query: 61  VARCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 120
           VARCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 61  VARCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 120

Query: 121 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAAL 180
           SKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAAL
Sbjct: 121 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAAL 180

Query: 181 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 240
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 181 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 240

Query: 241 RTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 300
           RTRKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 241 RTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 300

Query: 301 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 360
           NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE
Sbjct: 301 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 360

Query: 361 LRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           LRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN
Sbjct: 361 LRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/407 (89%), Positives = 368/407 (90%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 39  GAAPYADKLKETEKDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 98

Query: 63  RCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 122
           RCTKIIKPEAS+++  +EDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK
Sbjct: 99  RCTKIIKPEASDESPADEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 158

Query: 123 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 182
           YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI
Sbjct: 159 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 218

Query: 183 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 242
           DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
Sbjct: 219 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 278

Query: 243 RKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 302
           RKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT
Sbjct: 279 RKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 338

Query: 303 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 362
           LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR
Sbjct: 339 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 398

Query: 363 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTS+YMQYN
Sbjct: 399 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/417 (85%), Positives = 366/417 (87%), Gaps = 10/417 (2%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 40  GAAPYANKLKEIEKDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 99

Query: 63  RCTKIIK-------PEASEDNTG---EEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEE 112
           RCTKIIK       PE ++ N+    EED+ED+KY+INLKQIAKFVVGLGERVSPTDIEE
Sbjct: 100 RCTKIIKGDSSSSSPEDTQSNSSPNSEEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEE 159

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
           GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL
Sbjct: 160 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 219

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
           SPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 220 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 279

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VRELFEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 280 VRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 339

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 352
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRL
Sbjct: 340 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL 399

Query: 353 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTS+YMQYN
Sbjct: 400 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/407 (85%), Positives = 361/407 (88%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSH+WD+MGDRQRLSEEHPLQVA
Sbjct: 42  GAAPYADKLKVTEEDLKKIEARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVA 101

Query: 63  RCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 122
           RCTKIIK  + E   G EDE+D+KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK
Sbjct: 102 RCTKIIKSSSEEGAEGNEDEDDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 161

Query: 123 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 182
           YHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA LGI
Sbjct: 162 YHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGI 221

Query: 183 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 242
           DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
Sbjct: 222 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 281

Query: 243 RKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 302
           +KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT
Sbjct: 282 KKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 341

Query: 303 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 362
           LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK+MSVER IRWELISRLCPNSTGAELR
Sbjct: 342 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPNSTGAELR 401

Query: 363 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           SVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTS+YMQYN
Sbjct: 402 SVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/415 (83%), Positives = 363/415 (87%), Gaps = 8/415 (1%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDI+GDRQ+LSE HPLQVA
Sbjct: 42  GAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVA 101

Query: 63  RCTKIIKPEASEDNTGE--------EDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGM 114
           RCTKIIK E S D+ G         +D+ED+KY+INLKQIAKFVVGLGERVSPTDIEEGM
Sbjct: 102 RCTKIIKSEPSRDSAGGSSSATTVGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGM 161

Query: 115 RVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSP 174
           RVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSP
Sbjct: 162 RVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP 221

Query: 175 ERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 234
           ERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR
Sbjct: 222 ERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 281

Query: 235 ELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVM 294
           ELFEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVM
Sbjct: 282 ELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVM 341

Query: 295 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCP 354
           FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCP
Sbjct: 342 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCP 401

Query: 355 NSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           NSTGAELRSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTS+YMQYN
Sbjct: 402 NSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/413 (84%), Positives = 362/413 (87%), Gaps = 7/413 (1%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVA
Sbjct: 64  GAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVA 123

Query: 63  RCTKIIKPEASED------NTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRV 116
           RCTKII+   S D      NTGE+DE D+KY+INLKQIAKFVVGLGERVSPTDIEEGMRV
Sbjct: 124 RCTKIIRSNPSADASRSGANTGEDDE-DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 182

Query: 117 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPER 176
           GVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPER
Sbjct: 183 GVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPER 242

Query: 177 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 236
           FA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL
Sbjct: 243 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 302

Query: 237 FEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFA 296
           FEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFA
Sbjct: 303 FEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFA 362

Query: 297 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS 356
           TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNS
Sbjct: 363 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS 422

Query: 357 TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           TGAELRSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTS+YMQYN
Sbjct: 423 TGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/422 (82%), Positives = 365/422 (86%), Gaps = 15/422 (3%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 43  GAAPYASKLKETEKDLKDIELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 102

Query: 63  RCTKIIKPEAS---EDNTGE------------EDEEDSKYIINLKQIAKFVVGLGERVSP 107
           RCTKIIK  +S   E++ G             +D+E++KY+INLKQIAKFVVGLGERVSP
Sbjct: 103 RCTKIIKKSSSTEGENDNGNGENGESASANDADDDEEAKYVINLKQIAKFVVGLGERVSP 162

Query: 108 TDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVV 167
           TDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKEQI+KLREVV
Sbjct: 163 TDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVV 222

Query: 168 ELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVG 227
           ELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVG
Sbjct: 223 ELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVG 282

Query: 228 EGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDP 287
           EGARMVRELFEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDP
Sbjct: 283 EGARMVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDP 342

Query: 288 RGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWE 347
           RGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+K+MSVERGIRWE
Sbjct: 343 RGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWE 402

Query: 348 LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQ 407
           LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTS+YMQ
Sbjct: 403 LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQ 462

Query: 408 YN 409
           YN
Sbjct: 463 YN 464

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/423 (82%), Positives = 362/423 (85%), Gaps = 16/423 (3%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 41  GAAPYDSKIKETEKDLKVIEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 100

Query: 63  RCTKIIKPEA----------------SEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVS 106
           RCTKIIK  +                +  NT  +D E++KY+INLKQIAKFVVGLGERVS
Sbjct: 101 RCTKIIKKSSENGDESNSESTEGNGTANTNTAADDNEEAKYVINLKQIAKFVVGLGERVS 160

Query: 107 PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREV 166
           PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREV
Sbjct: 161 PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREV 220

Query: 167 VELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV 226
           VELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV
Sbjct: 221 VELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV 280

Query: 227 GEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFD 286
           GEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLELITQLDGFD
Sbjct: 281 GEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFD 340

Query: 287 PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRW 346
           PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRW
Sbjct: 341 PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRW 400

Query: 347 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYM 406
           ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTS+YM
Sbjct: 401 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYM 460

Query: 407 QYN 409
           QYN
Sbjct: 461 QYN 463

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/402 (85%), Positives = 358/402 (89%), Gaps = 22/402 (5%)

Query: 30  GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASEDNTG----------- 78
           GVKESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKIIK  +  +N+            
Sbjct: 67  GVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLENSNSMDNNSTNNTP 126

Query: 79  -----------EEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIEL 127
                      E+++ED+KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIEL
Sbjct: 127 LDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIEL 186

Query: 128 PLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKG 187
           PLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREVVELPLLSPERFA LGIDPPKG
Sbjct: 187 PLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKG 246

Query: 188 ILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACI 247
           ILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACI
Sbjct: 247 ILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACI 306

Query: 248 IFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPAL 307
           IFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPAL
Sbjct: 307 IFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPAL 366

Query: 308 LRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTE 367
           LRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTE
Sbjct: 367 LRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTE 426

Query: 368 AGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409
           AGMFAIRARRKVA+EKDFLQAVEKVINGYKKFSSTS+YMQYN
Sbjct: 427 AGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/431 (81%), Positives = 358/431 (83%), Gaps = 24/431 (5%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 42  GAAPYAAKLKETEKDLKEIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 101

Query: 63  RCTKIIKPEASED----------NTGEEDEEDS--------------KYIINLKQIAKFV 98
           RCTKIIK  AS +          NT       S              KY+INLKQIAKFV
Sbjct: 102 RCTKIIKSSASNEVSDESAVNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFV 161

Query: 99  VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 158
           VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE
Sbjct: 162 VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 221

Query: 159 QIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 218
           QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG
Sbjct: 222 QIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 281

Query: 219 SELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLEL 278
           SELVQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLEL
Sbjct: 282 SELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLEL 341

Query: 279 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 338
           ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM
Sbjct: 342 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 401

Query: 339 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 398
           SVER IRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKK
Sbjct: 402 SVERNIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKK 461

Query: 399 FSSTSQYMQYN 409
           FSSTS+YMQYN
Sbjct: 462 FSSTSRYMQYN 472

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/435 (80%), Positives = 360/435 (82%), Gaps = 32/435 (7%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 41  GAAPYAGKLKETEKDLKDIENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 100

Query: 63  RCTKIIKPEASEDNTGEEDEED----------------------------SKYIINLKQI 94
           RCTKII+     +  GE   ED                            +KY+INLKQI
Sbjct: 101 RCTKIIR----SNGEGESRNEDGLDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQI 156

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
           AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG
Sbjct: 157 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 216

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           GCKEQI+KLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI
Sbjct: 217 GCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 276

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 274
           RVIGSELVQKYVGEGARMVRELFEMART+KACI+FFDEI               NEVQRT
Sbjct: 277 RVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRT 336

Query: 275 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 334
           MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH
Sbjct: 337 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 396

Query: 335 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 394
           +KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVIN
Sbjct: 397 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVIN 456

Query: 395 GYKKFSSTSQYMQYN 409
           GYKKFSSTS+YMQYN
Sbjct: 457 GYKKFSSTSRYMQYN 471

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/428 (80%), Positives = 359/428 (83%), Gaps = 21/428 (4%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRL EEHPLQVA
Sbjct: 41  GAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVA 100

Query: 63  RCTKIIKPEASEDNTGEEDEEDS---------------------KYIINLKQIAKFVVGL 101
           RCTKIIK     D++  ++  DS                     KY+INLKQIAKFVVGL
Sbjct: 101 RCTKIIKGSGENDDSTTDNNNDSVNGNSNSNQESADVDEDDEDAKYVINLKQIAKFVVGL 160

Query: 102 GERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQID 161
           GERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+
Sbjct: 161 GERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIE 220

Query: 162 KLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL 221
           KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL
Sbjct: 221 KLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL 280

Query: 222 VQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQ 281
           VQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLELITQ
Sbjct: 281 VQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQ 340

Query: 282 LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE 341
           LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE
Sbjct: 341 LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE 400

Query: 342 RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSS 401
           RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSS
Sbjct: 401 RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSS 460

Query: 402 TSQYMQYN 409
           TS+YMQYN
Sbjct: 461 TSRYMQYN 468

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/432 (80%), Positives = 360/432 (83%), Gaps = 25/432 (5%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 43  GAAPYAAKLKEIEKDLKTIENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 102

Query: 63  RCTKIIKPEA-------------------------SEDNTGEEDEEDSKYIINLKQIAKF 97
           RCTKIIK                                 GE+++ED+KY+INLKQIAKF
Sbjct: 103 RCTKIIKSNGNEEEQEGEGESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKF 162

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           VVGLGERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK
Sbjct: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI
Sbjct: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
           GSELVQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLE
Sbjct: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLE 342

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS
Sbjct: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           MSVER IRWELISRLCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYK
Sbjct: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462

Query: 398 KFSSTSQYMQYN 409
           KFSSTS+YMQYN
Sbjct: 463 KFSSTSRYMQYN 474

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/427 (81%), Positives = 362/427 (84%), Gaps = 20/427 (4%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 42  GAAPYATKLKETEKDLKDIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 101

Query: 63  RCTKIIKPEASEDNTGE--------------------EDEEDSKYIINLKQIAKFVVGLG 102
           RCTKIIK  +  +  GE                    E++ED+KY+INLKQIAKFVVGLG
Sbjct: 102 RCTKIIKSTSDSNENGEGLDGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLG 161

Query: 103 ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDK 162
           ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QI+K
Sbjct: 162 ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEK 221

Query: 163 LREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 222
           LREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV
Sbjct: 222 LREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 281

Query: 223 QKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQL 282
           QKYVGEGARMVRELFEMAR++KACI+FFDEI               NEVQRTMLELITQL
Sbjct: 282 QKYVGEGARMVRELFEMARSKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQL 341

Query: 283 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER 342
           DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVER
Sbjct: 342 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVER 401

Query: 343 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST 402
           GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST
Sbjct: 402 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST 461

Query: 403 SQYMQYN 409
           S+YMQYN
Sbjct: 462 SRYMQYN 468

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/436 (79%), Positives = 360/436 (82%), Gaps = 29/436 (6%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDI+GDRQRLSEE PLQVA
Sbjct: 40  GAAPYAKKLKSIENDLKEIEKKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVA 99

Query: 63  RCTKIIKPEASE-----------------------------DNTGEEDEEDSKYIINLKQ 93
           RCTKIIK E  +                               T +ED++D+KY+INLKQ
Sbjct: 100 RCTKIIKAEKPQRSGNALGGDADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQ 159

Query: 94  IAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDV 153
           IAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDV
Sbjct: 160 IAKFVVGLGERVSPTDIEEGMRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDV 219

Query: 154 GGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATF 213
           GGCKEQI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATF
Sbjct: 220 GGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATF 279

Query: 214 IRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQR 273
           IRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDE+               NEVQR
Sbjct: 280 IRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQR 339

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI
Sbjct: 340 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 399

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           H+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV TEKDFL+AVEKVI
Sbjct: 400 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVI 459

Query: 394 NGYKKFSSTSQYMQYN 409
           NGYKKFSSTS+YMQYN
Sbjct: 460 NGYKKFSSTSRYMQYN 475

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/427 (80%), Positives = 356/427 (83%), Gaps = 20/427 (4%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRL EEHPLQVA
Sbjct: 41  GAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVA 100

Query: 63  RCTKIIKPEASEDNTGEEDEEDS--------------------KYIINLKQIAKFVVGLG 102
           RCTKIIK     D T  ++                        KY+INLKQIAKFVVGLG
Sbjct: 101 RCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLG 160

Query: 103 ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDK 162
           ERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+K
Sbjct: 161 ERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEK 220

Query: 163 LREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 222
           LREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV
Sbjct: 221 LREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 280

Query: 223 QKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQL 282
           QKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLELITQL
Sbjct: 281 QKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQL 340

Query: 283 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER 342
           DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER
Sbjct: 341 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER 400

Query: 343 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST 402
           GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSST
Sbjct: 401 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSST 460

Query: 403 SQYMQYN 409
           S+YMQYN
Sbjct: 461 SRYMQYN 467

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/428 (80%), Positives = 358/428 (83%), Gaps = 21/428 (4%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRL EEHPLQVA
Sbjct: 41  GAAPYAAKLKQTESDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVA 100

Query: 63  RCTKIIKPEASEDNTGEEDEEDS---------------------KYIINLKQIAKFVVGL 101
           RCTKIIK     D+   ++  +S                     KY+INLKQIAKFVVGL
Sbjct: 101 RCTKIIKGNGENDDPTTDNNSNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGL 160

Query: 102 GERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQID 161
           GERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+
Sbjct: 161 GERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIE 220

Query: 162 KLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL 221
           KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL
Sbjct: 221 KLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSEL 280

Query: 222 VQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQ 281
           VQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLELITQ
Sbjct: 281 VQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQ 340

Query: 282 LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE 341
           LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE
Sbjct: 341 LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE 400

Query: 342 RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSS 401
           RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSS
Sbjct: 401 RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSS 460

Query: 402 TSQYMQYN 409
           TS+YMQYN
Sbjct: 461 TSRYMQYN 468

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/431 (80%), Positives = 360/431 (83%), Gaps = 24/431 (5%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           GAAPY                      GVKESDTGLAPSHLWDIMGDRQRL EEHPLQVA
Sbjct: 41  GAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVA 100

Query: 63  RCTKIIKPEA------------------------SEDNTGEEDEEDSKYIINLKQIAKFV 98
           RCTKIIK                            E    +ED+ED+KY+INLKQIAKFV
Sbjct: 101 RCTKIIKGNGENDDSTTNNNNDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFV 160

Query: 99  VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 158
           VGLGERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+
Sbjct: 161 VGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKD 220

Query: 159 QIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 218
           QI+KLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG
Sbjct: 221 QIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 280

Query: 219 SELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLEL 278
           SELVQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLEL
Sbjct: 281 SELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLEL 340

Query: 279 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 338
           ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM
Sbjct: 341 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 400

Query: 339 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 398
           SVER IRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKK
Sbjct: 401 SVERDIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 460

Query: 399 FSSTSQYMQYN 409
           FSSTS+YMQYN
Sbjct: 461 FSSTSRYMQYN 471

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/435 (78%), Positives = 355/435 (81%), Gaps = 28/435 (6%)

Query: 3   GAAPYXXXXXXXXXXXXXXXXXXXXXXGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62
           G APY                      GV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVA
Sbjct: 43  GVAPYAVKLKETENDLKEIEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVA 102

Query: 63  RCTKIIKPEASEDNTGEEDEED----------------------------SKYIINLKQI 94
           RCTKIIK    + N    +                               SKY+INLKQI
Sbjct: 103 RCTKIIKSGEGDGNGSGNNSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQI 162

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
           AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVG
Sbjct: 163 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVG 222

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           GCK+QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI
Sbjct: 223 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 282

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 274
           RVIGSELVQKYVGEGARMVRELFEMART++ACIIFFDEI               NEVQRT
Sbjct: 283 RVIGSELVQKYVGEGARMVRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRT 342

Query: 275 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 334
           MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH
Sbjct: 343 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 402

Query: 335 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 394
           SKSMSVERGIRWELISRLCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AV+KVIN
Sbjct: 403 SKSMSVERGIRWELISRLCPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVIN 462

Query: 395 GYKKFSSTSQYMQYN 409
           GYKKFSSTS+YMQYN
Sbjct: 463 GYKKFSSTSRYMQYN 477

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/385 (85%), Positives = 341/385 (88%), Gaps = 22/385 (5%)

Query: 47  MGDRQRLSEEHPLQVARCTKIIKPEASEDNTGEE--DEE--------------------D 84
           MGDRQRLSEEHPLQVARCTKIIK  A+    GE+  DE+                    D
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTSTSNNSNAENAEEDEED 60

Query: 85  SKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 144
           +KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE
Sbjct: 61  NKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 120

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           KPD+TYSDVGGCK+QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARA
Sbjct: 121 KPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 180

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
           VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDEI           
Sbjct: 181 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDG 240

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL
Sbjct: 241 AGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 300

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
           EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA+EKD
Sbjct: 301 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVASEKD 360

Query: 385 FLQAVEKVINGYKKFSSTSQYMQYN 409
           FL+AVEKVINGYKKFSSTS+YMQYN
Sbjct: 361 FLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  314 bits (805), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 209/311 (67%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQE 380

Query: 384 DFLQAVEKVIN 394
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  313 bits (802), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 209/311 (67%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 384 DFLQAVEKVIN 394
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  313 bits (801), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 209/311 (67%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 384 DFLQAVEKVIN 394
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  313 bits (801), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 209/311 (67%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 384 DFLQAVEKVIN 394
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  311 bits (798), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 209/311 (67%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE
Sbjct: 80  EKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVE 139

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 259

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 260 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 319

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  R  I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 320 VAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 379

Query: 384 DFLQAVEKVIN 394
           DF  AV KV+N
Sbjct: 380 DFELAVAKVMN 390

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  307 bits (787), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 209/313 (66%), Gaps = 2/313 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 74  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVE 133

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 134 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 193

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX--XXXXXX 261
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 194 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 253

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPP 313

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 381
           P +  RA I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTVAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 382 EKDFLQAVEKVIN 394
           ++DF  AV KV+N
Sbjct: 374 QEDFELAVGKVMN 386

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  307 bits (786), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 273
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           HS+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 394 N 394
           N
Sbjct: 391 N 391

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  307 bits (786), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 207/311 (66%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVE 140

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  +GG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLAR 200

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEG 260

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPT 320

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           +  R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 384 DFLQAVEKVIN 394
           D   AV KV+N
Sbjct: 381 DLELAVGKVMN 391

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  306 bits (785), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 208/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D + ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVE 137

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  R  I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 378 EDFELAVSKVMN 389

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  306 bits (785), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 273
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           HS+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 394 N 394
           N
Sbjct: 391 N 391

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  306 bits (784), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 208/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 82  DKKVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVE 141

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 142 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 201

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 202 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 261

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 262 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 321

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 322 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 381

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 382 EDFELAVGKVMN 393

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  305 bits (782), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 273
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 271 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 330

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           HS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 390

Query: 394 N 394
           N
Sbjct: 391 N 391

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  305 bits (781), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 208/315 (66%), Gaps = 4/315 (1%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D+K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 72  DTKVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVE 131

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 132 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 191

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX----XXXX 259
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 192 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 251

Query: 260 XXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF 319
                    +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF
Sbjct: 252 SSGGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEF 311

Query: 320 SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
             P L  R  I RIHS+ M++ RGI    I       +GA+++ VCTEAGM+A+R RR  
Sbjct: 312 PAPTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIH 371

Query: 380 ATEKDFLQAVEKVIN 394
            T++DF  AV KV+N
Sbjct: 372 VTQEDFELAVGKVMN 386

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  305 bits (781), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 273
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           HS+ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 394 N 394
           N
Sbjct: 394 N 394

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  305 bits (780), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 208/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVE 139

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 259

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  304 bits (779), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 208/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 76  DKRVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVE 135

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 136 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 195

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 196 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 255

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 256 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 315

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 316 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 375

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 376 EDFELAVAKVMN 387

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  304 bits (778), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 208/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVE 139

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEG 259

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  303 bits (777), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D + ++ ++   K++V +   ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVE 137

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 264 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 322
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 323 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
            +  RA I +IHS+ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARAEILKIHSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 383 KDFLQAVEKVIN 394
           +DF  AV KV+N
Sbjct: 378 EDFELAVAKVMN 389

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  302 bits (774), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 201/300 (67%)

Query: 95  AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 154
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 155 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 214
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 215 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 274
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 275 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 334
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 335 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 394
           S+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  280 bits (717), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 202/324 (62%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 111 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 170

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 171 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAK 230

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 231 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 290

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 291 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 350

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R    ++
Sbjct: 351 EAGRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQE 410

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK     +Y +
Sbjct: 411 DLMKAVRKVAE-VKKLEGKLEYQK 433

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  279 bits (714), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 110 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSF 169

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ D+T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 170 EQGDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 229

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 230 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 289

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+
Sbjct: 290 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPN 349

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + 
Sbjct: 350 ETGRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQD 409

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK     +Y +
Sbjct: 410 DLMKAVRKVAE-VKKLEGKIEYQK 432

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  278 bits (712), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 201/324 (62%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 114 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 173

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 174 EQGEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 233

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 234 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 293

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+
Sbjct: 294 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPN 353

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R   T  
Sbjct: 354 EAGRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSD 413

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T +Y +
Sbjct: 414 DLMKAVRKVAE-VKKLEGTIEYQK 436

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  278 bits (711), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 199/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           D KYI+      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 109 DEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 168

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+
Sbjct: 169 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAK 228

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 229 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 288

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 289 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 348

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             G   IF+IH+  +       +E   ++C    GA++R+  TEAG FAIR  R    ++
Sbjct: 349 EAGMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQE 408

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK     +Y +
Sbjct: 409 DLMKAVRKVAE-VKKLEGKLEYQK 431

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  278 bits (710), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 203/317 (64%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  F V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A  +   IIF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++ + + +E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTGEDFKQAKERVM 424

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  278 bits (710), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 202/322 (62%), Gaps = 1/322 (0%)

Query: 86  KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 145
           KYI+      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 385
           GR  IF+IH+ ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 386 LQAVEKVINGYKKFSSTSQYMQ 407
           ++AV KV +  KK   T +Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  277 bits (709), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 199/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 114 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 173

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 174 EQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 233

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 234 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 293

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+
Sbjct: 294 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPN 353

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      
Sbjct: 354 EAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPD 413

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T +Y +
Sbjct: 414 DLMKAVRKVAE-VKKLEGTIEYQK 436

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  277 bits (708), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 199/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 111 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 170

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ D+T+  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+
Sbjct: 171 EQGDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAK 230

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 231 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 290

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+
Sbjct: 291 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPN 350

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + 
Sbjct: 351 ETGRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQD 410

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK     +Y +
Sbjct: 411 DLMKAVRKVAE-VKKLEGKIEYQK 433

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  276 bits (706), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 98  EEKYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTF 157

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E  ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 158 EPGEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAK 217

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 218 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 277

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 278 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 337

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + 
Sbjct: 338 EAGRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQD 397

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV +  KK     +Y +
Sbjct: 398 DLMKAVRKV-SEVKKLEGKLEYQK 420

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  276 bits (706), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 114 EEKYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 173

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 174 EQGEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 233

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 234 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 293

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+
Sbjct: 294 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPN 353

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      
Sbjct: 354 EAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPD 413

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T +Y +
Sbjct: 414 DLMKAVRKVAE-VKKLEGTIEYQK 436

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  275 bits (704), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 104 EEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 163

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+
Sbjct: 164 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAK 223

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 224 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 283

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 284 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 343

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    ++
Sbjct: 344 EAGRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQE 403

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK     +Y +
Sbjct: 404 DLMKAVRKVAE-VKKLEGKLEYQK 426

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  275 bits (704), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 201/324 (62%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 103 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 162

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 163 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 222

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 223 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 282

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+
Sbjct: 283 GTSADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPN 342

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +  +    +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 343 EAGRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPE 402

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   + +Y +
Sbjct: 403 DLMKAVRKVAE-VKKLEGSLEYQK 425

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  273 bits (699), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 198/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  F V +   V    +  G  V +      I   L   +DP 
Sbjct: 47  TLEEIIDDDHAIVTSPTMPDFYVSILSFVDKELLGPGCAVSLHHKTMSIVGVLQDDVDPM 106

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +Y D+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 107 VSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 166

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      IIF DEI   
Sbjct: 167 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVASENSPSIIFIDEIDAI 226

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD    +KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 227 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVKVIMATNKIETLDPALIRPGRIDRK 286

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   + +E +     + +GA+++++CTEAG+ A+R R
Sbjct: 287 ILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTTKDDLSGADIQAMCTEAGLLALRER 346

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 347 RMQVTAEDFKQAKERVM 363

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  275 bits (703), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 114 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 173

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 174 EQGEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAK 233

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 234 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 293

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 294 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPN 353

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 354 EAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPE 413

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T +Y +
Sbjct: 414 DLMKAVRKVAE-VKKLEGTIEYQK 436

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  275 bits (703), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 199/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 112 EEKYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 171

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ D+++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 172 EQGDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAK 231

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 232 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 291

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 292 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPN 351

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 352 EAGRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPE 411

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   +  Y +
Sbjct: 412 DLMKAVRKVAE-VKKLEGSLDYQK 434

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  275 bits (702), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  274 bits (700), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 203/324 (62%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 101 EEKYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 160

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ +++++ +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 161 EQGEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 220

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AV+    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 221 AVSATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 280

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 281 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 340

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 341 EAGRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPE 400

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV +  KK   T +Y +
Sbjct: 401 DLMKAVRKV-SEVKKLEGTLEYQK 423

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  274 bits (701), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 107 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 166

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 167 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 226

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 227 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 286

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 287 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 346

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 347 ILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLALRER 406

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 407 RMQVTSEDFEQAKERVL 423

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  274 bits (701), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  274 bits (701), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  274 bits (701), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 199/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 120 EEKYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 179

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ +VT+  +GG  EQI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 180 EQGEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 239

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 240 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 299

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 300 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 359

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 360 EAGRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPE 419

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   + +Y +
Sbjct: 420 DLMKAVRKVAE-VKKLEGSLEYQK 442

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  273 bits (699), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 109 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 168

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 169 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 228

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 229 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 288

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 289 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 348

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 349 EAGRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPE 408

Query: 384 DFLQAVEKVINGYKKFSSTSQY 405
           D ++AV KV    KK   + +Y
Sbjct: 409 DLMKAVRKVAE-VKKLEGSLEY 429

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  274 bits (701), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 202/326 (61%), Gaps = 1/326 (0%)

Query: 80  EDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTM 139
           +D  D KYI+      +++VG+   +  + +++G+RV +D +   I   LP   DP V  
Sbjct: 128 KDLSDEKYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYN 187

Query: 140 MTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKT 199
           MT  E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKT
Sbjct: 188 MTSFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKT 247

Query: 200 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXX 259
           L A+AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+      
Sbjct: 248 LLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGR 307

Query: 260 XXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF 319
                     E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E 
Sbjct: 308 RFSEGTSADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEI 367

Query: 320 SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
            LP+  GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R  
Sbjct: 368 PLPNEAGRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNH 427

Query: 380 ATEKDFLQAVEKVINGYKKFSSTSQY 405
              +D ++AV KV    KK   + +Y
Sbjct: 428 IIPEDLMKAVRKVAE-VKKLEGSLEY 452

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  271 bits (694), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/330 (41%), Positives = 202/330 (61%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   II       F V +   V    +E G  V +      I   L    DP 
Sbjct: 47  TLEEIIDDDHAIITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPM 106

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           + +M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 107 INVMKIDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 166

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      I+F DEI   
Sbjct: 167 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAI 226

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 227 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 286

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 287 ILFENPDISTKRKILTIHTSKMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRER 346

Query: 377 RKVATEKDFLQAVEKVINGYKKFSSTSQYM 406
           R   T +DF QA E+++    + +  S Y+
Sbjct: 347 RMQVTAEDFKQAKERILKNKVEENLESLYL 376

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  273 bits (698), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 113 EEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSF 172

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 173 EQGEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAK 232

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+          
Sbjct: 233 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 292

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 293 GTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 352

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  IF+IH+  +       ++   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 353 EAGRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPE 412

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T +Y +
Sbjct: 413 DLMKAVRKVAE-VKKLEGTLEYQK 435

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  273 bits (698), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      +   L    DP 
Sbjct: 106 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHNKTMSVVGVLQDDADPM 165

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 166 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 225

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 226 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEIDAI 285

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 286 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 345

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA++++VCTEAG+ A+R R
Sbjct: 346 ILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLALRER 405

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 406 RMQVTAEDFKQAKERVM 422

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  273 bits (698), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL+ +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF Q  E+V+
Sbjct: 408 RMQVTAEDFKQGKERVL 424

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  273 bits (698), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 204/330 (61%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+       F V +   V    +E G  V +      I   L    DP 
Sbjct: 107 TLEEIIDDDHAIVTSPTTPDFYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPM 166

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 167 VSVMKIDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 226

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 227 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 286

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 287 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 346

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   I  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 347 ILFENPDISTKRKILGIHTSKMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRER 406

Query: 377 RKVATEKDFLQAVEKVINGYKKFSSTSQYM 406
           R   T +DF QA E+V+    + +  S Y+
Sbjct: 407 RMQVTAEDFKQAKERVMKNKVEENLESLYL 436

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  273 bits (697), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 120 EEKYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAF 179

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+
Sbjct: 180 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAK 239

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 240 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 299

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 300 GTSADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 359

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR +IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 360 EAGRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPE 419

Query: 384 DFLQAVEKVINGYKKFSSTSQY 405
           D ++AV KV +  KK   + +Y
Sbjct: 420 DLMKAVRKV-SEVKKLEGSLEY 440

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  272 bits (696), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 138/330 (41%), Positives = 203/330 (61%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +        +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVLQDDTDPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           +++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 ISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYESNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  MS+   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVINGYKKFSSTSQYM 406
           R   T +DF QA E+V+    + +    YM
Sbjct: 408 RMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  272 bits (695), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 104 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 163

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 164 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 223

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 224 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 283

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 284 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 343

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 344 ILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLALRER 403

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 404 RMQVTAEDFKQAKERVM 420

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  272 bits (695), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 197/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +        +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           +  M +++ P   YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 IAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +R + +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  271 bits (693), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 199/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTGPTMPDYYVSILSFVDKELLEPGCSVLLHNKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF Q  E+V+
Sbjct: 408 RMQVTAEDFKQGKERVL 424

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  271 bits (693), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLCEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTGEDFKQAKERVM 424

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  271 bits (693), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 198/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+       F V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +Y+D+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPAESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +  E +       +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDITTKRKILGIHTSKMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTVEDFKQAKERVM 424

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  270 bits (691), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 197/315 (62%)

Query: 79  EEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVT 138
           EE  +D   I+    +  + V +   V    +E G  V +      I   L    DP V+
Sbjct: 107 EEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVS 166

Query: 139 MMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGK 198
           +M +++ P  TYSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGK
Sbjct: 167 VMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGK 226

Query: 199 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXX 258
           TL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      I+F DEI     
Sbjct: 227 TLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEIDAIGT 286

Query: 259 XXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 318
                      E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRIDRK+ 
Sbjct: 287 KRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRIDRKIL 346

Query: 319 FSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRK 378
           F  PDL  +  I  IH+  MS+   +  + +     + +GA+++++CTEAG+ A+R RR 
Sbjct: 347 FENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLALRERRM 406

Query: 379 VATEKDFLQAVEKVI 393
             T KDF Q  E+V+
Sbjct: 407 QVTAKDFEQGKERVL 421

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  270 bits (691), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 199/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+       F V +   V    +E G  V +      I   L    DP 
Sbjct: 108 TLEEIIDDDHAIVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P  +Y+D+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRER 407

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+V+
Sbjct: 408 RMQVTVEDFKQAKERVM 424

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  270 bits (690), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  270 bits (690), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 154/385 (40%), Positives = 218/385 (56%), Gaps = 23/385 (5%)

Query: 41  SHLWDIMGDRQRLSEEH-------PLQVARCTKIIKPEASEDNTGEEDEEDSKYIINLKQ 93
           SH  ++M D+ + ++E        P  VA   +++  +  ED    E       + NL  
Sbjct: 52  SHENNVMLDKIKDNKEKIKNNRQLPYLVANVVEVMDMDEIEDKENNESTTQGGNV-NLDN 110

Query: 94  IAK---FVVGLGER----------VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMM 140
            AK    VV    R          V PT ++    VGV++  Y I   LP   D  V  M
Sbjct: 111 AAKGKAAVVKTSSRQTVFLPMVGLVDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAM 170

Query: 141 TVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTL 200
            V+EKP  TYSDVGG  +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL
Sbjct: 171 EVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTL 230

Query: 201 CARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXX 260
            ARA A +T+ATF+++   +LVQ ++GEGA++VR+ F +A+ +   IIF DE+       
Sbjct: 231 LARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKR 290

Query: 261 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 320
                    EVQRTMLEL+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF 
Sbjct: 291 FDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFP 350

Query: 321 LPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA 380
           LP  +GRA I +IHS+ M+ +  I W+ ++R      GA+L++V  EAGM A+R  +   
Sbjct: 351 LPTEDGRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSV 410

Query: 381 TEKDFLQAVEKVINGYKKFSSTSQY 405
             +DF++ + +V    +K  S S Y
Sbjct: 411 KHEDFVEGIGEV--QARKSKSVSFY 433

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  270 bits (689), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  270 bits (689), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 156/390 (40%), Positives = 221/390 (56%), Gaps = 33/390 (8%)

Query: 41  SHLWDIMGDRQRLSEEH-------PLQVARCTKIIKPEASEDNTGEEDEEDSKYI----- 88
           SH   +M D+ + ++E        P  VA   +I+      D  G +DE++S+       
Sbjct: 52  SHENSVMLDKIKDNKEKIKNNKQLPYLVANIVEIM------DMDGLDDEQNSESATQGGN 105

Query: 89  INLKQIAK---FVVGLGER----------VSPTDIEEGMRVGVDRSKYHIELPLPPRIDP 135
           +NL   AK    VV    R          V P  ++    VGV++  Y +   LP   D 
Sbjct: 106 VNLDNAAKGKAAVVKTSSRQTVFLPMVGLVDPNKLKPNDLVGVNKDSYLVLDTLPSEFDS 165

Query: 136 SVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPG 195
            V  M V+EKP  TYSDVGG  +QI++L E + LP+   E+F  +GI  PKG L+YGPPG
Sbjct: 166 RVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPG 225

Query: 196 TGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX 255
           TGKTL ARA A +T+ATF+++   +LVQ ++GEGA++VR+ F +A+ +   IIF DE+  
Sbjct: 226 TGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDA 285

Query: 256 XXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDR 315
                         EVQRTMLEL+ QLDGF     +KV+ ATNR + LDPALLR GR+DR
Sbjct: 286 IGTKRFDSEKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDR 345

Query: 316 KVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRA 375
           K+EF LP  E RA I +IHS+ M+ +  I W+ ++R      GA+L++V  EAGM A+R 
Sbjct: 346 KIEFPLPSEEARAQILQIHSRKMTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRN 405

Query: 376 RRKVATEKDFLQAVEKVINGYKKFSSTSQY 405
            +     +DF++A+ +V    +K  S S Y
Sbjct: 406 GQSQVKHEDFVEAIGEV--QARKTKSVSFY 433

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  270 bits (689), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 194/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QAR 423

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  269 bits (688), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 135/317 (42%), Positives = 196/317 (61%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   II       F V +   V    +E G  V +      I   L    DP 
Sbjct: 126 TLEEIIDDDHAIITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPM 185

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           + +M +++ P   YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 186 INVMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 245

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      I+F DEI   
Sbjct: 246 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAI 305

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 306 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 365

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +  + +     + +GA+++++CTEAG+ A+R R
Sbjct: 366 ILFENPDITTKRKILAIHTSKMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRER 425

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF QA E+++
Sbjct: 426 RMQVTAEDFKQAKERIL 442

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  268 bits (685), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 198/324 (61%), Gaps = 1/324 (0%)

Query: 84  DSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 143
           + KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 121 EEKYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSF 180

Query: 144 EKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 203
           ++ ++++  +GG  +QI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+
Sbjct: 181 DQDNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAK 240

Query: 204 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX 263
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI          
Sbjct: 241 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSE 300

Query: 264 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 323
                 E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+
Sbjct: 301 GTSADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPN 360

Query: 324 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
             GR  +F+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +
Sbjct: 361 EAGRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPE 420

Query: 384 DFLQAVEKVINGYKKFSSTSQYMQ 407
           D ++AV KV    KK   T  Y +
Sbjct: 421 DMMKAVRKVAES-KKLEGTVDYQK 443

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  267 bits (682), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 218/372 (58%), Gaps = 19/372 (5%)

Query: 43  LWDIMGDRQRL--SEEHPLQVARCTKIIKPEASEDNTGEEDEE-----DSKYIINLKQIA 95
           L  I  +R+++  + + P  VA   +I+     +   GEEDEE      +  +    +  
Sbjct: 61  LEKIKDNREKIKNNRQLPYLVANVVEIM-----DGGAGEEDEERAAGGKAAVVKTSSRQT 115

Query: 96  KFV--VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDV 153
            F+  VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDV
Sbjct: 116 VFLPMVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDV 172

Query: 154 GGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATF 213
           GG  +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF
Sbjct: 173 GGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATF 232

Query: 214 IRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQR 273
           +++   +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQR
Sbjct: 233 LKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQR 292

Query: 274 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 333
           TMLEL+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +I
Sbjct: 293 TMLELLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQI 352

Query: 334 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 393
           HS+ M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V 
Sbjct: 353 HSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV- 411

Query: 394 NGYKKFSSTSQY 405
              +K  S S Y
Sbjct: 412 -QARKSKSVSFY 422

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  267 bits (683), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEG+++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  267 bits (682), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  267 bits (682), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  267 bits (682), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  267 bits (682), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  266 bits (681), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 198/317 (62%)

Query: 77  TGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 136
           T EE  +D   I+       + V +   V    +E G  V +      +   L    DP 
Sbjct: 105 TLEEIVDDDHAIVTSPTTPDYYVSILSFVDKELLEPGCSVLLHHKTMSVVGVLQDDADPM 164

Query: 137 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 196
           V++M +++ P   YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 165 VSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 224

Query: 197 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 256
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI   
Sbjct: 225 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 284

Query: 257 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 316
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 285 GTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 344

Query: 317 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           + F  PD+  +  I  IH+  M++   +  + +     + +GA+++++CTEAG+ A+R R
Sbjct: 345 ILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRER 404

Query: 377 RKVATEKDFLQAVEKVI 393
           R   T +DF +A E+V+
Sbjct: 405 RMQVTAQDFKEAKERVL 421

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  266 bits (680), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEG+++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  266 bits (679), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (679), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+    I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  266 bits (679), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  266 bits (680), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QAR 451

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  265 bits (677), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  266 bits (680), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  264 bits (675), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  262 bits (669), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 277
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 398 KFSSTSQY 405
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  253 bits (645), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 177/278 (63%), Gaps = 5/278 (1%)

Query: 114 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLS 173
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 174 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 233
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 234 RELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 293
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 294 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRL 352
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 353 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (641), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 180/293 (61%), Gaps = 8/293 (2%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSL 369

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 399
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYTAQVKTDNDVDKF 422

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  252 bits (643), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 180/292 (61%), Gaps = 8/292 (2%)

Query: 114 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLS 173
           M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q  ++RE VELPL  
Sbjct: 160 MSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLTQ 219

Query: 174 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 233
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMV
Sbjct: 220 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMV 279

Query: 234 RELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 293
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 280 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVKV 339

Query: 294 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRL 352
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S +
Sbjct: 340 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 397

Query: 353 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 399
             N   +GA + ++  EAG+ A+R  R V  + D  +A +   K  N   KF
Sbjct: 398 IRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (640), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  251 bits (640), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 366
           RPGR+DRK+EF SL D   R  IF   +  MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 367 EAGMFAIRARRKVATEKDFLQA 388
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  250 bits (638), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S++++   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 366
           RPGR+DRK+EF SL D   R  IF   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 367 EAGMFAIRARRKVATEKDFLQA 388
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (637), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 179/293 (61%), Gaps = 8/293 (2%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 399
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKF 424

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  249 bits (637), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  249 bits (637), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 172/263 (65%), Gaps = 5/263 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 272

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVC 365
           RPGR+DRK+EF SL D   R  IF   +  MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLIVRNDSLSGAIIAAIM 390

Query: 366 TEAGMFAIRARRKVATEKDFLQA 388
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  249 bits (636), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 171/263 (65%), Gaps = 5/263 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     I+
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVC 365
           RPGR+DRK+EF SL D   R  IF   +  MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 366 TEAGMFAIRARRKVATEKDFLQA 388
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (636), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  249 bits (636), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 372

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  250 bits (639), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 170/259 (65%), Gaps = 3/259 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 366
           RPGR+DRK+EF SL D   R  IF   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 367 EAGMFAIRARRKVATEKDF 385
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  249 bits (635), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSL 368

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 369 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  248 bits (634), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 187/309 (60%), Gaps = 5/309 (1%)

Query: 83  EDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTV 142
           ++S  I++      +VV +   +    ++  M V + R    +   LPP  D S+ +M  
Sbjct: 108 DNSTGIVSSTTGMNYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGE 167

Query: 143 EEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCA 202
            EKPDVTY+DVGG   Q  ++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  
Sbjct: 168 NEKPDVTYADVGGLDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLV 227

Query: 203 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX 262
           +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     IIF DE+         
Sbjct: 228 KAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFD 287

Query: 263 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SL 321
                  EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL
Sbjct: 288 AQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSL 347

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRARRKV 379
            D   R  IF   +  M++      +L S +  N   +GA + ++  EAG+ A+R  R V
Sbjct: 348 RDRRERRLIFGTVAAKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYV 405

Query: 380 ATEKDFLQA 388
             + D  +A
Sbjct: 406 ILQSDLEEA 414

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  248 bits (633), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  248 bits (632), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 366
           RPGR+DRK+EF SL D   R  IF   +  MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 367 EAGMFAIRARRKVATEKDFLQA 388
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  240 bits (613), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 113 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 172
            M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q  ++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 173 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 232
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 233 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 292
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 293 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 351
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSL 369

Query: 352 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 388
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  238 bits (608), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M+  EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 309 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 366
           RPGR+DRK+EF SL D   R  IF   +  M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 367 EAGMFAIRARRKVATEKDFLQA 388
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  207 bits (526), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  181 bits (458), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 137/241 (56%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 374 R 374
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  206 bits (525), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 374 R----ARRKVATEK 383
           +    A+R++  +K
Sbjct: 710 KDSIEAQRQLEAKK 723

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  202 bits (515), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  178 bits (452), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 141/250 (56%), Gaps = 1/250 (0%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 374 RARRKVATEK 383
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  205 bits (522), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           D+ Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  178 bits (452), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 374 R 374
           +
Sbjct: 715 K 715

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG     ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 374 R----ARRKVATEKD 384
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  205 bits (521), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  185 bits (470), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 140/241 (58%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E  D+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD  GR +I     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  204 bits (520), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 144/254 (56%), Gaps = 4/254 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 374 R----ARRKVATEK 383
           +    A+R+   E+
Sbjct: 710 KDSIEAQRRALAEQ 723

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  204 bits (520), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  180 bits (456), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  204 bits (519), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  181 bits (458), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%), Gaps = 2/241 (0%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 374 R 374
           +
Sbjct: 709 K 709

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  204 bits (519), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  185 bits (470), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 141/250 (56%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 374 RARRKVATEK 383
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  204 bits (518), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  185 bits (469), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT++D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD E R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 374 R 374
           +
Sbjct: 707 K 707

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  204 bits (518), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  D+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 374 R----ARRKVATEKD 384
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  203 bits (516), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  180 bits (457), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 3/241 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 374 R 374
           +
Sbjct: 699 K 699

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  203 bits (517), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  181 bits (460), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I  IH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  185 bits (470), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 374 R----ARRKVATEK 383
           R    A+++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 374 R----ARRKVATEKD 384
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQREAEKE 724

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  202 bits (515), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 137/241 (56%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 374 R 374
           +
Sbjct: 710 K 710

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  202 bits (515), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 374 R----ARRKVATEKD 384
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  202 bits (515), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I  IH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  183 bits (464), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 374 R 374
           R
Sbjct: 711 R 711

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  202 bits (514), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 147/259 (56%), Gaps = 10/259 (3%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +V+++DVGG +E  ++LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R  I +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 374 R----------ARRKVATE 382
           +          A+++V TE
Sbjct: 710 KDSIEAHRQAEAKKEVKTE 728

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  201 bits (512), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  181 bits (458), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 145/254 (57%), Gaps = 3/254 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG ++  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 374 RAR---RKVATEKD 384
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  201 bits (512), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 207 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 266
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 267 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 326 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  + RIH+K+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  181 bits (458), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 134 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 193
           +PS    TV E  +VT+ D+GG  E   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 194 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 253
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 254 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 313
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 314 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           D+ +   LPD  GR +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 374 R 374
           +
Sbjct: 707 K 707

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  194 bits (494), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 158/279 (56%), Gaps = 25/279 (8%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 373
           PDL+ RA I +IH+K  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 374 -RARRKVATE--------KDFLQAVEKVINGYKKFSSTS 403
            R+  K+  +         DF+ A+EK++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 25/269 (9%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+ ++  +IFFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 373
           PD+ GR  I +IH+K+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 374 -RARRKVATE--------KDFLQAVEKVI 393
            R+  K+A +        KDF+ A++K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  192 bits (487), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 151/269 (56%), Gaps = 25/269 (9%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++++ DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                +    TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR------ 374
           PD + RA I +IH+K+        + E + ++     GA+LR++CTEA +F I+      
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 375 ----------ARRKVATEKDFLQAVEKVI 393
                      R    T  DF+ A++K++
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIV 612

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  190 bits (483), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 156/267 (58%), Gaps = 15/267 (5%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA 380
           P+LE RA I RIH+KS        + + ++ L     GA+LR++CTEA + +I  +RK  
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSI--QRKYP 606

Query: 381 TEKDFLQAVEK-VINGYKKFSSTSQYM 406
                 Q+ EK V++  +  +ST  +M
Sbjct: 607 Q---IYQSDEKLVVDPSQVKTSTGDFM 630

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  179 bits (453), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 107/156 (68%)

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
           LPP  D S+++M   EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 284
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  190 bits (483), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 372
           PDL  R+ I  IH+K        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 373 IRARRKV------------------ATEKDFLQAVEKVI 393
           I  +RKV                     +DF+ A+EK++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  190 bits (482), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 154/270 (57%), Gaps = 27/270 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 322 PDLEGRANIFRIHSKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--- 376
           PD++ RA I  IH++  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 377 -------------RKVATEKDFLQAVEKVI 393
                        +   +  DF+ A+EK++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  189 bits (481), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 157/279 (56%), Gaps = 25/279 (8%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++++ DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                +    TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 373
           PD + R+ I +IH+K  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 374 -RARRKV--------ATEKDFLQAVEKVINGYKKFSSTS 403
            R+  K+         T  DF+ A+EK++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  189 bits (481), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 153/269 (56%), Gaps = 25/269 (9%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 373
           PDLE R  I  IH+K  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 374 -RARRKVATE--------KDFLQAVEKVI 393
            R+ +K+  +         DF+ A+EK+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  189 bits (481), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 156/271 (57%), Gaps = 29/271 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ ++DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 207 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXX 260
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 261 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 320
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 321 LPDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 373
           LPD + RA I  IH+K         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 374 -----------RARRKVATEKDFLQAVEKVI 393
                      +++ KV T KDF+ A++K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  189 bits (480), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 107/270 (39%), Positives = 158/270 (58%), Gaps = 27/270 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           D+ + +VGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 207 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXX 260
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 261 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 320
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 321 LPDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 373
           LPD++ R+ I  IH+K  +     +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 374 --RARRKVATEK--------DFLQAVEKVI 393
             ++ +K+  +         DF+ A+EK++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  189 bits (480), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 373
           PDL+ R  I  IH+K  +    I  + IS+L   +    GA+LR++CTEA + +I     
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 374 ---RARRKVATE--------KDFLQAVEKVI 393
              ++  K+  +        +DF+ A+EK++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  186 bits (472), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V++ DV GC E   ++ E V   L  PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR++FE AR     IIF DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 326 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
               T K F QA+E+VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  186 bits (473), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 326 GRANIFRIHSKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
            +    K F QA+E+VI G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  188 bits (477), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 150/268 (55%), Gaps = 25/268 (9%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRAR---- 376
           PD+  RA I  IH++         + E ++ L     GA+LR++CTEA + +I+ R    
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQY 602

Query: 377 ---RKVATE---------KDFLQAVEKV 392
               +V  +         KDF+ A+EK+
Sbjct: 603 IKVSQVGNKPKGKCQVKAKDFMIAMEKI 630

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  186 bits (471), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 147/263 (55%), Gaps = 11/263 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L  P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 326 GRANIFRIHSKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARR 377
           GR  I+++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 378 KVATEKDFLQAVEKVINGYKKFS 400
                 +F QA+E+VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  187 bits (476), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 151/269 (56%), Gaps = 27/269 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                ++   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 377
           PD   RA I  IH+K  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 378 --------------KVATEKDFLQAVEKV 392
                         KV T KDF+ A++K+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  185 bits (470), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 148/261 (56%), Gaps = 9/261 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V++ DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX--XX 265
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 326 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
           GR  I+ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 380 ATEKDFLQAVEKVINGYKKFS 400
            T   F QA+E+VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  186 bits (473), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 98/236 (41%), Positives = 141/236 (59%), Gaps = 9/236 (3%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++++ +VGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 322 PDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           PDL+ R+ I +IH+K        +  E ++ L     GA+LR++CTEA + +I+ +
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRK 619

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  184 bits (467), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E   ++ E V+  L +PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX--XXXXXXXXXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 326 GRANIFRIHSKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
                 + F QA+E+VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (472), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    ID+L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 207 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  IIFFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 372
           P LE R+ I  IH+K        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 373 IRARRKV------------------ATEKDFLQAVEKVI 393
           I  +RK+                     +DF+ A+EK++
Sbjct: 640 I--QRKLPQIYQSDIKLHIDPSTVNVKARDFMLALEKIV 676

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  184 bits (466), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 102/262 (38%), Positives = 146/262 (55%), Gaps = 6/262 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           + PS       E P V +SD+GG  E   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD + R  I R  +   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 372 AIRARRKVATEKDFLQAVEKVI 393
           +I     V TEK   +  EK +
Sbjct: 727 SI--MENVETEKVSTEHFEKAL 746

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           VTY+ VGG   +I+ L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            T+A  + + G  +V KY+GE    +R++F  A   +  I+F DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 268 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 327
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 328 ANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 374
            +I     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  185 bits (470), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 152/271 (56%), Gaps = 29/271 (10%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 373
           PD   R  I +IH+K  S    +  ELI RL   +    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSP--PLSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 374 ---RARRKV--------ATEKDFLQAVEKVI 393
              R+  K+            DF +A+EK++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  185 bits (470), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 374
           PD++ R+ I +I ++  S    I + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQ 645

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  184 bits (467), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H   + +  GI ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  184 bits (466), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 149/264 (56%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ DV GC E   ++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 326 GRANIFRIHSKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR +I+ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
            K    + F QA+E+VI G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  +IFFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 374
           PD++ R+ I +I +K  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  183 bits (465), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 140 MTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKT 199
              E    + ++DV GC E  +++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 200 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXX 259
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 260 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 318
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 319 FSLPDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 375
             LP+LEGR  IF +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 376 RRKVATEKDFLQAVEKVINGYKKFS 400
                    F +A+E+VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  183 bits (464), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 384 DFLQAVEKVINGYKKFS 400
            F QAVE+VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  183 bits (464), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           VT+ DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  182 bits (461), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 143/261 (54%), Gaps = 7/261 (2%)

Query: 118 VDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLS 173
           +DRSK  + L         I PS       E P V +SD+GG  +   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 174 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 233
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 234 RELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 293
           RE+F  AR     IIFFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 294 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRL 352
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  +   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 353 CPNSTGAELRSVCTEAGMFAI 373
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  172 bits (437), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 136/230 (59%), Gaps = 8/230 (3%)

Query: 150 YSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 209
           Y+DVGG K +ID L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 210 DATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN 269
           +A  + + G  +V KY+GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 270 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 328
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 329 NIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 374
           +I +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  181 bits (460), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 146/263 (55%), Gaps = 11/263 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 326 GRANIFRIHSKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRARR 377
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 378 KVATEKDFLQAVEKVINGYKKFS 400
                + F QA+E+VI G +K S
Sbjct: 536 AFVEFRHFEQAIERVIAGLEKKS 558

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  181 bits (459), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 326 GRANIFRIHSKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRARR 377
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 378 KVATEKDFLQAVEKVINGYKKFS 400
                K F QA+E+VI G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  182 bits (461), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 327 RANIFRIHSKSMSVERGI--RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
           R  IF++H   +++   I      ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 513 RKEIFKVHLSKITLAEDIVDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLEH 572

Query: 385 FLQAVEKVINGYKKFS 400
           F  A+E+VI G ++ S
Sbjct: 573 FEHAIERVIGGVERKS 588

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  182 bits (461), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 384 DFLQAVEKVINGYKKFS 400
           +F QA+E+VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  182 bits (461), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           VT+ DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF++H   + +  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  181 bits (460), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +  + PD E R  I R  +K   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 372 AI 373
           AI
Sbjct: 727 AI 728

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 131/232 (56%), Gaps = 8/232 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +TY  VGG  +++D L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 327 RANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 374
           R +I       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  182 bits (463), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 138/234 (58%), Gaps = 9/234 (3%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           +V + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 322 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 374
           PD++ R  I +I ++  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  181 bits (459), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 326 GRANIFRIHSKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H K +++E  +             ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
               T + F QA+E+VI G +K S
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEKKS 566

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 140/236 (59%), Gaps = 13/236 (5%)

Query: 147 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 206
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 207 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 261
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 262 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 374
           PD++ R  I +I +K  +    +  E I++L        GA+LRS+CTEA + +I+
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQ 651

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  180 bits (457), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG  E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD E R  I    +K   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 372 AI--RARRKVATEKDFLQAVEKVING--------YKKFSSTS 403
           AI    + K      F +A+E +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  163 bits (413), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 130/230 (56%), Gaps = 8/230 (3%)

Query: 150 YSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 209
           Y  VGG  ++I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN +
Sbjct: 236 YEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVANTS 295

Query: 210 DATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN 269
           +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI                
Sbjct: 296 NAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDDSG 352

Query: 270 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 328
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R 
Sbjct: 353 EVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEARL 412

Query: 329 NIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 374
           +I      +MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 413 DILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQ 462

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  180 bits (456), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + ++DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 384 DFLQAVEKVINGYKKFS 400
            F  A+E+VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  180 bits (456), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  180 bits (456), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  179 bits (455), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 384 DFLQAVEKVINGYKK 398
            F QA+E+VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  179 bits (453), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 167/312 (53%), Gaps = 26/312 (8%)

Query: 106 SPTDIEEGMRVGV-DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLR 164
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG ++   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 165 EVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 224
           E+++LPL + + FAALGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 225 YVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 284
           YVGE  R +RE+F  AR     IIFFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 285 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGI 344
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  +K+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 345 RWELISRLCPNS---TGAELRSVCTEAGMFAIR--ARRKVATEKDF---LQAVEKVING- 395
             EL++ L   +   +GAE+  +C EAG+ AI      K      F   LQ + K I   
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAIMDDIHTKKVDANHFEVALQGISKCITPE 755

Query: 396 ----YKKFSSTS 403
               Y++F+S S
Sbjct: 756 MLEYYQEFASRS 767

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y  VGG K +ID L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            ++A  + + G  +V KY+GE    +RE+F  A+  +  IIF DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 327 RANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 374
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  179 bits (453), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V++ +V GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 326 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
                   F QA+E+VI G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  179 bits (454), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H + + +  G   +L +RL    P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  179 bits (453), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R  +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  179 bits (453), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 327 RANIFRIHSKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H K + +   I ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  178 bits (452), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 146/267 (54%), Gaps = 6/267 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD+  R  I +  +K  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 372 AIRARRKVATEKDFLQAVEKVINGYKK 398
           AI     VA  K  L+  EK   G  +
Sbjct: 735 AIMEDLDVA--KVELRHFEKAFKGIAR 759

 Score =  167 bits (423), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG  ++I+ L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 327 RANIFRIHSKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           R +I       MS +R +      + I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTIQ 470

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  178 bits (451), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 144/264 (54%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE  R     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 326 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
                   F QA+E+VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  179 bits (453), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV G  E  +++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  178 bits (451), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 159/304 (52%), Gaps = 10/304 (3%)

Query: 110 IEEGMRVGVDRSKYHIELPLPPR----IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLRE 165
           I+ G+   +DR K  + L         I PS       E P V +SD+GG +E   K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 166 VVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 225
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 226 VGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 285
           VGE  R +RE+F  AR     IIFFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 286 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGI 344
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  +K   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 345 RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQ 404
             E ++      +GAE+  +C EAG+ AI     + T K   +  EK ++G  K   T +
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAI--MEDLETSKVEARHFEKALSGISK-GITQE 760

Query: 405 YMQY 408
            + Y
Sbjct: 761 MLAY 764

 Score =  159 bits (402), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 141/249 (56%), Gaps = 8/249 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + Y+ VGG  ++I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            T+A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 327 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 382
           R +I       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 383 KDFLQAVEK 391
           ++ L+ + K
Sbjct: 476 REKLKVILK 484

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE ART    IIF DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 326 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR +I+ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
            +    + F QA+E+VI G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
             +  F  V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 326 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 380 ATEKDFLQAVEKVINGYKK 398
            T   F QA+E+VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 166/311 (53%), Gaps = 19/311 (6%)

Query: 110 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKL 163
           I+ G++   D S   +++ +         I PS       E P V +SD+GG +E   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 164 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 223
           +E+++LPL + + F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 224 KYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 283
           KYVGE  R +RE+F  AR+    IIFFDEI                     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEIDALSPDRDGGSSSS--AASHVLTSLLNEID 641

Query: 284 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERG 343
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  I + ++K+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 344 -IRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--RKVATEKDFLQAVEKVING----- 395
            I  E ++R     +GAE+  +C EAG+ AI         T + F +A++ +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 396 ---YKKFSSTS 403
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  167 bits (423), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 138/239 (57%), Gaps = 6/239 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V+Y+ VG   ++I+ LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            +DA  + + G  +V KY+G+    +R++F  A+  +  IIF DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 268 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 327
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 328 ANIFRIHSKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 382
            +I       MS +R  +  E I  +   +    GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 153/294 (52%), Gaps = 25/294 (8%)

Query: 117 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPER 176
           GV +SK H              +   E    VT+ DV GC+E   ++ E V+  L +P +
Sbjct: 293 GVGKSKAH--------------LFNKETDVKVTFKDVAGCQEAKQEIMEFVDF-LKNPHK 337

Query: 177 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 236
           +  LG   P+G +L GPPGTGKTL A+AVA      F+ V GSE V+ +VG GA  VR+L
Sbjct: 338 YTELGAKIPRGAILSGPPGTGKTLLAKAVAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL 397

Query: 237 FEMARTRKACIIFFDEIXXXXXXXXXXXXX--XXNEVQRTMLELITQLDGFDPRGNIKVM 294
           FE A      IIF DEI                 +E + T+ +L+ ++DGF     + V+
Sbjct: 398 FEQASKMAPSIIFVDEIDAIGKARGKNGSLGGSNDEREATLNQLLVEMDGFSTSDQVVVL 457

Query: 295 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSV--------ERGIRW 346
             TNRP+ LD ALLRPGR DR V+   PD+EGR  I+ +H K +++        ++ +  
Sbjct: 458 AGTNRPDVLDKALLRPGRFDRHVQIDAPDVEGRKLIYLVHLKKLNLDPLYSEDKQKQLLA 517

Query: 347 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFS 400
             ++ L P  TGA++ + C E+ + A R          F +A+E+VI G +K S
Sbjct: 518 GKLAALTPGFTGADIANACNESALIAARKMDPYVQFTHFEEAIERVIAGLEKKS 571

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  177 bits (450), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 143/245 (58%), Gaps = 8/245 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V Y+ VGG K++   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            TDA  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 327 RANIFRIHSKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 382
           R +I R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 383 KDFLQ 387
           +D L+
Sbjct: 504 RDDLK 508

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 135/242 (55%), Gaps = 3/242 (1%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V + D+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    P  + R  I +  +K  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 372 AI 373
           AI
Sbjct: 759 AI 760

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  177 bits (450), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF++H K +++  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  177 bits (449), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 327 RANIFRIHSKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
           R  IF++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 385 FLQAVEKVINGYKKFS 400
           F QA+E+VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  176 bits (446), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  176 bits (445), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ DV GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 326 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
            K      F QA+E+VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  176 bits (445), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 137/242 (56%), Gaps = 3/242 (1%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG +E   K++E+++LPL +   FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +  + PD + R  I +  +K   +E   I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 372 AI 373
           AI
Sbjct: 733 AI 734

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +TY  +GG +++++ L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 327 RANIFRIHSKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 382
           R +I   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 383 KDFLQAVEKV 392
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  176 bits (445), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 143/266 (53%), Gaps = 6/266 (2%)

Query: 139 MMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGK 198
           M   +    V ++ V GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 199 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXX 258
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 259 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 317
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 318 EFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 374
               P+L GR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 375 ARRKVATEKDFLQAVEKVINGYKKFS 400
                     F QAVE+VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  176 bits (445), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 142/264 (53%), Gaps = 12/264 (4%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           + + DV GC+E   ++ E V   L SP+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX- 266
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 267 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 326 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 376
           GR  I+ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 377 RKVATEKDFLQAVEKVINGYKKFS 400
                   F QA+E+VI G +K S
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEKKS 565

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  175 bits (444), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 326 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 380 ATEKDFLQAVEKVINGYKK 398
            T   F QA+E+VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  175 bits (443), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  175 bits (443), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 326 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 380 ATEKDFLQAVEKVINGYKK 398
            T   F QA+E+VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  174 bits (442), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF+ AR R   IIF DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 385 FLQAVEKVINGYKK 398
           F  A +K + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  175 bits (443), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 171/329 (51%), Gaps = 24/329 (7%)

Query: 63  RCTKIIKPEASEDN-----TGEEDEEDSKYIIN------LKQIAKFVVGLGERVSPTDIE 111
           + T     ++SEDN     T   DE   K   N      L  + +F+    E +S     
Sbjct: 440 KSTPTTATDSSEDNMEIDETANGDESSLKNTANMIDPLPLSVVQQFIRNYPEPLS----- 494

Query: 112 EGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPL 171
            G ++ +   KY   L   P I P+         PDVT+++VG  +    +L   +  P+
Sbjct: 495 -GEQLSLLSIKYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPI 553

Query: 172 LSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 231
             PE +  +GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R
Sbjct: 554 KRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESER 613

Query: 232 MVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNI 291
            +R++F  AR    C+IFFDE+               + V  T+L   T+LDG + R  I
Sbjct: 614 SIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGI 670

Query: 292 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERGIRWELI 349
            V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +   + +E I
Sbjct: 671 FVIGATNRPDMIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEI 730

Query: 350 SR--LCPNSTGAELRSVCTEAGMFAIRAR 376
            R   C N +GA+L ++  E+ + A++ +
Sbjct: 731 IRNEKCNNFSGADLAALVRESSVLALKRK 759

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 145/266 (54%), Gaps = 6/266 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG +E   K++E+++LPL + E F+ LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD+  R  I +  +K  +  E G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADRTEGYSGAEVVLLCQEAGLA 734

Query: 372 AIRARRKVATE--KDFLQAVEKVING 395
           AI     V     + F +A E +  G
Sbjct: 735 AIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  170 bits (431), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 138/234 (58%), Gaps = 12/234 (5%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG  ++I+ L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 327 RANIFRIHSKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           R +I       MS ER      GI+   I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTIQ 470

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 146/271 (53%), Gaps = 10/271 (3%)

Query: 110 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKL 163
           I+ G+ +  D  K+ + + L         I PS       E P V +SD+GG  E   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 164 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 223
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 224 KYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 283
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 284 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-R 342
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  I +  +K  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 343 GIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           G+  + ++      +GAE+  +C EAG+ AI
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAI 733

 Score =  169 bits (427), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 151/283 (53%), Gaps = 16/283 (5%)

Query: 105 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 156
           VS  D+      G    +Y++  P   R   +    T E +          ++Y+ VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 157 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 216
            ++I+ L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 217 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 275
            G  +V KY+GE    +RE+F  AR  +  IIF DEI                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 276 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHS 335
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R +I     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 336 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 374
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  174 bits (441), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ VRELF  AR+R   I+F DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  174 bits (441), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 265
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 266 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 325
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 326 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 379
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 380 ATEKDFLQAVEKVINGYKK 398
            T   F QA+E+VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  174 bits (441), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 139/255 (54%), Gaps = 6/255 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     +IF DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R  IF +H K + +   I ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 384 DFLQAVEKVINGYKK 398
            F QA+E+VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (440), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 147/267 (55%), Gaps = 6/267 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG ++   K++E+++LPL + E F  LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD+  R  I +  +K  ++E  GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 372 AIRARRKVATEKDFLQAVEKVINGYKK 398
           AI     V   K  L+  EK   G  +
Sbjct: 735 AIMEDLDVT--KVELRHFEKAFKGISR 759

 Score =  166 bits (421), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG +++I+ L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 327 RANIFRIHSKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           R +I       MS +R        +LI+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTIQ 470

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  174 bits (441), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 268 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 327 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 383
           R +IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 384 DFLQAVEKVINGYKKFS 400
            F QA+E+VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  174 bits (441), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 171/332 (51%), Gaps = 19/332 (5%)

Query: 53  LSEEHPLQVARCTKIIKPEASEDNTGEEDEEDSKYIIN------LKQIAKFVVGLGERVS 106
            S E  + + +    +  E  + N    +E+  K   N      L  I KF+    E   
Sbjct: 452 FSSEDQMDIDQNESPVPTETGQQNDSLINEQSLKNTANMIDPLPLSIIQKFIQNFPE--- 508

Query: 107 PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREV 166
           P + E+  ++ +   KY   L   P I P+         PDVT+++VG   +   +L   
Sbjct: 509 PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALGKVRVELNMA 565

Query: 167 VELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV 226
           +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYV
Sbjct: 566 IVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYV 625

Query: 227 GEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFD 286
           GE  R +R++F  AR    C+IFFDE+               + V  T+L   T+LDG +
Sbjct: 626 GESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLN 682

Query: 287 PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERGI 344
            R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I    S+S    +  G+
Sbjct: 683 DRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDIITTVSRSSGTPLAEGV 742

Query: 345 RWELI--SRLCPNSTGAELRSVCTEAGMFAIR 374
            +  I     C N +GA+L ++  E+ + A++
Sbjct: 743 DFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P    + +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 266 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  173 bits (439), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 151/278 (54%), Gaps = 8/278 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           + PS       E P V +SD+GG +E   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 370
           +DR +  + PD   R  I    S   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 371 FAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQY 408
            AI     + T++   +  EK ++G  +   T + ++Y
Sbjct: 732 AAI--MENLDTKRVEARHFEKALSGISR-GITPEMLEY 766

 Score =  155 bits (391), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 128/229 (55%), Gaps = 6/229 (2%)

Query: 150 YSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 209
           YS VGG  ++ID L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 210 DATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN 269
           +A  + + G  +V K++GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 270 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 329
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 330 IFRIHSKSMSVERGIRWELISRLCPNST----GAELRSVCTEAGMFAIR 374
           I +     M+ +     +   R   + T    GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLSDDDIRNIASRTHGYVGADLIALCRESVMKAIQ 469

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  173 bits (439), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 161/313 (51%), Gaps = 22/313 (7%)

Query: 75  DNTGEEDEEDSKYIIN---------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 125
           D   E  +ED K + N         L  I KF+    E   P + E+   + +   +Y  
Sbjct: 437 DQDTENKDEDEKSLKNTANMIDPLPLTIIQKFIQNFPE---PLNDEQLSNLSI---QYED 490

Query: 126 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPP 185
            L   P I P+         PDVT++ VG   +   +L   +  P+  PE +  +GI  P
Sbjct: 491 FLKALPTIQPTAKREGFATVPDVTWASVGALTKVRVELNMAIVQPIKKPELYEKVGISAP 550

Query: 186 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKA 245
            G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    
Sbjct: 551 AGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVP 610

Query: 246 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 305
           C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DP
Sbjct: 611 CVIFFDELDALVPRRDSTLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDP 667

Query: 306 ALLRPGRIDRKVEFSLPDLEGRANIF----RIHSKSMSVERGIRWELISRLCPNSTGAEL 361
           A+LRPGR+D+ +   LP+ E + +I     R +   MS +  +   +    C N +GA++
Sbjct: 668 AMLRPGRLDKTLFIELPNAEEKLDILKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADI 727

Query: 362 RSVCTEAGMFAIR 374
            S+  E+ + A++
Sbjct: 728 ASLVRESSVLALK 740

 Score =  142 bits (357), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P      +GG ++ + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  173 bits (438), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRWELI--SRLCPNST 357
            +DPA+LRPGR+D+ +   LPDL  + +I +  I S    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 358 GAELRSVCTEAGMFAIR 374
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  147 bits (371), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P    S +GG  + + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 266 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  + ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  173 bits (438), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT+S+VG   +   +L   +  P+  PE +  +G
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQPIKRPELYEKVG 557

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 558 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 617

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 618 ASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 674

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 357
            +DPA+LRPGR+D+ +   LP+ + + +I +   KS    +S +  I+  +    C N +
Sbjct: 675 MIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNFS 734

Query: 358 GAELRSVCTEAGMFAIR 374
           GA+L ++  E+ + A++
Sbjct: 735 GADLAALVRESSVLALK 751

 Score =  152 bits (383), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P    + +GG  + I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 266 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  172 bits (436), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  172 bits (435), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 385 FLQ-AVEKVINGYKK 398
            L+ A +K++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 164/310 (52%), Gaps = 19/310 (6%)

Query: 75  DNTGEEDEEDSKYIIN------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELP 128
           D    EDE + K   N      L  + +F+    E +S        ++ +   KY   L 
Sbjct: 457 DEAANEDESNLKNTANMIDPLPLSVVQQFIHNYPEPLSDD------QLSLLSIKYEDFLK 510

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
             P I P+         PDVT+++VG  +    +L   +  P+  PE +  +GI  P G+
Sbjct: 511 ALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVGISAPGGV 570

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+I
Sbjct: 571 LLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVI 630

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+L
Sbjct: 631 FFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAML 687

Query: 309 RPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERGIRWELI--SRLCPNSTGAELRSV 364
           RPGR+D+ +   LP++E + +I +  +KS    +   + +E I  +  C N +GA+L ++
Sbjct: 688 RPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFSGADLAAL 747

Query: 365 CTEAGMFAIR 374
             E+ + A++
Sbjct: 748 VRESSVLALK 757

 Score =  147 bits (370), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I R  S  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  172 bits (437), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/273 (35%), Positives = 150/273 (54%), Gaps = 15/273 (5%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 357
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +S +      + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 358 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVE 390
           GA+L ++  E+ + A++        ++F Q+ E
Sbjct: 741 GADLAALVRESSVLALK--------RNFFQSEE 765

 Score =  144 bits (363), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  172 bits (435), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR     IIF DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 385 FLQ-AVEKVINGYKK 398
            L+ A +K++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  172 bits (435), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   I+F DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GR++I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 357
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +S +      + +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 358 GAELRSVCTEAGMFAIR 374
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 131/232 (56%), Gaps = 6/232 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P+ +   +GG  + I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 266 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 373
           P+   R +I +  S  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (433), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR024W (YME1)
          Length = 732

 Score =  171 bits (432), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 260 KTNVKFEDVRGCDEARAELEEIVDF-LKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARA 318

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 319 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 378

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 379 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 435

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 436 RGRADILQHHMRKVTLAPDVDPSIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTH 495

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 496 FEWAKDKILMGAER 509

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT+S VG   +   +L   +  P+  PE +  +G
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVG 544

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 545 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRAR 604

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 605 ASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 661

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRWELI--SRLCPNST 357
            +DPA+LRPGR+D+ +   LP+ E + +I R  I S    +   +    I     C N +
Sbjct: 662 MIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFS 721

Query: 358 GAELRSVCTEAGMFAIR 374
           GA++ ++  E+ + A++
Sbjct: 722 GADIAALVRESSVLALK 738

 Score =  145 bits (365), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P    S +GG  + I +L E++ LP+L PE ++A G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 266 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R  I +  + S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  171 bits (432), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 149/277 (53%), Gaps = 6/277 (2%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG  +   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIR-WELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD + R  I    +K+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 372 AIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQY 408
           AI     + TE    +  EK ++G  +    ++ +QY
Sbjct: 729 AI--MENLETENVEQRHFEKALSGISR-GINAEMLQY 762

 Score =  159 bits (403), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 132/228 (57%), Gaps = 8/228 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG  ++I+ L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 327 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 370
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVM 461

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  171 bits (433), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 164/306 (53%), Gaps = 19/306 (6%)

Query: 82  EEDSKYIINLKQIAKFVVGLGERV---------SPTDIEEGMRVGVDRSKYHIELPLPPR 132
           ++DS   INLK  A  +  L   V          P + ++  ++ +   KY   L   P 
Sbjct: 457 QKDSDSEINLKNTANMIDPLPLSVIQRFIHNYPDPLNDDQLNQLTI---KYEDFLKALPT 513

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I P+         PDVT+S+VG  ++   +L   +  P+  PE +  +GI  P G+LL+G
Sbjct: 514 IQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVGISAPGGVLLWG 573

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE
Sbjct: 574 PPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDE 633

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           +               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR
Sbjct: 634 LDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRPDMIDPAMLRPGR 690

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNSTGAELRSVCTEA 368
           +D+ +   LP+ + + +I R  + S    +S +  ++  +    C N +GA+L ++  E+
Sbjct: 691 LDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFSGADLAALVRES 750

Query: 369 GMFAIR 374
            + A++
Sbjct: 751 SVLALK 756

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 266 XXXNEVQRTMLELITQLDGF---DPRGN-IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D     +  G  + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  +  + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  170 bits (431), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 134/242 (55%), Gaps = 3/242 (1%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           I PS       E P V +SD+GG ++   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 371
           +DR +    PD E R  I R  +K    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 372 AI 373
           AI
Sbjct: 729 AI 730

 Score =  160 bits (404), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 134/228 (58%), Gaps = 8/228 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG +++I+ L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
             +A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 327 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 370
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVM 461

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  170 bits (430), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F  + GSE  + YVG GA+ +RELF  AR R   I+F DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GR +I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 385 FLQAVEKVINGYKK 398
           F  A +K++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.23
           YLL034C
          Length = 806

 Score =  171 bits (432), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 162/314 (51%), Gaps = 27/314 (8%)

Query: 75  DNTGEEDEEDSKYIIN------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELP 128
           D TG  DE+  K   N      L  I KF+    E   P + E+   + +   KY   L 
Sbjct: 437 DQTGILDEKAMKNTANIIDPIPLSTIQKFIKNFPE---PLNDEQLQHLTI---KYEDFLK 490

Query: 129 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 188
             P I P+         PDVT+++VG   +   +L   +  P+  PE +  +GI  P G+
Sbjct: 491 ALPTIQPTAKREGFATVPDVTWANVGALSKIRIELNMAIVQPIKRPELYEKVGISAPAGV 550

Query: 189 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 248
           LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+I
Sbjct: 551 LLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVI 610

Query: 249 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 308
           FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+L
Sbjct: 611 FFDELDALVPRRDTTLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAML 667

Query: 309 RPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERG--------IRWELISRLCPNSTGAE 360
           RPGR+D+ +   LP+ + + +I     K++ V  G        +   +    C N +GA+
Sbjct: 668 RPGRLDKTLFIELPNTQEKLDII----KTLKVSNGTPIADDVDLEKVIADERCRNFSGAD 723

Query: 361 LRSVCTEAGMFAIR 374
           + ++  EA + A++
Sbjct: 724 IAALLREASVLALK 737

 Score =  140 bits (354), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PSTNLESLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI V    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 247 AGELQVPFISVSAPSIVSGMSGESEKKLRDLFDEAKQLAPCLVFFDEIDAITPKRDGGAQ 306

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D    +      + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDEISMQKTDGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 364

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S+ + ++  I +  +++L P   GA+L+++ T +G  AI+
Sbjct: 365 PNEISRIHILKKMSQHLKIDGEIDFIKLAKLTPGFVGADLKALITASGTCAIK 417

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  170 bits (430), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 145 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 204
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 205 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 264
            A      F+ + GSE  + YVG GA+ +R+LF  AR +   IIF DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 265 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 324
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 325 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 384
            GR++I R H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 385 FLQAVEKVINGYKK 398
              A +K++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 122 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 181
           KY   L   P I P+         PDVT++++G       +L   +  P+  PE +  +G
Sbjct: 454 KYEDFLKALPTIQPTAKREGFATVPDVTWNNIGALSNVRLELNMAIVQPIKRPELYEKVG 513

Query: 182 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 241
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 514 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 573

Query: 242 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 301
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 574 ASIPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 630

Query: 302 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRW-ELISRL-CPNST 357
            +DPA+LRPGR+D+ +   LP  E + +I +  + S    V   I + E+I+   C N +
Sbjct: 631 MIDPAMLRPGRLDKTIFIELPTKEEKLDILQTLLRSNGTPVAHDIDFAEIINDFRCQNFS 690

Query: 358 GAELRSVCTEAGMFAIR 374
           GA+L ++  E+ + A++
Sbjct: 691 GADLAALVRESSVSALK 707

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P+     +GG  + + +L E++ LP+L PE F   GIDPP+G+LL+GPPG GKT  A A+
Sbjct: 167 PETNLQSLGGMDDVVAQLMELIGLPILHPEIFETTGIDPPRGVLLHGPPGCGKTSIANAL 226

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI V    +V    GE  + +R+LFE A+    C+IFFDEI            
Sbjct: 227 AGELKVPFISVSAPSVVSGMSGESEKKIRDLFEEAQQIAPCLIFFDEIDAITPKRDGGAQ 286

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D    +      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 287 REME--KRIVAQLLTSMDELTLQKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 344

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 345 PNEVSRLHILKKLSSTLKLDGEIDFLQLAKLTPGFVGADLKALITAAGTCAIK 397

>TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {ON}
           Anc_4.23 YLL034C
          Length = 861

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 165/313 (52%), Gaps = 27/313 (8%)

Query: 76  NTGEEDEEDSKYIIN------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPL 129
           N+ +EDE + K   N      L  I  F+    E   P + ++ + + +   KY   L  
Sbjct: 460 NSTDEDEPNLKNTANIIDPLPLSIIQNFIQKYPE---PLNNDQLLLLSI---KYEDFLKA 513

Query: 130 PPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVEL----PLLSPERFAALGIDPP 185
            P I P+         PDVT+  +G     +DK+R  + L    P+  PE +  +GI  P
Sbjct: 514 LPTIQPTAKREGFATVPDVTWESIGA----LDKIRAELNLAIVQPVKRPELYEKVGISAP 569

Query: 186 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKA 245
            G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    
Sbjct: 570 AGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFSRARASVP 629

Query: 246 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 305
           C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DP
Sbjct: 630 CVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDP 686

Query: 306 ALLRPGRIDRKVEFSLPDLEGRANIF----RIHSKSMSVERGIRWELISRLCPNSTGAEL 361
           A+LRPGR+D+ +   LP+ E + +I     +++   ++ +  +   +    C N +GA++
Sbjct: 687 AMLRPGRLDKTLFIELPNFEEKLDILKTITKVNGTPLASDVDLSIIINDERCRNYSGADI 746

Query: 362 RSVCTEAGMFAIR 374
            S+  E+ + A++
Sbjct: 747 ASLVRESSVLALK 759

 Score =  147 bits (371), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 202 PTSSLSSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 261

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI V    +V    GE  + VRELFE A++   C++FFDEI            
Sbjct: 262 AGELQVPFISVSAPSVVSGMSGESEKKVRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 321

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 322 REME--RRIVAQLLTSMDELSMEKTDGKPVIVIGATNRPDALDAALRRAGRFDREICLNV 379

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P    R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 380 PSEVSRLHILKKMSNNLRIDGHIDFSKLAKLTPGFVGADLKALVTAAGTCAIK 432

>TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON}
           Anc_4.259 YLR397C
          Length = 808

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 147/284 (51%), Gaps = 15/284 (5%)

Query: 133 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 192
           + PS       E P V +SD+GG +E   K++E+++LPL + E F  LG+  PKG+LLYG
Sbjct: 523 VRPSAMREIFLEMPKVYWSDIGGQEELKQKMKEMIQLPLEASETFNKLGVTAPKGVLLYG 582

Query: 193 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 252
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 583 PPGCSKTLTAKALATESGINFFAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 642

Query: 253 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 312
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 643 IDAISSSREGGSGSDVS--NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 700

Query: 313 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS---TGAELRSVCTEAG 369
           +DR +    PD   R  I +  +     E       +  L   +   +GAE+  +C EAG
Sbjct: 701 LDRHLYVGPPDFNARLQIIKKCTIKFGSEIQNDEPFLRELSAKTGGCSGAEVVLLCQEAG 760

Query: 370 MFAIRARRKV--ATEKDFLQAVEKVING--------YKKFSSTS 403
           + AI A  +V    +  F  A+E +  G        Y++F+S S
Sbjct: 761 LSAIMADYQVDKVGKHHFQNALEGLSRGITEDMLGYYQQFASRS 804

 Score =  165 bits (417), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 148 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 207
           ++Y+ VGG  ++I+ L+  +ELPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 269 LSYNLVGGLNKEIEILKNAIELPLHKPKLFSRFGVSPPRGILLHGPPGTGKTMLLRCVAN 328

Query: 208 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 267
            ++A  + + G  +V KY+GE    +R+ F  A+  +  IIF DEI              
Sbjct: 329 NSNAHVLTINGPSIVSKYLGETESSLRDFFNEAKKYQPSIIFIDEI---DSIAPNRSSDD 385

Query: 268 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 326
             EV+ R +  L+T +DG    G + V+ ATNRPN++D AL RPGR D+++E  +PD++G
Sbjct: 386 SGEVESRVVATLLTLMDGMGNSGRVVVVGATNRPNSIDSALRRPGRFDQEIEIGIPDVDG 445

Query: 327 RANIFRIHSKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 374
           R +I       MS ER  +  E I  +   +    GA+L ++C E+ M AI+
Sbjct: 446 RKDILLKQFHKMSSERHSLSDEDIQSIASKTHGYVGADLSALCRESVMKAIQ 497

>NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON}
           Anc_7.215 YER047C
          Length = 870

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 169/316 (53%), Gaps = 21/316 (6%)

Query: 71  EASEDN--TGEEDEEDSKYIIN------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 122
           + +ED+  T EED  D K   N      L  I KF+    +   P + E+  ++ +   K
Sbjct: 484 QVTEDSHSTEEEDPSDLKNTANIIDPLPLSIIQKFIKNFPD---PLNTEQLGQLAI---K 537

Query: 123 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 182
           Y   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +GI
Sbjct: 538 YEDFLKALPTIQPTAKREGFATVPDVTWANVGALGKIRIELNMAIVQPIKRPELYEKVGI 597

Query: 183 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 242
             P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR 
Sbjct: 598 SAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARA 657

Query: 243 RKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 302
              C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ 
Sbjct: 658 SVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDM 714

Query: 303 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS--MSVERGIRWELISR--LCPNSTG 358
           +DPA+LRPGR+D+ +   LP+ + + +I    ++S    +   +++  I +   C N +G
Sbjct: 715 IDPAMLRPGRLDKTLFIELPNYDEKLDIITTLARSNGTPLADDVQFSEIIKDERCRNFSG 774

Query: 359 AELRSVCTEAGMFAIR 374
           A+L ++  E+ + A++
Sbjct: 775 ADLAALVRESSVLALK 790

 Score =  145 bits (367), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 146 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 205
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 219 PTSNLESLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 278

Query: 206 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 265
           A      FI +    +V    GE  + +RELFE A+    C++FFDEI            
Sbjct: 279 AGELKVPFISISAPSVVSGMSGESEKKIRELFEEAKALAPCLMFFDEIDAITPKRDGGAQ 338

Query: 266 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 321
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 339 REME--RRIVAQLLTSMDELTMEQTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 396

Query: 322 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 374
           P+   R +I +  S+++ ++  I +  +++L P   GA+L+S+ T AG  AI+
Sbjct: 397 PNEVSRLHILKKMSQNLKIDGSIDFLKLAKLTPGFVGADLKSLTTAAGTCAIK 449

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,403,536
Number of extensions: 1530965
Number of successful extensions: 6765
Number of sequences better than 10.0: 535
Number of HSP's gapped: 6223
Number of HSP's successfully gapped: 640
Length of query: 409
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 297
Effective length of database: 40,638,807
Effective search space: 12069725679
Effective search space used: 12069725679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)