Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_14.25871.317ON80880840500.0
KLTH0H10736g1.317ON81080729280.0
SAKL0D06974g1.317ON81381323150.0
TDEL0D018601.317ON80981121610.0
Ecym_62881.317ON80679320790.0
AEL166C1.317ON80679620500.0
NCAS0A092201.317ON83180820490.0
KAFR0A017301.317ON82180820050.0
ZYRO0G20724g1.317ON81279519900.0
Kpol_1035.261.317ON83582119820.0
KLLA0F01705g1.317ON78778719180.0
NDAI0G057401.317ON85784619240.0
TBLA0F013301.317ON82780519010.0
KNAG0C058301.317ON83080818320.0
TPHA0O014801.317ON82481318270.0
CAGL0J05236g1.317ON84283317620.0
Suva_6.1381.317ON83082016860.0
YJL062W (LAS21)1.317ON83081816760.0
Skud_10.1591.317ON83182116730.0
Smik_10.1781.317ON83182016680.0
Ecym_55594.28ON10143264946e-51
YLL031C (GPI13)4.28ON10173604902e-50
KAFR0I014104.28ON10164424841e-49
NDAI0H003204.28ON10344204832e-49
ZYRO0B01034g4.28ON10093004742e-48
CAGL0G04015g4.28ON10193394742e-48
KLTH0E06094g4.28ON10163364724e-48
Kwal_55.20667singletonOFF6024014614e-48
KLLA0C17534g4.28ON10053284716e-48
Suva_10.414.28ON10173534707e-48
Kwal_YGOB_55.206644.28ON9564014697e-48
KNAG0J028204.28ON10173374708e-48
Kpol_478.14.28ON10093804672e-47
Smik_12.254.28ON10173364662e-47
Skud_12.364.28ON10163694635e-47
NCAS0C058004.28ON10113324627e-47
TPHA0K021804.28ON10284484628e-47
SAKL0H25542g4.28ON10133314601e-46
TDEL0F016904.28ON10053864573e-46
TPHA0F003104.28ON10263084441e-44
TBLA0A085004.28ON10654444414e-44
AGR126C4.28ON10133274272e-42
AEL113C1.184ON9253341602e-10
Skud_11.601.184ON9193291584e-10
SAKL0C05434g1.184ON10353471568e-10
Suva_11.581.184ON9193291531e-09
Ecym_80941.184ON9263211531e-09
YKL165C (MCD4)1.184ON9193321461e-08
KLLA0B07249g1.184ON9193351452e-08
TBLA0E014804.28ON10403671442e-08
Smik_11.641.184ON9453211442e-08
TDEL0C036901.184ON9203311432e-08
CAGL0M08448g1.184ON9213211414e-08
NDAI0A009801.184ON9253211405e-08
Kwal_33.138561.184ON9223211406e-08
TBLA0C058401.184ON9473221397e-08
KAFR0G005001.184ON9223211389e-08
ZYRO0G18458g1.184ON9213211352e-07
TPHA0A028001.184ON9203211333e-07
KLTH0F04884g1.184ON9223211334e-07
KNAG0C010801.184ON9313161316e-07
NCAS0B082601.184ON9243121272e-06
Kpol_2001.281.184ON9193241236e-06
Kpol_1044.184.28ON10224411156e-05
KLTH0C11286g6.18ON95174790.80
KLLA0A11374g1.444ON62149790.89
TDEL0C00150singletonON52672752.2
Kpol_529.262.1ON156666762.4
TBLA0E028805.574ON56444718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2587
         (808 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...  1564   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...  1132   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   896   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   837   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   805   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   794   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   793   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   776   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   771   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   768   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   743   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   745   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   736   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   710   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   708   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   683   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   654   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   650   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   649   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   647   0.0  
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   194   6e-51
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   193   2e-50
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   191   1e-49
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   190   2e-49
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   187   2e-48
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   187   2e-48
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   186   4e-48
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   182   4e-48
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   186   6e-48
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   185   7e-48
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   185   7e-48
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   185   8e-48
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   184   2e-47
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   184   2e-47
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   182   5e-47
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   182   7e-47
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   182   8e-47
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   181   1e-46
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   180   3e-46
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   175   1e-44
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   174   4e-44
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   169   2e-42
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    66   2e-10
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    65   4e-10
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    65   8e-10
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    64   1e-09
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    64   1e-09
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    61   1e-08
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    60   2e-08
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    60   2e-08
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    60   2e-08
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    60   2e-08
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    59   4e-08
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    59   5e-08
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    59   6e-08
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    58   7e-08
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    58   9e-08
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    57   2e-07
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    56   3e-07
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    56   4e-07
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    55   6e-07
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    54   2e-06
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    52   6e-06
Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {...    49   6e-05
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    35   0.80 
KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {...    35   0.89 
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 33   2.2  
Kpol_529.26 s529 complement(73634..78334) [4701 bp, 1566 aa] {ON...    34   2.4  
TBLA0E02880 Chr5 (718872..720566) [1695 bp, 564 aa] {ON} Anc_5.5...    32   8.3  

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score = 1564 bits (4050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/808 (94%), Positives = 763/808 (94%)

Query: 1   MSKKXXXXXXXXXXXXXTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60
           MSKK             TFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA
Sbjct: 1   MSKKLLILVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60

Query: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180
           VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE
Sbjct: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180

Query: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240
           VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS
Sbjct: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
           VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300

Query: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT 360
           DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT
Sbjct: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT 360

Query: 361 ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLLKPTI 420
           ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLLKPTI
Sbjct: 361 ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLLKPTI 420

Query: 421 SKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXX 480
           SKPA                     EEEHQLWWWLAIALTGASYTQAPSEIKEH      
Sbjct: 421 SKPALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQAPSEIKEHLIILLC 480

Query: 481 XXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLV 540
                GWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLV
Sbjct: 481 LRLIRGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLV 540

Query: 541 STLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTIL 600
           STLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTIL
Sbjct: 541 STLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTIL 600

Query: 601 AVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRR 660
           AVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRR
Sbjct: 601 AVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRR 660

Query: 661 EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAP 720
           EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAP
Sbjct: 661 EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAP 720

Query: 721 SIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFS 780
           SIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFS
Sbjct: 721 SIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFS 780

Query: 781 PKLCYYVSWNIFMNAVIGWLVEATLLVF 808
           PKLCYYVSWNIFMNAVIGWLVEATLLVF
Sbjct: 781 PKLCYYVSWNIFMNAVIGWLVEATLLVF 808

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/807 (65%), Positives = 633/807 (78%), Gaps = 1/807 (0%)

Query: 1   MSKKXXXXXXXXXXXXXTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60
           M+K+             TFSAGFFPQKSVL+GDA+FN++P+  R+++PKF K+VL+++DA
Sbjct: 1   MNKRLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60

Query: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFVFQKDMS F F+H LLN+G AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180
           VAEDD SSNLKEQDSWLRQF ++ K+IKFFGDDTWLKLFP EFFDETDGTNSFFVSDFEE
Sbjct: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180

Query: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240
           VD NVTRHLP+QL +QDSWDVLILH+LGLDHIGHKGGAFS FM PK REMD VIEQ+YN+
Sbjct: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
           VGEDTLICVMGDHGMNDLGNHGGSSAGETSA L+FIS+LLE YEKPLAQ  +  P+ + +
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300

Query: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT 360
            +Y+Y++KVNQID VP+I++LFN P+PKNSIGV++PD L+LLSP DA+ K++DNY QL +
Sbjct: 301 PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS 360

Query: 361 ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITAIATFLLLKPT 419
           ISG       D D I + MR++Q DLAK AT YNY +LG GF +LL ++++A F      
Sbjct: 361 ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYLLLGIGFLTLLVVSSVALFFSWTSF 420

Query: 420 ISKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXX 479
            S                        EEEHQ+WWW +IAL G SY  AP E+ +H     
Sbjct: 421 PSTFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA 480

Query: 480 XXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539
                 GWNNSGQK+ YE+TL E+LKQ YQ++WLLIT TIFV QF+ + KG  +FQ SFL
Sbjct: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540

Query: 540 VSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTI 599
           +S LCL+YKATWSIVN E+VP+WLQ + ++S+SIM G +  Q D  ++LVPMARLFF+  
Sbjct: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600

Query: 600 LAVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRR 659
            AV  +E++ H++ P+  R L  I A+ +  LILQTS ANIPQFL + ILS KL S+W R
Sbjct: 601 AAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSR 660

Query: 660 REWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFA 719
           R+WS  +LM   +VLQ+L+FFQFGNTNSIATV+LTNAYNG+SENYNIYVVG LMCVSNFA
Sbjct: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA 720

Query: 720 PSIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVF 779
           PSIYWSL+CLKILYS   + KW+ F  SR+PSFL+YC+FGCFLLGSCVILRYHLFIWSVF
Sbjct: 721 PSIYWSLSCLKILYSKSTQSKWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLFIWSVF 780

Query: 780 SPKLCYYVSWNIFMNAVIGWLVEATLL 806
           SPKLCYYVSWN+FMNA+I W  E TL+
Sbjct: 781 SPKLCYYVSWNLFMNAIIAWFFEGTLV 807

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/813 (54%), Positives = 561/813 (69%), Gaps = 6/813 (0%)

Query: 1   MSKKXXXXXXXXXXXXXTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60
           M K+             TFS GFFPQKSVL+GDA F + P +Q +  P F KLVL+VIDA
Sbjct: 1   MGKRSVILLLLQIVAIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDA 60

Query: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+FQ+  S F FVH LLN G AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFQESNSKFNFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180
           VAEDD SS+L +QDSWLRQFH NNKRIKFFGDDTWLKLFP EFF E +GTNSFFVSDFE+
Sbjct: 121 VAEDDLSSSLNDQDSWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240
           VD NVTRHLP Q + +D WDVLILH+LGLDHIGHKGG+ S FM  KQ EMD VI+Q+Y S
Sbjct: 181 VDLNVTRHLPHQFSHKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYES 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
           +  DTL+CVMGDHGMNDLGNHGGSS GETSA L FIS  L+ ++ P+ Q +   P+K  +
Sbjct: 241 MDRDTLLCVMGDHGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLKEHS 300

Query: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT 360
           ++Y Y+ +V QIDLVP+++SLFN PIPKNS+G+++ D L+L   + A++K+ DN+ QL  
Sbjct: 301 ENYKYLDEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQLMN 360

Query: 361 ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIAT--FLLLKP 418
           I G+  +++ D     + M+ IQ  LAK  T YNY ++  G+ +L +  +AT  F L   
Sbjct: 361 IIGETPSDTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATTGFTLSLV 420

Query: 419 TISKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXX 478
            ++  +                     EEE QLWWW++  +   S    P EI  H    
Sbjct: 421 KLNYDS-ALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAILVPQEIINHLLVF 479

Query: 479 XXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAK--NKGLVSFQC 536
                  GWNNSGQK+ Y+ TL E+LK      W L  LTIFVT F      +G +SF  
Sbjct: 480 TCLRLIRGWNNSGQKFIYDCTLYELLKVHTSWNWALNALTIFVTSFTCTLGERGPLSFVS 539

Query: 537 SFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFF 596
           SFL++TLCL+YK TWS+VNGE++  WL+ V+ KS  ++  + +++    +SLVPMARLFF
Sbjct: 540 SFLLATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLDDTDNRDMYTDSLVPMARLFF 599

Query: 597 KTILAVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESV 656
           +  L + L  I L+K    + ++  +I +  +  LILQTS ANIPQFLV+ IL ++L+ +
Sbjct: 600 QITLTLILFRIALNKLMDRKTKYFKDIHSIVSMILILQTSSANIPQFLVFWILQDRLKYL 659

Query: 657 WRRREWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVS 716
                 S  ++M+  ++LQNL FFQFG TNSIATVNLTNAYNGIS +YNI+VVG LMC+ 
Sbjct: 660 LTAYTPSDCLVMVISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHVVGLLMCIG 719

Query: 717 NFAPSIYWSLNCLKILYSFPVK-DKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFI 775
           NFAPSIYWS+  L  L+      DKW+IF A+R+P+ +FY I GCF++GSCVILRYHLFI
Sbjct: 720 NFAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCVILRYHLFI 779

Query: 776 WSVFSPKLCYYVSWNIFMNAVIGWLVEATLLVF 808
           WSVFSPKLCYYV+WN+FMN ++ W  E  L+  
Sbjct: 780 WSVFSPKLCYYVTWNVFMNFMVSWCAEGLLVAL 812

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/811 (51%), Positives = 540/811 (66%), Gaps = 12/811 (1%)

Query: 1   MSKKXXXXXXXXXXXXXTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60
           M K+              F AGFFPQK VLK +A+F  +P  Q +  P FNKLVL+VIDA
Sbjct: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60

Query: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+F+K  S F F+H LLN G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180
           VAEDDSSSNL +QDSW+RQF  + K+++FFGDDTWLKLFP+E+FDE DGTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180

Query: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240
           VD NVTRHLPKQL  Q  WD LILH+LGLDHIGHKGG  S FM  KQ EMDE+++Q+Y +
Sbjct: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
           V ++TLICVMGDHGMND+GNHGGSSAGETSA L  IS+ L  Y  P  Q     P++  +
Sbjct: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300

Query: 301 D--DYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQL 358
              DY Y++++ Q+D+VP++++LFNFPIPKNS+G+++ + L+LL PK A++KL++N  QL
Sbjct: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360

Query: 359 TTISG--DLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLL 416
            +IS   +++ + ++ D +Y  M+DIQ DL ++AT YNY ++G G +LL IT I T L+ 
Sbjct: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVITTIITVLVG 420

Query: 417 KPTIS-KPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHX 475
              +                          EEEHQ+WWW++   T AS      E   H 
Sbjct: 421 SNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTGATLASSVYLVDEKYTHF 480

Query: 476 XXXXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQ 535
                      WNNSGQK+  E+T+ +ILK+    QW L    I +   +  +  +V+F 
Sbjct: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540

Query: 536 CSFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLF 595
           CSF+++ LCL+YK TW++VN E VP WL  V  KS SIM G+     D  +SL+P+A+LF
Sbjct: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFD--KSLIPLAQLF 598

Query: 596 FKTILAVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLES 655
           F+       + +V  K   ++    H I  + T  LI Q+   NIP F V+ +L   L  
Sbjct: 599 FRCFAGCVAVAVVACKMGGNKNS--HAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNK 656

Query: 656 VWRRREWSPSILMLA-GIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMC 714
           +  +R  S + ++ A  ++LQ   FF FG TNSIATV+L+NAYNG+SENYNIY VGF+MC
Sbjct: 657 IVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMC 716

Query: 715 VSNFAPSIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLF 774
           VSNFAPSIYWS     +LY      KW  F  S++   +F CI GC L+ +CV LR+HLF
Sbjct: 717 VSNFAPSIYWSTFTWNLLYK--TNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLF 774

Query: 775 IWSVFSPKLCYYVSWNIFMNAVIGWLVEATL 805
           IWSVFSPKLCYY +WNIFMN VIGW++E  L
Sbjct: 775 IWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/793 (50%), Positives = 534/793 (67%), Gaps = 13/793 (1%)

Query: 18  TFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFV 77
           TF+ GFFPQKSVL GD+EF + P+E + + P+F K+V++VIDALRSDF+FQ ++S F FV
Sbjct: 18  TFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSGFHFV 77

Query: 78  HGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWL 137
           H L+N+G+AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+SSNLK+QDSWL
Sbjct: 78  HDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWL 137

Query: 138 RQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQD 197
            Q H + KRI F+GDDTWLKLFP  FF  +DGTNSFFVSDFEEVD NVTRHLP  L+ Q+
Sbjct: 138 SQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLSYQE 197

Query: 198 SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMND 257
            WD+LILH+LGLDHIGHKGG+ S FM PK  EMD VI+ +Y++V E TL+CV+GDHGMND
Sbjct: 198 -WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMND 256

Query: 258 LGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPS 317
           +GNHGGSSAGETSA ++FIS+ L  Y+ P AQ     P+   + DY Y++++ Q+D+VP+
Sbjct: 257 MGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPT 316

Query: 318 ISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMA-NSSDQDVIY 376
           + SLFNFPIP+NS+G+++ D L LL    A++K+ DN+ QL  ++ +      +  D++ 
Sbjct: 317 LVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLANNTPEFAGASIDMLL 375

Query: 377 QHMRDIQGDLAKNATKYNYFMLGFGFSLL-FITAIATFLLLKPTISKPAXXXXXXXXXXX 435
           + M+  Q DLA  AT YNY  L  G S+L FIT I +    +                  
Sbjct: 376 EQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQTKILSLTVAISLSL 435

Query: 436 XXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXXXXXXXGWNNSGQKYT 495
                     EEEHQ+WWW+  A  G S+   PS   +H           GWNNSGQKY 
Sbjct: 436 GLSMFSSSFVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCARLIRGWNNSGQKYI 495

Query: 496 YEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCLIYKATWSIVN 555
           YE+T+ +IL++    +WL+   T+F+  F      L++F  SF+  TLCL YK  W++VN
Sbjct: 496 YENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLVN 555

Query: 556 GEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTILAVTLLEIVLHKWNPD 615
              VP+WLQ  V  + S + G +N    LKE+LVP+ARL F++ILA  +  +  +++   
Sbjct: 556 EGLVPNWLQAFVNMTCSFLIGPDNM---LKEALVPLARLCFQSILASIVFRVCYNRFKSS 612

Query: 616 RKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRREWS--PSILMLAGIV 673
            K  L +I       L+LQTSP+NIP FL++ ++   +  +      +    I  +  ++
Sbjct: 613 PKT-LQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSSNDLSQISCILSLI 671

Query: 674 LQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLKILY 733
           +QN  FFQFG TNSIAT+NLTN+YNG+S++YNIYVVGFL  +SNFAP IYWSLN +++ Y
Sbjct: 672 MQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSLNLIEV-Y 730

Query: 734 SFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNIFM 793
             P  +K   +L  R+P    Y + G FLL SC+ LRYHLFIWSVFSPKLCYY++W+I +
Sbjct: 731 QEP--NKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSILI 788

Query: 794 NAVIGWLVEATLL 806
           N ++  L    LL
Sbjct: 789 NGLLEHLFNPLLL 801

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/796 (50%), Positives = 527/796 (66%), Gaps = 18/796 (2%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F+AGFFPQK VLKGDA+F +  + QR + P F+KLVL+VIDALR+DF+FQ+++S+F+FVH
Sbjct: 19  FAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADFLFQQNVSHFDFVH 78

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
            LLNRG+AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDDSSSNLK+QDSW+ 
Sbjct: 79  ELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDSSSNLKDQDSWIS 138

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF  + K+I FFGDDTWLKLFP+EFF + DGTNSFFVSDFEEVD NVTRHLP +L  +D 
Sbjct: 139 QFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEEVDTNVTRHLPHELQHKD- 197

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDL 258
           WDVLILH+LGLDHIGHKGGA S FM PK REMD VI Q+Y+ V   TL+CVMGDHGMNDL
Sbjct: 198 WDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQVDNRTLLCVMGDHGMNDL 257

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSI 318
           GNHGGSSAGETSAG++FIS++L  Y +P AQ+  + P+ T  +DY + +++ Q+D VP+I
Sbjct: 258 GNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPV-TAAEDYQFFTRIQQVDFVPTI 316

Query: 319 SSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMANSSDQDV--IY 376
           +SLFN PIPKNS+GV + +   LL  + A  K+++NY QL  ++    A   + D+  + 
Sbjct: 317 ASLFNIPIPKNSLGVFVREFSSLLG-QHATTKIIENYHQLMQLAAKKTAARGNDDIDSML 375

Query: 377 QHMRDIQGDLAKNATKYNYFMLGFGFSLL-FITAIATFLLLKPTISKPAXXXXXXXXXXX 435
             M+D+Q  LA+ AT YNY ML  G  +L  +TA   +  +       A           
Sbjct: 376 AEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYCYISSARLNEASVLMIAVTALL 435

Query: 436 XXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXXXXXXXGWNNSGQKYT 495
                     EEEHQ+WWW+ IA+ G S+   PS    H           GWNNSGQK+ 
Sbjct: 436 GSSVFGSSFVEEEHQIWWWIIIAVVGYSWATRPSCTPSHLVFLVCARLLRGWNNSGQKFM 495

Query: 496 YEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCLIYKATWSIVN 555
           Y+ T+ E+LK    ++WLL+  T+ V       +  +    + L   L  +YK  W+ VN
Sbjct: 496 YDFTVAELLKSHPSIKWLLVCATLAVVALDGFTERPLLSIFNLLAGLLWFVYKTCWANVN 555

Query: 556 GEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTILAVTLLEIVLHKWNPD 615
           GE  P++ Q +V K+ S++        D K+ LVP+ARLFFK   A+  + I  +     
Sbjct: 556 GEVSPTYAQTLVTKACSLLFAGGTPWDD-KQLLVPLARLFFKVTAAIVCMRIAYNVVFAK 614

Query: 616 RKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWR--RREWSPSILMLAGIV 673
           RK FL  +    T  LI+QT+  NIP FLV+ I+   L ++ R    +    +  +  ++
Sbjct: 615 RK-FLSELFPLFTIVLIMQTASQNIPLFLVFTIMRSSLRNILRVGYPQQRCEMFFVLSLI 673

Query: 674 LQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCL--KI 731
           LQNL+FFQFG TNSIAT++LTN+YNGISENYNIYVVG LMC+ N AP+IYWSL  +    
Sbjct: 674 LQNLSFFQFGGTNSIATIDLTNSYNGISENYNIYVVGLLMCIGNMAPAIYWSLAAVVDHQ 733

Query: 732 LYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNI 791
           LYS       K +   ++ S  FY +    LL +C+ +RYHLFIWSVFSPKLCY + WNI
Sbjct: 734 LYS------KKSYAQQKLSSMFFYSVNSLLLLVACICMRYHLFIWSVFSPKLCYLLGWNI 787

Query: 792 FMNAVIGWLVEATLLV 807
            ++ +   ++E  LL+
Sbjct: 788 LIHFLTETVLEPFLLM 803

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/808 (49%), Positives = 532/808 (65%), Gaps = 21/808 (2%)

Query: 20  SAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVHG 79
           + GFFPQK+VLKG A+F++  ++QR+  P F KLVL+VIDALRSDF+F +  S+F F+H 
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 80  LLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQ 139
            LN G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD S+ L +QDS L Q
Sbjct: 81  QLNEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQ 140

Query: 140 FHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDSW 199
           FH+ NK+I FFGDDTWLKLFP+++F+E +GTNSFFVSDFE VD NV+RHL KQL     W
Sbjct: 141 FHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDW 200

Query: 200 DVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLG 259
           DVLI+H+LGLDHIGHK GA S FM  K  EMD ++ QVY ++ +DTL+ VMGDHGMN++G
Sbjct: 201 DVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDDDTLLVVMGDHGMNEVG 260

Query: 260 NHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDD-YSYVSKVNQIDLVPSI 318
           NHGGSSAGETSAGL+F+S  L+  E PL Q H   PIK + D+ + +++ V QIDLVP++
Sbjct: 261 NHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDENFQFLTSVQQIDLVPTL 320

Query: 319 SSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTIS-GDLMAN----SSDQD 373
           ++LFN PIPKN++G+V+P+ L+ L      +KLM+NY QL  +S G  + N      D  
Sbjct: 321 ATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIPFDHMDSK 380

Query: 374 VIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLL---KPTISKPAXXXXXX 430
            I   M++IQ +L KNAT YNY  LG G+ LL  T +  F++    + ++          
Sbjct: 381 NIMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQKSLYCATTIITIV 440

Query: 431 XXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQ------APSEIKEHXXXXXXXXXX 484
                          EEEHQ+WWW+       S  +      + S +  H          
Sbjct: 441 ISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFNHFLIAVCARII 500

Query: 485 XGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNK-GLVSFQCSFLVSTL 543
            GWNNSGQK+ YE  L  ILK  Y   W LI  TI+    +   +   +SF   F ++TL
Sbjct: 501 RGWNNSGQKHVYEFILTNILKNHYNTLWYLICTTIYYIGLKNTIRTDFLSFLGPFFMTTL 560

Query: 544 CLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQAD-LKESLVPMARLFFKTILAV 602
           C +YK  W+IVN E VP W   +  ++  I+    +S  D  KE+L+P+A LF++T +A+
Sbjct: 561 CFVYKLDWAIVNNESVPEWFYVITKEASDILLKVGHSPKDAFKEALLPLATLFYQTFVAL 620

Query: 603 TLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWR--RR 660
             + I+   +   RK F  +I  Y +  LI Q++  NIPQFLV+  L + +  V +   +
Sbjct: 621 VSIRIIFLVFFSRRKTFFDDISNYISLLLIFQSTATNIPQFLVFEFLKKSITKVLQNYHQ 680

Query: 661 EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAP 720
           E   + L L  ++LQ+  FFQFG TNSIAT++++NAY+GISENYNIY+VG  M +SNFAP
Sbjct: 681 ENKNNYLPLISLILQSFTFFQFGGTNSIATIDISNAYHGISENYNIYLVGIFMTISNFAP 740

Query: 721 SIYWSLNCLKILYS-FP-VKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSV 778
           SIYW ++   ILY+  P    KW I+  +++P  +F CI GC LL +C ILRYHLFIWSV
Sbjct: 741 SIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCLLAACYILRYHLFIWSV 800

Query: 779 FSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           FSPKLCY++ WN+FMN V+GWLVE TL+
Sbjct: 801 FSPKLCYFLGWNVFMNFVVGWLVEGTLV 828

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/808 (48%), Positives = 521/808 (64%), Gaps = 29/808 (3%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F+ GFFPQK+V+ G+A F+     Q +    F KLVLIVIDALRSDF+F +  SNF FVH
Sbjct: 19  FAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDALRSDFLFDESSSNFHFVH 78

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
             LN G+AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDA+LNVAEDDSSSN+K+QDSWL+
Sbjct: 79  SKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLNVAEDDSSSNVKDQDSWLK 138

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QFH    R++FFGDDTWLKLFP EFF++ +GTNSFFVSDFE+VD NVTRH+P+QL   + 
Sbjct: 139 QFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQVDLNVTRHIPRQLEKTED 198

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDL 258
           WDVLILH+LGLDHIGHKGGA S FM  K REMD+++ ++Y+++ EDTL+ VMGDHGMND 
Sbjct: 199 WDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDNLDEDTLLIVMGDHGMNDA 258

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSI 318
           GNHGGSSAGETSAGL+F S+ L  ++ P+ Q +   PI + + DY Y+++V Q+DLVP++
Sbjct: 259 GNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPITSNSSDYQYLTQVQQMDLVPTL 318

Query: 319 SSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISG-------------DL 365
           ++L+N PIPKNS+GV++PD L+LL P     KL++NY QL  +S              DL
Sbjct: 319 AALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQLLELSKVEYDDELFNLNVFDL 378

Query: 366 MANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFG-FSLLFITAIATFLLLKPTISKPA 424
              S  Q +    M+ +Q  L    T+Y+Y ML  G F  L +T +          S   
Sbjct: 379 EKRSECQRI----MKTLQEKLIAATTEYDYTMLAIGCFMSLVLTLVMAIFSFFQMASNKY 434

Query: 425 XXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIK--EHXXXXXXXX 482
                                EEEHQ+WWW+   +TG  +  A   +   EH        
Sbjct: 435 FFASVLLASILGFSCFGSSFVEEEHQIWWWV---ITGCLFISAAKTMHYFEHSVILLCLR 491

Query: 483 XXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLVST 542
              GWNN+GQK  Y + + +IL++   LQW L  LT FV         +  F  S  +  
Sbjct: 492 LIRGWNNTGQKTVYPYVISKILEENSTLQWNLNALTFFVISLNGNQNSMWGFISSSTLGI 551

Query: 543 LCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTILAV 602
           LCL YKATW++VN E VP ++Q ++    S    ++ ++ D   +L+PMA  F  ++ A+
Sbjct: 552 LCLAYKATWAVVNKEIVPWYIQNIMDNCASFF--QDGNKKDYSSTLIPMASFFLHSVAAI 609

Query: 603 TLLEIVLHKWNPDRKRF-LHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRRE 661
               ++  K+N     F L  I  Y T  ++  +S  NIPQFL++ I+   +  + ++  
Sbjct: 610 IFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFEIMRSFISKILKKHY 669

Query: 662 WSPSILM-LAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAP 720
            S   L  L  + LQN AFFQFG TNSIAT++++NAY+GISENYNIYV+G LM +SNFAP
Sbjct: 670 NSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNIYVIGVLMVLSNFAP 729

Query: 721 SIYWSLNCLKILYSFPVK--DKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSV 778
           SIYW++    I+Y       +KW  F  S++P+ LF CI G  L+ +CV+ RYHLF+WSV
Sbjct: 730 SIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLMLACVMFRYHLFVWSV 789

Query: 779 FSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           FSPKLCY+V WN+FMNA+ GW++E  LL
Sbjct: 790 FSPKLCYFVGWNLFMNAIFGWVLEVLLL 817

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/795 (49%), Positives = 524/795 (65%), Gaps = 14/795 (1%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFPQK+VLKG+A+F  +   Q Q  P F+K VLIV+DALRSDFVF++ +SNF+FVH
Sbjct: 19  FCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDALRSDFVFEESISNFKFVH 78

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
            L+N G+AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWL+
Sbjct: 79  SLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLK 138

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF    K+++FFGDDTWLKLFP +FF E +GTNSFFVSDFE+VD NVTRHLP QL TQ  
Sbjct: 139 QFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQVDLNVTRHLPHQLETQKD 198

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDL 258
           WDVLILH+LGLDHIGHKGGA S FM  K  EMD +++ +Y +V E+TL+CVMGDHGMN++
Sbjct: 199 WDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYENVDENTLVCVMGDHGMNEV 258

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDD----YSYVSKVNQIDL 314
           GNHGGSS GETS+ L+ IS+ L+ ++ PL Q     PI T+  D    Y Y++KV Q+D 
Sbjct: 259 GNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPITTQFQDGEVNYDYLTKVQQVDF 318

Query: 315 VPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISG-DLMANSSDQD 373
           VP++++LFN PIPKN++G+++PD L+LL  K A +K+ DN+ QL ++ G  L   +   +
Sbjct: 319 VPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFNQLASLLGRTLEVKNESIN 378

Query: 374 VIYQHMRDIQGDLAKNATKYNYFMLGFGFSLL-FITAIATFLLLKPTISKPAXXXXXXXX 432
             ++ M+D+Q  L K+AT Y Y +L  GF LL  +TA+A +  +       +        
Sbjct: 379 EEFEQMKDLQEVLTKSATNYKYPILAAGFGLLTVLTAVALWYGISIMQLSKSSLLTIVLS 438

Query: 433 XXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXXXXXXXGWNNSGQ 492
                        EEEHQ+WWW+       S       +  H           GWNNSGQ
Sbjct: 439 LLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYLRKALGLHFVCFVCVRLIRGWNNSGQ 498

Query: 493 KYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCLIYKATWS 552
           KYTY++T+ E+LK    +QW L  LTIF           +SF  SF +  LC  YK +W+
Sbjct: 499 KYTYDNTIFELLKANPGVQWYLNILTIFTVGLGGSLGDRLSFILSFSLCALCGSYKISWA 558

Query: 553 IVNGEKVPSWLQRVVMKSFSIMNGEN-NSQADLKESLVPMARLFFKTILAVTLLEIVLHK 611
           IVN E VP W+Q +  KS      E+ N +    ++LVPMA+ FFK  +A  +++I   K
Sbjct: 559 IVNREDVPFWMQELAFKSCLFFTKEHTNPEEVFGKALVPMAQFFFKYFIACLVVKISASK 618

Query: 612 WNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRREWSPSILM-LA 670
               +     N+ +  +  L+ Q+  ANIP F ++ +L   L  ++     S +  + L+
Sbjct: 619 IGVCKA----NLFSMLSILLMFQSPTANIPLFFIFEVLRAALSRLFTDYYGSNTYFVSLS 674

Query: 671 GIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLK 730
            ++LQ   F+QFG TNSIA+++L+NAYNG+ ENYNIY+VGF+M VSNFAP+IYWSL   K
Sbjct: 675 SLLLQYFTFYQFGGTNSIASIDLSNAYNGVPENYNIYLVGFMMFVSNFAPTIYWSL--YK 732

Query: 731 ILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWN 790
                P   KW ++   ++P  +F C+ G FLL +C + R+HLFIWSVFSPKLCY+VSWN
Sbjct: 733 STIPRPESRKWILYAEQKIPFLIFNCVVGVFLLIACYVFRFHLFIWSVFSPKLCYFVSWN 792

Query: 791 IFMNAVIGWLVEATL 805
           IFMN +I   +E+ +
Sbjct: 793 IFMNIIIECGLESIV 807

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/821 (48%), Positives = 532/821 (64%), Gaps = 43/821 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFP K+VL+GDA F    D Q    P FNKLVL+VIDALRSDF+F +D+S F ++H
Sbjct: 20  FCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFNYIH 79

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
            L N G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLK QDSW  
Sbjct: 80  ELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM 139

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF  + K+I+FFGDDTWLKLFP E F E +GTNSFFVSDFE+VD NVTRHL KQ+  ++ 
Sbjct: 140 QFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIKEKND 199

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGED--TLICVMGDHGMN 256
           WD LILH+LGLDHIGHKGG  S FM PK REMD +I+ ++ +VG+D  TLICVMGDHGMN
Sbjct: 200 WDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGDHGMN 259

Query: 257 DLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN------DDYSYVSKVN 310
           ++GNHGGSS GETSAGL+ IS+ L+ +E P  Q     PIK+ N        Y +++++ 
Sbjct: 260 EVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQ 319

Query: 311 QIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDL----- 365
           Q+D+VP++S+LFN P PKN++GV+MP +L LL PK  ++KL +N+ QL  +S +      
Sbjct: 320 QVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKDIRQL 379

Query: 366 -----MANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIAT-----FLL 415
                  N+  +D+I   M+DIQG+L  +AT YN  +L  G  L+FI  +       F +
Sbjct: 380 YESYDFENTEIKDII-SEMKDIQGELTSSATNYNVPLLYLGLGLIFILTLTISFWFYFSV 438

Query: 416 LKPTISKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHX 475
           L+                            EEEHQ+WWW+   L   S    P +   H 
Sbjct: 439 LEVDFKN---VLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495

Query: 476 XXXXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQ-LQWLLITLTIFVTQFRAKNKGLVSF 534
                     GWNNSGQKY+Y+ T+  +L  +Y+  QW L   TI     +     L+SF
Sbjct: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555

Query: 535 QCSFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQ--ADLKESLVPMA 592
             S+ + ++C++YK  W+I+N + VP  + +  +     ++ + + Q  + ++E+L+P+A
Sbjct: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615

Query: 593 RLFFKTILAVTLLEIVLHKWNPDRKRFLHN----IQAYCTAFLILQTSPANIPQFLVYLI 648
           R FF ++LA     IV+  +   + + + N    IQ   T  LI Q+  + I  F+VY I
Sbjct: 616 RFFFYSVLA-----IVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDI 670

Query: 649 LSEKLESVWRRREWSPSILMLAGI--VLQNLAFFQFGNTNSIATVNLTNAYNGISENYNI 706
           L   L S+    ++S ++++ + I  VLQ   FFQFG TNSIAT +LTNAYNG+SE+YNI
Sbjct: 671 LQSSLSSL-LVNQYSSNVMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNI 729

Query: 707 YVVGFLMCVSNFAPSIYWSLNCLKILYS-FPVKDKWKIFLASRMPSFLFYCIFGCFLLGS 765
           Y VGFLMCVSNFAP+IYW++   K++Y+     +KW +F  +++P   F CI GCFLL S
Sbjct: 730 YFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLS 789

Query: 766 CVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           C ILRYHLFIWSVFSPKLCYY +WNIFMN ++GW++E  +L
Sbjct: 790 CFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVL 830

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/787 (49%), Positives = 513/787 (65%), Gaps = 46/787 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFPQK VLK D++F   P+ Q    P F KLVL+VIDALRSDF+FQKD S+FEF+H
Sbjct: 20  FCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLFQKDSSDFEFLH 79

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
           GLLN G+AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+SSNLKEQDS L+
Sbjct: 80  GLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLK 139

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QFH ++ ++ FFGDDTWLKLFP EFF E DGTNSFFVSDFEEVDFNVTRH+P Q+  Q +
Sbjct: 140 QFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQMEHQKN 199

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDL 258
           WDVLILH+LGLDHIGHKGG+ SHFM  K REMD VI+Q+Y  +  DTL+ V+GDHGMNDL
Sbjct: 200 WDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKIDGDTLMVVLGDHGMNDL 259

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSI 318
           GNHGGSS+GETSA L F+S+ L+ Y+    Q     P++  + DY Y+ +V QID+VP++
Sbjct: 260 GNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVEDAHPDYKYLKEVEQIDIVPTL 319

Query: 319 SSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMANSSDQDV--IY 376
           S LFN PIPKNS+GV++ ++L+LL  K A +K+ DNYLQLT +     A    +    + 
Sbjct: 320 SMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQLTKLKPGYEAQLEKKSAGTLL 379

Query: 377 QHMRDIQGDLAKNATKYNYFMLGFGFSLLFI-TAIAT---FLLLKPTISKPAXXXXXXXX 432
           + MR+IQ  LA  AT YNY  L +G +L+ I T I T   F L +  I            
Sbjct: 380 EEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVWNFQLSQEYIEHVG------TS 433

Query: 433 XXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXXXXXXXGWNNSGQ 492
                        EEEHQ+WWW+ I++          ++              GWNNSGQ
Sbjct: 434 VLLGISMFASSFIEEEHQIWWWITISVLLLMQISNGKKL----VVLSGLRLIRGWNNSGQ 489

Query: 493 KYTYEHTLLEILKQKYQLQWLLITLTIFVTQF-----RAKNKGLVSFQCSFLVSTLCLIY 547
           KY Y++ L  +LK    + W L  +T     F     + +++ +VS      ++   + Y
Sbjct: 490 KYIYDNVLHTLLKSHTSVLWWLNVVTFLSVGFPFLRNKDESEKMVSLLSVSFLALSSITY 549

Query: 548 KATWSIVNGEKVPSWLQRVVMKSFSI-MNGENNSQADLKESLVPMARLFFKTILAVTLLE 606
           K  ++IVNG+KVPS L    ++S ++ +  EN +++D+ + LVP+AR+FF+ I  V+++ 
Sbjct: 550 KICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDISQCLVPIARIFFQ-ICGVSIII 608

Query: 607 IVLHKWNPDRK-RFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRREWSPS 665
           ++  K+  ++    L+ + +     L+LQTS ANIP FL++ IL+            +P 
Sbjct: 609 LLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIPLFLIFEILTSV----------TPD 658

Query: 666 ILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWS 725
           I  +  + LQNL FFQFG TNSIATVNLTNAYNG+S NYNIYVVG LM +SN+APSIYW+
Sbjct: 659 ITPIFSLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNYNIYVVGVLMFLSNYAPSIYWA 718

Query: 726 LNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCY 785
           L+ +      P   K K            Y I G  L+ +C+ LRYHLFIWSVFSPKLCY
Sbjct: 719 LSLI------PQSYKQKTLRLQH------YYITGTCLMIACIALRYHLFIWSVFSPKLCY 766

Query: 786 YVSWNIF 792
           Y +W+++
Sbjct: 767 YAAWSLY 773

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/846 (46%), Positives = 519/846 (61%), Gaps = 68/846 (8%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F+ GFFPQK+V+KGD++F      Q Q  P FNKLVLIVIDALRSDF+F    S+F FVH
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
             LN+G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS L++QDS ++
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF++  K +KFFGDDTWLKLFP  +F E +GTNSFFVSDFE VD NVTRHLP+QLA  D+
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLAANDA 198

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVY------NSVGEDTLICVMGD 252
            DVLILH+LGLDHIGHK GA S FM  K  EMDE+I+ +Y      N   ++TL+ VMGD
Sbjct: 199 -DVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 253 HGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPI-----KTKNDDYSYVS 307
           HGMN++GNHGGSSAGETSAG++F+S  L  Y  P  Q +   P+     +   +++ Y++
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLNEEGQNNFQYLN 317

Query: 308 KVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTIS----- 362
            + Q+DLVP++++LF  PIPKNS+GV++P+ L++L P+    K+ +NY QL  +S     
Sbjct: 318 SIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSAN 377

Query: 363 -------GDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLL 415
                   DL  N   Q+++   M++IQ +L K AT YNY +L  G+S+L I+ + T LL
Sbjct: 378 EYEYNFDSDLDVN---QEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLL 434

Query: 416 LKPTISKP---AXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPS--- 469
           +    SK                          EEEHQ+WWW+       S     +   
Sbjct: 435 IWKDYSKKNIFQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQN 494

Query: 470 ------EIKEHXXXXXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQ 523
                  I  H           GW+NSGQKY Y+H L  +LK    +QW L  LTI +  
Sbjct: 495 GFSPLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKSHTNIQWYLNLLTILIIG 554

Query: 524 F-RAKNKGLVSFQCSFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQA 582
           F +        F  +F +S LC IYK  W+IVN E VP W      ++ SI+ G   +  
Sbjct: 555 FQKDSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGP--TAT 612

Query: 583 DLKESLVPMARLFFKTILAVTLLEIVLHKW----NPDRKRFLHNIQAYCTAFLILQTSPA 638
             ++SL+PMA LF K I+   +  I+  K     N      + +I  Y    LI +TS  
Sbjct: 613 TFQDSLIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLLIFETSST 672

Query: 639 NIPQFLVYLILSEKLESVWRR--------------REWSPSILMLAGIVLQNLAFFQFGN 684
            I QFL++    E +  +W +                   S++ L  ++LQN  FFQFG 
Sbjct: 673 KISQFLIF----EIINHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQFGG 728

Query: 685 TNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLKILY---SFPVKD-K 740
           TNSIAT++++NAY+GISENYNIY VG  M +SNFAPSIYW++     LY   S   K+ K
Sbjct: 729 TNSIATIDISNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNKNSK 788

Query: 741 WKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWL 800
           W IF ++++P   F CI GC LL SC ILRYHLFIWSVFSPKLCY++ WN+FMN+++G++
Sbjct: 789 WIIFASNKLPILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIVGYI 848

Query: 801 VEATLL 806
           VE  ++
Sbjct: 849 VEGLIV 854

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/805 (47%), Positives = 513/805 (63%), Gaps = 16/805 (1%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFPQKSVL G + F  +   Q++  P F+KL+L+VIDALRSDF+F  ++SNF F H
Sbjct: 20  FCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDALRSDFIFDSNISNFPFTH 79

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
            LLN G AWG+TAYSNPPTVTLPRLKG+TTGSTPNFLDAILNVAEDD+SSNLK+QDS L 
Sbjct: 80  SLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILNVAEDDNSSNLKDQDSLLN 139

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF++NNK+I+FFGDDTWLKLFP ++F+E +GTNSFFVSDF +VD NVTRH+PKQL  ++ 
Sbjct: 140 QFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQVDNNVTRHIPKQLQEKND 199

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDL 258
           WDVLILH+LGLDHIGHKGG  S FM  K  EMD +I Q+Y ++  D L+C++GDHGMN+L
Sbjct: 200 WDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYENLDNDGLLCILGDHGMNEL 259

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDD---YSYVSKVNQIDLV 315
           GNHGGSS GETSA ++F S  L  +E P  Q     PI   ++D   + Y++++ Q+D V
Sbjct: 260 GNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPITKPSEDENSFKYLTEIQQVDFV 319

Query: 316 PSISSLFNFPIPKNSIGVVMPDVLRLL-SPKDAQLKLMDNY---LQLTTISGDLMANSSD 371
           P+I++LFN PIP+NS+G+++  +L+LL + K   +KL +NY   L L  I   +   SS 
Sbjct: 320 PTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYKQLLDLAHIHSTMDDISSL 379

Query: 372 QDV-IYQHMRDIQGDLAKNATKYNY-FMLGFGFSLLFITAIATFLLLKPTISKPAXXXXX 429
           +D  ++  M  IQ DL ++AT Y Y F+     S +  T +   L+ K            
Sbjct: 380 EDFELFTKMVSIQEDLTRSATNYFYEFLAAGIISSIIGTILYAVLITKDLKFNGIEIISI 439

Query: 430 XXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXXXXXXXGWNN 489
                           EEEHQ+WWW+   L   S    P+    H           GWNN
Sbjct: 440 IISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKPNTKLLHLTLFICVRLIRGWNN 499

Query: 490 SGQKYTYEHTLLEILKQ-KYQ-LQWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCLIY 547
           SGQKY YE T+  IL + +Y+ +QW LI  TI    F    K L +F  S  +  L   +
Sbjct: 500 SGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFNDSMKNLPTFAMSLSLGVLVFSF 559

Query: 548 KATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTILAVTLLEI 607
           K +WSI NGEKVP  ++ +      ++  + +       +L P+A+LFF   L   ++++
Sbjct: 560 KVSWSITNGEKVPFVIKDMARTVVKLLFPDESKDIIFSLALNPLAQLFFHCTLGFLVIKL 619

Query: 608 VLHKWNPDR--KRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRREWS-P 664
           ++ K   D+        +        I+QT P+NIP F V+ I+   L  + +    S P
Sbjct: 620 LIQKLKIDKTVDNIFDELTKVMNLVAIMQTRPSNIPMFCVFEIMKMILVKIIKHDYNSNP 679

Query: 665 SILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYW 724
            +  +A +VLQ+  FFQFG TNSIATV+L+NAYNG+SENYNIY VG LM ++NFAPSIYW
Sbjct: 680 YVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNGVSENYNIYYVGLLMTIANFAPSIYW 739

Query: 725 SLNCLKILYSFPVKD--KWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPK 782
           ++    ILYS+      + + F+ S++   LFY I GCFL  SC ILRYHLFIWSVFSPK
Sbjct: 740 AVFSWDILYSYDTNSILRRQNFMKSKVLPLLFYFIIGCFLFLSCFILRYHLFIWSVFSPK 799

Query: 783 LCYYVSWNIFMNAVIGWLVEATLLV 807
           LCYYV+W+IFMN ++GW+ E  L++
Sbjct: 800 LCYYVAWSIFMNCIVGWVFEGILVL 824

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/808 (46%), Positives = 516/808 (63%), Gaps = 33/808 (4%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQIS-----PKFNKLVLIVIDALRSDFVFQKDMSN 73
           F  GFFPQK VLKG AEFN  P+   ++      P FNK +L+V+DALRSDF+F    S+
Sbjct: 19  FCLGFFPQKKVLKGQAEFN--PENLDRLGSNREEPVFNKFILVVVDALRSDFIFDSHNSH 76

Query: 74  FEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQ 133
           F+FVH  LN G+AWG+TA+S+PPTVTLPRLKGITTGSTPNFLDA+LNVAEDD +S +KEQ
Sbjct: 77  FDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFLDALLNVAEDDQTSTIKEQ 136

Query: 134 DSWLRQFHIN-NKRIKFFGDDTWLKLFP--QEFFDETDGTNSFFVSDFEEVDFNVTRHLP 190
           DSW+ QF  N N+ I+FFGDDTWLKLF    E F E +GTNSFFVSDF +VD NVTRH+P
Sbjct: 137 DSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFFVSDFTQVDLNVTRHIP 196

Query: 191 KQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVM 250
            QL  +D WD LILH+LGLDHIGHKGGA+SHFM  K +EMD V++ +Y +V  DTLI VM
Sbjct: 197 TQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVLKDLYENVDPDTLIVVM 256

Query: 251 GDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTK-----NDDYSY 305
           GDHGMND+GNHGGSS GET AGL+F+S  L  + KP +Q +ET P+ T      +  + Y
Sbjct: 257 GDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQ-YETIPLNTPVTADGDKTFEY 315

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDL 365
           +++V Q+D+VP++++LFN PIPKNS+G+++ D + LL     + K+ +NY QL T+S  +
Sbjct: 316 LTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLREAKVGENYQQLFTLSNSM 375

Query: 366 MANSSD--QDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLF-ITAIATFLLLKPTISK 422
              +     D +Y+ MR +Q +L +NAT YNY  L  G+ +L  +TA    L ++     
Sbjct: 376 ETVNVGLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVILVCVTAYCLILAVQRMRLS 435

Query: 423 PAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWL---AIALTGASYTQAPSEIKEHXXXXX 479
            A                     EEEHQLWWW+   +I  T A    +            
Sbjct: 436 GAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFTLAFRQSSWHTTSSCITLSL 495

Query: 480 XXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539
                 GWNN+GQK TY + +  IL     ++W L  L  F+   ++  + L+SF    +
Sbjct: 496 AVRLIRGWNNTGQKTTYTYVIGNILAAHPTIKWNLNVLA-FLAVCQSNTESLMSFCGHIV 554

Query: 540 VSTLCLIYKATWSIVNGEKVPSW---LQRVVMKSFSIMNGENNSQADLKESLVPMARLFF 596
           +  + L YK  W++VN E VP +     +++ +   +  GE+    +L+E+L+P+AR+F+
Sbjct: 555 LIVVALAYKINWALVNKENVPVYAFQFLQIIGRLIKVNVGED--IENLEEALIPLARVFY 612

Query: 597 KTILAVTLLEIVLHKWN-PDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLES 655
           + +L+ T+++IVL K         + +I       L+  +S +NIPQFL++ I+   +  
Sbjct: 613 RLVLSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMFLSSTSNIPQFLIFEIMKVCITQ 672

Query: 656 VWRRREWSP-SILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMC 714
           + +    S  SI  +  ++LQN  FFQFG TNSIAT++L+NAY+GISENYNIY VG+LM 
Sbjct: 673 IIKDEYGSDISITAIVSLILQNFTFFQFGRTNSIATIDLSNAYHGISENYNIYAVGWLMV 732

Query: 715 VSNFAPSIYWSLNCLKILYSFPV---KDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRY 771
           +SNFAP++YW++    I Y  P    K +W  F   ++P  LF  + GC LL +CV LRY
Sbjct: 733 ISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKLPITLFNGLVGCCLLAACVALRY 792

Query: 772 HLFIWSVFSPKLCYYVSWNIFMNAVIGW 799
           HLFIWSVFSPKLCYYV WN+FM ++IGW
Sbjct: 793 HLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/813 (48%), Positives = 521/813 (64%), Gaps = 39/813 (4%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFP K+VL+G  EFNF+ + Q    P F KLV +VIDALRSDF++++  S+F FVH
Sbjct: 17  FCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVH 76

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
            +LN G+AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS+LK+QDSWL 
Sbjct: 77  RVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLM 136

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS 198
           QF+ +NK I+FFGDDTWLKLFP   F E +GTNSFFVSDFE+VD NVTRHL KQ   ++ 
Sbjct: 137 QFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQFKEKEQ 196

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVG--EDTLICVMGDHGMN 256
           WDVLILH+LGLDHIGHKGG+ S FM  K  EMD ++E +YNS+G  EDTL+CVMGDHGMN
Sbjct: 197 WDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMGDHGMN 256

Query: 257 DLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK------TKNDDYSYVSKVN 310
           + GNHGGSS+GETSAGL  IS+  +   KP  Q +   PIK       +  DY ++S V 
Sbjct: 257 NGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQ 316

Query: 311 QIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMA--- 367
           Q+D VP++S+LFN P+P NS+GV++P++LRLL PK  + KL +N+ QLT +S  L     
Sbjct: 317 QVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLTTRNI 376

Query: 368 -------NSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLLKPTI 420
                  N + +D+I Q M+ +Q +L K+AT YN  M     +++ ++ +   ++ K   
Sbjct: 377 YNAIDFQNDTIEDIISQ-MQSVQSELMKSATNYN--MNAIYIAIILLSIVTLIIIHKAFS 433

Query: 421 SKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSEIKEHXXXXXX 480
           +                        EEEHQ+WWWL   +   S          +      
Sbjct: 434 NYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNFIVFLC 493

Query: 481 XXXXXGWNNSGQKYTYEHTLLEILKQKY-QLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539
                GWNNSGQKY Y   L  +LK KY   QW L T TI    F+       SF  SFL
Sbjct: 494 LRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSFMSSFL 553

Query: 540 VSTLCLIYKATWSIVNGEKVPSWLQR-VVMKSFSIMNGENNSQADLKES-LVPMARLFFK 597
           ++ LCL+YK +W+IVN E VP  ++  V++    +M+  N +   L ES L+P+ARLFF 
Sbjct: 554 LANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLARLFFC 613

Query: 598 TILAVTLLEIVLHKWNPDR-KRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESV 656
            ++ +  L +V+ K +P R    + NI+      LI QTSP NI  +L++ IL   L  +
Sbjct: 614 CVVILLSLTLVIGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFGILETNLTDI 673

Query: 657 WRRR-EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCV 715
             +    +  ++    +V+Q   F+QFGNTNSIAT++LTNAYNG+SE+YNIY VG++M +
Sbjct: 674 IDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMMSI 733

Query: 716 SNFAPSIYWSLNCLKILYSFP-----VKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILR 770
           SN+AP+IYWS+        FP      K KWK F+  +    LF CI G FLL +C ILR
Sbjct: 734 SNYAPAIYWSM--------FPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILR 785

Query: 771 YHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEA 803
           YHLFIWSVFSPKLCYY+ WNIFMN +IGW++E 
Sbjct: 786 YHLFIWSVFSPKLCYYMMWNIFMNVIIGWILET 818

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/833 (45%), Positives = 510/833 (61%), Gaps = 51/833 (6%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F  GFFPQK VL G A      D      P F+KLV++V+DA+RSDF+F   +S F F+H
Sbjct: 16  FGCGFFPQKKVLDGHAAL----DGTHARDPVFDKLVVVVVDAMRSDFLFDASISKFHFIH 71

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
             L  G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD+SS+L  QDSWL 
Sbjct: 72  EKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTSSSLLAQDSWLW 131

Query: 139 QFHIN-NKRIKFFGDDTWLKLFP--------QEFFDETDGTNSFFVSDFEEVDFNVTRHL 189
           QF  N  KRI+FFGDDTWLKLFP        Q  FDE +GTNSFFVSDF +VD NVTRH+
Sbjct: 132 QFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDFTQVDLNVTRHI 191

Query: 190 PKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVG-EDTLIC 248
            +QL     WDVLILH+LGLDHIGHK G +S FM PK  EMD +I ++Y+ +  + TL+ 
Sbjct: 192 DRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLYDELDMQSTLLV 251

Query: 249 VMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNH-ETFPIKT------KND 301
           +MGDHGMNDLGNHGGSSAGETSAG++F+S  L  Y+    Q+  + FP+K       +  
Sbjct: 252 LMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAKEFPMKIPSLNAGEEK 311

Query: 302 DYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLK---LMDNYLQL 358
            + Y+ K+ QID+VP+ISSLFN  IPKN++GV++P+ L+L   KD  L+   + +N+ QL
Sbjct: 312 TFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLF--KDVSLQKAIVKENWNQL 369

Query: 359 TTISG---DLMANSSD---QDVIYQHMRDIQGDLAKNATKYNYFMLGFG-FSLLFITAIA 411
           + ++     +M  + +   +DVI ++M+D+Q +LAK AT YNY +L  G F  + IT   
Sbjct: 370 SGLTKGKTQIMEETKNFVIEDVI-KNMKDVQENLAKTATDYNYPLLFIGCFLSIVITGTI 428

Query: 412 TFLLLKPTISKPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAP-SE 470
            +   +                            EEEHQ WWW+   L   S      S 
Sbjct: 429 YYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGLVLLSMVNLNFSS 488

Query: 471 IKEHXXXXXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKG 530
            K H           GWNNSGQKYTY++ +  +LK      W L  +T+ V     K+  
Sbjct: 489 WKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNIDALWWLNLITVTVVGLNLKSLR 548

Query: 531 LVSFQCSFL----------VSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENN- 579
             +   S L          +S +  +YK  WSIVNGE+VP    + V+++ S++  +   
Sbjct: 549 FGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKWVLETASLIVEDATL 608

Query: 580 -SQADL-KESLVPMARLFFKTILAVTLLEIVLHKW--NPDRKRFLHNIQAYCTAFLILQT 635
             + DL   +L+P+AR+FFK   AV +  +++ K+    D  + L  +  Y T FL+ QT
Sbjct: 609 YREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVSRYVTIFLVFQT 668

Query: 636 SPANIPQFLVYLILSEKLESVWRRREWSPSIL-MLAGIVLQNLAFFQFGNTNSIATVNLT 694
              NI  FL + I++E    + R R  S  +L ++ GI+LQ   FFQ G TNSIATV+L+
Sbjct: 669 PSHNIGLFLFFEIINEITVHIIRERYQSDYLLAVIFGIILQFFTFFQSGGTNSIATVDLS 728

Query: 695 NAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLF 754
           NAYNG+SENYNIYVVG +MC+SNFAP+IYWS    +I Y+     +W+  +A++ P  + 
Sbjct: 729 NAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANSSRWQTLVAAKYPFIII 788

Query: 755 YCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLLV 807
               GC LL +C+ILRYHLFIWSVFSPKLCYY+ W IF+  ++ W+ E  LL+
Sbjct: 789 QSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWIPEILLLL 841

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/820 (45%), Positives = 506/820 (61%), Gaps = 43/820 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPK--FNKLVLIVIDALRSDFVFQKDMSNFEF 76
           F   FFP+K VL G ++     D+ R +  +  F KLV +VIDALRSDF+F   +S+F  
Sbjct: 20  FIFAFFPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNN 79

Query: 77  VHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSW 136
           VH  LN G+AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L E DSW
Sbjct: 80  VHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSW 139

Query: 137 LRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQ 196
           L+QF  +N  I+F GDDTWLKLFP E+FD TD T+SFFVSDF +VD NVTR+L  +L  +
Sbjct: 140 LQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQE 199

Query: 197 -DSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGE-----DTLICVM 250
              WDV ILH+LGLDHIGHK G  S FM+ K +EMD +++ +Y+ V E     DTLICV+
Sbjct: 200 WAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVL 259

Query: 251 GDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK-TKNDDYSYVSKV 309
           GDHGMN+LGNHGGSSAGETSAGL+F+S  L  + KP +Q     PI  T + D+ Y+  V
Sbjct: 260 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSV 319

Query: 310 NQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISG---DLM 366
            QID+VP+I++LF  PIP NS+G+++PD L+LL  K A +K  +N++ L  +S    +++
Sbjct: 320 QQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWRLSDHQEEVV 377

Query: 367 ANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITAIATFLLLK---PTISK 422
            +  D   IY  M DIQ  L K+AT YNY +L   F S L IT IAT+ L +   PT  K
Sbjct: 378 LDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQLQRHSGPTFCK 437

Query: 423 --PAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGA---SYTQAPSEIKEHXXX 477
              +                     EEEHQLWWW+  A       +Y    S I      
Sbjct: 438 LRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIARWFIM 497

Query: 478 XXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCS 537
                    WNNSGQK+ Y + +  IL +    +W L +LT  +    +    L+    S
Sbjct: 498 LACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQLLHCIMS 557

Query: 538 FLVSTLCLIYKATWSIVNGEK--VPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLF 595
            ++  LC  YK +W IVNG++  +P +LQ ++ K   I N  N         L+ +AR+F
Sbjct: 558 TILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN---------LITLARVF 608

Query: 596 FKTILAVTLLEIVLHKWNP-DRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLE 654
           F+    V +  +VL K    D+K  + +++ Y T  LILQTS  NI  F+V+ IL  ++ 
Sbjct: 609 FQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQIC 668

Query: 655 SVWRRREWSPSILM-----LAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVV 709
             ++    S S        L  +VLQN +FFQFG TNSI+T++L NAY+GIS +YNI VV
Sbjct: 669 YFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVV 728

Query: 710 GFLMCVSNFAPSIYWSLNCLKILYSFPV--KDKWKIFLASRMPSFLFYCIFGCFLLGSCV 767
           G LM ++NFAP+IYWS+    I Y  P   ++K + F+ S++P+F ++CIFG  L+ +C+
Sbjct: 729 GLLMSIANFAPAIYWSMLPWSINYE-PASSQNKLQTFVKSKLPAFTYHCIFGTCLMTACI 787

Query: 768 ILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLLV 807
            LR+HLFIWSVFSPKLCY++ WN+ M  + GWL E  +++
Sbjct: 788 FLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVIL 827

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/818 (44%), Positives = 501/818 (61%), Gaps = 41/818 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F   FFP+K VL G ++ +   D   Q    F KLV ++IDALRSDF+F   +S+F  VH
Sbjct: 20  FIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLFDSQISHFNNVH 79

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
             LN G+AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L E DSWL+
Sbjct: 80  QWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQ 139

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQ-D 197
           QF  +N  I+F GDDTWLKLFPQ++FD  D T+SFFVSDF +VD NVTR+LP +L  +  
Sbjct: 140 QFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWA 199

Query: 198 SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGE-----DTLICVMGD 252
            WDV ILH+LGLDHIGHK G  S FMA K +EMD +++ +Y+ V E     DTLICV+GD
Sbjct: 200 QWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGD 259

Query: 253 HGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKND-DYSYVSKVNQ 311
           HGMN+LGNHGGSSAGETSAGL+F+S  L  + +P +Q + T PI    D ++ Y+  V Q
Sbjct: 260 HGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQ 319

Query: 312 IDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTIS---GDLMAN 368
           ID+VP+I++LF  PIP NS+G+++PD L+LL  K A +K  +N++ L  +S   G++  +
Sbjct: 320 IDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--ENFMHLWKLSDHHGEVALD 377

Query: 369 SSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITAIATFLLLKPTIS-----K 422
               + IY  M  IQ  L K+AT YNY +L   F   L IT IA ++LL+ +       +
Sbjct: 378 DFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIITIIAIYVLLRYSGPDFWQLR 437

Query: 423 PAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGAS---YTQAPSEIKEHXXXXX 479
            +                     EEEHQLWWW+  A +      Y      I        
Sbjct: 438 VSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVPLFVYRLNVLIIVRWFIMMA 497

Query: 480 XXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539
                  WNNSGQK+ Y + +  +L Q    +W L  LT  V    +    ++ F  + +
Sbjct: 498 CVRSIKFWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLTFLVLIMASAGFQVLHFIVTTI 557

Query: 540 VSTLCLIYKATWSIVNGEK--VPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFK 597
           +  LC  YK +W IVNG +  +P ++  ++ K            A  + +L+ +AR+FF+
Sbjct: 558 LVGLCFTYKISWEIVNGNQAEIPLFMHDLLAKI---------DFAPTESNLIVLARVFFQ 608

Query: 598 TILAVTLLEIVLHKWNPDRKRFL-HNIQAYCTAFLILQTSPANIPQFLVYLILSEKL--- 653
               V +  +VL K     K +L  +++ Y T  L+ QTS  NI QFLV+ IL  ++   
Sbjct: 609 AWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQTSSQNIGQFLVFQILESQIFYF 668

Query: 654 -ESVWRRREWSPSILM---LAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVV 709
            +++      S S +    L  ++LQN  FFQFG TNSI+T++L NAY+G+S +YNIYVV
Sbjct: 669 FQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSISTIDLGNAYHGVSSDYNIYVV 728

Query: 710 GFLMCVSNFAPSIYWSLNCLKILY-SFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVI 768
           G LM V+NFAP+IYWS+    I Y S P + K + F+ S++P+F ++CIFG  L+ +CV+
Sbjct: 729 GILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIRSKLPAFTYHCIFGTCLMTACVV 788

Query: 769 LRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           LR+HLFIWSVFSPKLCY++ WN  M  + GWL E  LL
Sbjct: 789 LRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPELALL 826

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/821 (44%), Positives = 502/821 (61%), Gaps = 46/821 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQR--QISPKFNKLVLIVIDALRSDFVFQKDMSNFEF 76
           F   FFP+K VL G ++ +  PDE R  Q +  F KLV ++IDALRSDF+F   +S+F  
Sbjct: 20  FIFAFFPRKIVLTGISQQD--PDEDRDLQHNRPFQKLVFVIIDALRSDFLFDAQISHFNN 77

Query: 77  VHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSW 136
           VH  LN G+AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L E DSW
Sbjct: 78  VHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSW 137

Query: 137 LRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQ 196
           L+QF  +N  I+F GDDTWLKLFP E+FD  D T+SFFVSDF +VD NVTR+L K+L  +
Sbjct: 138 LQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSDFTQVDNNVTRNLQKKLFQE 197

Query: 197 -DSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGE-----DTLICVM 250
              WDV ILH+LGLDHIGH+ G  S FM  K +EMD +++ +Y+ V E     DTLICV+
Sbjct: 198 WAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKSIYDQVLEHENDDDTLICVL 257

Query: 251 GDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK-TKNDDYSYVSKV 309
           GDHGMN+LGNHGGSSAGETSAGL+F+S  L  + KP  Q     PI  T + D+ Y+  V
Sbjct: 258 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQETHILPINGTPDHDFQYLESV 317

Query: 310 NQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTIS---GDLM 366
            QID+VP+I++LF  PIP NS+G+++PD L+LL  K A +K  +N++ L  +S    D+ 
Sbjct: 318 QQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--ENFMHLWRLSDHHDDVA 375

Query: 367 ANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITAIATFLLLK---PTIS- 421
            +    + IY  M DIQ  L ++AT YNY +L   F S LF T +A + L +   P+   
Sbjct: 376 LDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTTIVAVYQLQRYSGPSFCH 435

Query: 422 -KPAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGASYTQAPSE---IKEHXXX 477
              +                     EEEHQLWWW+  A +       PS           
Sbjct: 436 LHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVPLFLYPSNAFVFARWFIM 495

Query: 478 XXXXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCS 537
                    WNNSGQK+ Y + +  +L Q    +W L + T       +    L+ F  +
Sbjct: 496 IACVRLIKFWNNSGQKFIYSNVMSNLLNQNPFWKWYLNSSTFLALIIPSARSQLLHFIVT 555

Query: 538 FLVSTLCLIYKATWSIVNGEK--VPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLF 595
            ++  LC  YK +W IVNG +  +P ++Q ++ K    +  ENN        L+ +AR+F
Sbjct: 556 TILVGLCFTYKISWEIVNGNQAEIPPFMQGLLTK-MDFLPTENN--------LLLLARVF 606

Query: 596 FKTILAVTLLEIVLHKWNPDRKRFL-HNIQAYCTAFLILQTSPANIPQFLVYLILSEKLE 654
           F+    V +  + L K     KR+L  +++ Y T  LI QTS  NI QF+++ IL  ++ 
Sbjct: 607 FQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSSQNIGQFIIFQILQSQIY 666

Query: 655 SVWRRRE-----WSPSILMLAGIV---LQNLAFFQFGNTNSIATVNLTNAYNGISENYNI 706
             ++         SPS + L+ +V   LQN  FFQFG TNSI+T++L NAY+G+S +YNI
Sbjct: 667 YFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSISTIDLGNAYHGVSSDYNI 726

Query: 707 YVVGFLMCVSNFAPSIYWSLNCLKILY-SFPVKDKWKIFLASRMPSFLFYCIFGCFLLGS 765
           YVVG LM V+NFAP+IYWS+    I Y S   ++K + F+ S+MP+F ++CIFG  L+ +
Sbjct: 727 YVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSKMPAFTYHCIFGACLMTA 786

Query: 766 CVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           C+ LR+HLFIWSVFSPKLCY++ WN+ M  + GWL E  +L
Sbjct: 787 CIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPELAIL 827

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/820 (43%), Positives = 499/820 (60%), Gaps = 44/820 (5%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F   FFP+K VL G ++ +   D   Q +  F KLV ++IDALRSDF+F   +S+F  VH
Sbjct: 20  FIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIIDALRSDFLFDSHISHFNNVH 79

Query: 79  GLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLR 138
             LN G+AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L E DSWL+
Sbjct: 80  EWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQ 139

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQ-D 197
           QF  +N  I+F GDDTWLKLFPQE+FD TD T+SFFVSDF +VD NVTR+LP ++  +  
Sbjct: 140 QFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFTQVDNNVTRNLPGKIFQEWA 199

Query: 198 SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICVMGD 252
            WDV ILH+LGLDHIGHK G  S FM  K +EMD +++ +Y+ V      EDTLICV+GD
Sbjct: 200 QWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIYDQVLVHEHEEDTLICVLGD 259

Query: 253 HGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKND-DYSYVSKVNQ 311
           HGMN+LGNHGGSSAGETSAGL+F+S  L  + KP +Q + T PI    D D+ Y+  V Q
Sbjct: 260 HGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRTLPINAAPDRDFQYLETVQQ 319

Query: 312 IDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTIS---GDLMAN 368
           ID+VP+I++LF  PIP NS+G+++PD L+LL  K A +K  +N++ L  +S   GD   +
Sbjct: 320 IDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASIK--ENFMHLWKLSDHNGDFTLD 377

Query: 369 SSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITAIATFLLLKPTIS-----K 422
               D IY  M  IQ  L K+AT YNY +L   F S L IT IA + L + + S     +
Sbjct: 378 DLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIITIIAIYQLQRNSGSSLWQPR 437

Query: 423 PAXXXXXXXXXXXXXXXXXXXXXEEEHQLWWWLAIALTGAS---YTQAPSEIKEHXXXXX 479
            +                     EEEHQLWWW+  A +      Y      +        
Sbjct: 438 TSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVPLFVYNLNVFVVARWFIMMV 497

Query: 480 XXXXXXGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539
                  WNNSGQK+ Y + +  +L Q    +W L   T+      +    ++ F  + +
Sbjct: 498 CVRLIKFWNNSGQKFIYSNVMSNLLNQNPIWKWWLNLFTLLALIIASSRFQVLHFIVTTI 557

Query: 540 VSTLCLIYKATWSIVNGEK--VPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFK 597
           +  LC  YK +W IVNG +  +P ++  ++ K    +  E+N        L+ +AR+FF+
Sbjct: 558 LVGLCFTYKISWEIVNGNQAEIPIFMHDLLAK-IDFVPTESN--------LILLARVFFQ 608

Query: 598 TILAVTLLEIVLHKWNPDRKRFL-HNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESV 656
               V +  +VL K     K +L  +I+ Y T  LILQTS  NI QF+++ IL  ++   
Sbjct: 609 AWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSSQNIGQFIIFQILQSQIYYF 668

Query: 657 WRRREWSPSILM---------LAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIY 707
           ++    +P +L          L  ++LQN  FFQFG TNSI+T++L NAY+G+S +YN+ 
Sbjct: 669 FKSLP-APFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNSISTIDLGNAYHGVSSDYNMC 727

Query: 708 VVGFLMCVSNFAPSIYWSLNCLKILY-SFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSC 766
            VG LM ++NFAPSIYWS+    + Y S   + K + F+ S++P+F ++CIFG  L+ +C
Sbjct: 728 TVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIRSKLPAFTYHCIFGTCLMTAC 787

Query: 767 VILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLL 806
           + LR+HLFIWSVFSPKLCY++ WN  M  + GW+ E T+L
Sbjct: 788 IFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITELTVL 827

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  194 bits (494), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 177/326 (54%), Gaps = 27/326 (8%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS----NF 74
           F+ GF   ++VL   A F    DE +    KF+K V++++DALR DFV   D +    N 
Sbjct: 61  FTRGFLLSRTVLDNVASF----DETKDSYGKFDKAVILIVDALRFDFVIPVDTAAEGYND 116

Query: 75  EFVHGLLNRGQAWGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNL 130
            + + L    + W  +      ++PPT TL RLKG+TTGS P F+DA  N   D     +
Sbjct: 117 NYHNNLKVLYEYWDNSVLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGD-----V 171

Query: 131 KEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLP 190
             +D+ ++Q +++NK I F GDDTW  LF     + +    S  V D + VD  V  +  
Sbjct: 172 IVEDNLIKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYESLNVWDLDTVDNGVISYFE 231

Query: 191 KQLATQD----SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTL 246
           + L  +D     WDVLI H LG+DH+GHK G     M+ KQ+++D+ I +V  S+ EDTL
Sbjct: 232 EHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSEKQQQVDKFIRKVIASIDEDTL 291

Query: 247 ICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYV 306
           + VMGDHGM+  GNHGG S  E  + L   S+    ++      + T       ++Y   
Sbjct: 292 LVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAWKLKSPDQYNT---SRLGENY--- 345

Query: 307 SKVNQIDLVPSISSLFNFPIPKNSIG 332
            +VNQIDLVP++S L   PIP N++G
Sbjct: 346 RQVNQIDLVPTLSLLLGTPIPFNNLG 371

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  193 bits (490), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 187/360 (51%), Gaps = 35/360 (9%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS----NF 74
           F+ GF   + VL   +  N    E  ++ P+FNK V++VIDALR DF    + S    N 
Sbjct: 53  FTRGFLLSRHVLDNISSQN----ETSKLPPRFNKAVILVIDALRFDFAIPVNESHSNYNL 108

Query: 75  EFVHGLLNRGQAWGYTA---------YSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125
            + + +L+   ++              ++PPT TL RLKG+TTGS P F+DA  N     
Sbjct: 109 NYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF---- 164

Query: 126 SSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV 185
               + E+D++L+Q H+ NK +KF GDDTW+ LF     +++    S  V D + VD  V
Sbjct: 165 -DGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGV 223

Query: 186 TRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDT 245
             +    L     WDV+I H LG+DH+GHK G     M  KQ ++D+ I+ +  S+ +DT
Sbjct: 224 MDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSIDDDT 283

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
           L+ ++GDHGM+  GNHGG S  E  + L   S+  + +      N+    I     DY  
Sbjct: 284 LLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKETSNYN---IDNLGHDY-- 338

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLR-------LLSPKDAQLKLMDNYLQL 358
              V QIDLV S++ L   PIP N++G  + ++ R        ++   +QL+L  + +Q+
Sbjct: 339 -RSVRQIDLVSSLALLMGQPIPFNNLGWPIDEIARNDREWSQFVNSAISQLQLYKDTMQI 397

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 140/442 (31%), Positives = 214/442 (48%), Gaps = 58/442 (13%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS------ 72
           F+ GF   + VL      N  P +   I  KF+K V++++DALR DFV   D +      
Sbjct: 53  FTKGFLLSRQVLD-----NITPLDSNVIDAKFDKAVILIVDALRFDFVIPVDSTEHLNNN 107

Query: 73  ---NFEFVHGLLNRGQAWGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125
              N + ++     G + G +      ++PPT TL RLKG+TTGS P F+DA  N     
Sbjct: 108 YHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNF---- 163

Query: 126 SSSNLKEQDSWLRQFHIN-NKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFN 184
            + N+  +D+ +RQ   N N+ I F GDDTW  LF     + +    S  V D + VD  
Sbjct: 164 -NGNVIFEDNLIRQLSENLNREILFVGDDTWDALFHPFLSNNSLPYESLNVWDLDTVDNG 222

Query: 185 VTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGED 244
           V     + L   D WDVLI H LG+DH+GHK G     M  KQ +++  I+++ +S+  +
Sbjct: 223 VIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNTFIKKIIDSIDNN 282

Query: 245 TLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYS 304
           TL+ VMGDHGM+  GNHGG S  E  + L   ++     +K + + H+ F      D   
Sbjct: 283 TLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTK-----KKNIFRKHDDFTPYNITDLGK 337

Query: 305 YVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKL-------MDNYLQ 357
               VNQIDLV ++S L   PIP N++G  + ++      K+ ++K+       +  Y +
Sbjct: 338 NYRAVNQIDLVSTLSYLLGIPIPFNNLGWPIEEIFH---SKNDKIKMTKRVLDQLRTYQE 394

Query: 358 LTTIS---------GDLMANSSDQDVI----YQHMRDIQGDLAKNA----TKYNYFMLGF 400
           +  IS         G  M  S   D+I    Y+  +  Q  L +       +++Y+ +  
Sbjct: 395 IMGISFQDPESNENGRSMNESFFNDIIATGSYELGQKYQSILLEKCKDLWARFDYYSIAT 454

Query: 401 GFSLLFITAIATFLLLK--PTI 420
           G  LL I+     L+ K  P+I
Sbjct: 455 GLILLTISVTILILITKLIPSI 476

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  190 bits (483), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 213/420 (50%), Gaps = 51/420 (12%)

Query: 28  SVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSN----------FEFV 77
           S+L+ +  FN   D       KF+K V++VIDALR DFV   D SN          F+ +
Sbjct: 75  SILESNPIFNNPSD-----IAKFDKTVIVVIDALRFDFVIPVDESNPNYNPNYHNNFKVM 129

Query: 78  HGLLNRGQAWGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQ 133
           +   N   +   +      ++PPT TL RLKG+TTGS P F+DA  N        ++ E+
Sbjct: 130 YDHFNETSSADSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF-----DGSVIEE 184

Query: 134 DSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQL 193
           D+ ++Q ++NNK + F GDDTW  LF      ++    S  V D + VD  V  +  K+L
Sbjct: 185 DNLIKQMYLNNKTVYFVGDDTWDSLFHPFLSSKSQPFESLNVWDLDTVDNGVISYFEKEL 244

Query: 194 AT-------QDSWDVLILHFLGLDHIGHKGGAFSHF-MAPKQREMDEVIEQVYNSVGEDT 245
            +       +  WDVLI H LG+DH+GHK G  SHF M  KQ +++E + +V +S+ EDT
Sbjct: 245 ISKKNNQKEEKEWDVLIGHMLGMDHVGHKYGP-SHFSMKDKQLQLNEFVTKVIDSLDEDT 303

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
           L+ VMGDHGM+  GNHGG S  E  + L   S+  + +      N ET  +   N    +
Sbjct: 304 LLVVMGDHGMDHTGNHGGDSQDELESTLFLFSKKQQMWNLD-PDNQET--LYNVNKLGKH 360

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDL 365
             +VNQIDLVP++S L   PIP N++G  + ++ +         K + N L+  T +  +
Sbjct: 361 YRQVNQIDLVPTLSLLTGLPIPFNNLGWPIKEIAKNFDEDRFYTKAILNQLERYTHTIGI 420

Query: 366 MANSSDQDVIYQHM-----------RDIQGDLAKNA----TKYNYFMLGFGFSLLFITAI 410
              + ++  + + +            D Q +L +      T ++Y+ +  G  LL I+ I
Sbjct: 421 EPPTQEKKRLLEELWQQAQNDTTLGHDYQIELLQLYRDLWTNFDYYSIATGICLLTISVI 480

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/300 (37%), Positives = 165/300 (55%), Gaps = 26/300 (8%)

Query: 49  KFNKLVLIVIDALRSDFVFQKDMSNFEF-------VHGLLN----RGQAWGYTAYSNPPT 97
           KF+K V++VIDALR DFV   D S+ +        +  L N    +G +  +   ++PPT
Sbjct: 77  KFDKAVVLVIDALRFDFVIPVDESHPQHNPNYHNNIKALWNDESLKGSSLLFKFIADPPT 136

Query: 98  VTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLK 157
            TL RLKG+TTGS P F+DA  N        ++ E+D+ ++Q ++  K + F GDDTW  
Sbjct: 137 TTLQRLKGLTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQLYLAQKNVYFAGDDTWSA 191

Query: 158 LFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQL-----ATQDSWDVLILHFLGLDHI 212
           LF      +++   S  V D + VD  V  +  + L          WDVL+ H LG+DH+
Sbjct: 192 LFHPFLSAQSEPYPSLNVWDLDTVDNGVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHV 251

Query: 213 GHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAG 272
           GHK G     M  KQ ++DE I ++  ++ +DTL+ VMGDHGM+  GNHGG S  E  + 
Sbjct: 252 GHKYGPNHFTMREKQLQVDEFIRKIIAAIDKDTLLIVMGDHGMDHTGNHGGDSIDELEST 311

Query: 273 LIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           L   S+  + ++    ++   + +     +Y    +VNQIDLVP++S L N PIP NS+G
Sbjct: 312 LFLYSKRPDMWQP--NEDPNVYDVSDLGKNY---KQVNQIDLVPTLSLLLNLPIPFNSLG 366

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 172/339 (50%), Gaps = 40/339 (11%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS------ 72
           F+ GF   ++VL   +      D    +  KF+K+VL+V+DALR DFV     S      
Sbjct: 53  FAKGFLLSRTVLDNVST---TSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNE 109

Query: 73  ----NFEFVHGLLNRGQAWGYTAYSN------------PPTVTLPRLKGITTGSTPNFLD 116
               N + ++      +  G   YSN            PPT TL RLKG+TTGS P F+D
Sbjct: 110 NFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLTTGSLPTFID 169

Query: 117 AILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVS 176
           A  N        ++ E+D+ ++Q  + NK + F GDDTW  LF     + ++   S  V 
Sbjct: 170 AGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVW 224

Query: 177 DFEEVDFNVTRHLPKQL---ATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEV 233
           D + VD  V  +    L   +   +WD+L+ H LG+DH+GHK G     M  KQ +++  
Sbjct: 225 DLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRF 284

Query: 234 IEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHET 293
           I+++  S+  DTL+ VMGDHGM+  GNHGG S  E  + L F ++     +      +  
Sbjct: 285 IQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTK----RQNTWKNQNGN 340

Query: 294 FPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           + I+    +Y     VNQIDLVP++S L + P+P N++G
Sbjct: 341 YDIENLAQNY---HSVNQIDLVPTLSLLLDIPVPFNNLG 376

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  186 bits (472), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/336 (35%), Positives = 176/336 (52%), Gaps = 43/336 (12%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS------ 72
           F+ GF   ++VL+  A      D +     +F+K V++VIDALR DF    D +      
Sbjct: 59  FARGFLLTRTVLENVAT---GADHE----ARFSKCVILVIDALRFDFSIPVDPADNAFNS 111

Query: 73  ----NFEFVHGLLNRGQAWGYTAY-----SNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123
               N + +H   N   +  +++      ++PPT TL RLKG+TTGS P F+DA  N   
Sbjct: 112 YFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF-- 169

Query: 124 DDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDF 183
              +  + E+D+ ++Q  +NN+ + F GDDTW  LF       +    S  V D + VD 
Sbjct: 170 ---NGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFESLNVWDLDTVDN 226

Query: 184 NVTRHLPKQLATQ----DSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYN 239
            V R     L  +    + WDVLI H LG+DH+GHK G     M  KQ + +E I+++  
Sbjct: 227 GVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIKRICE 286

Query: 240 SVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNH---ETFPI 296
           S+ +DTL+ VMGDHGM+  GNHGG S  E  A L   S+      +P   +H   + + I
Sbjct: 287 SIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSK------RPNMWSHLPEQFYDI 340

Query: 297 KTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
               ++Y    +VNQIDLVP++S L   PIP N++G
Sbjct: 341 SALGENY---RQVNQIDLVPTLSLLLGLPIPFNNLG 373

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  182 bits (461), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 202/401 (50%), Gaps = 45/401 (11%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKD-------- 70
           F+ GF   ++VL+  A             PKF+K V++VIDALR DF    D        
Sbjct: 63  FARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFSIPIDPQENGYNP 115

Query: 71  --MSNFEFVH-GLLNRGQAWGYTAY-SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDS 126
              +N +  H G  ++  +     + S+PPT TL RLKG+TTGS P F+DA  N      
Sbjct: 116 YYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDAGSNF----- 170

Query: 127 SSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV- 185
           +  + E+D+ ++Q ++NNK I F GDDTW  LF       +    S  V D + VD  V 
Sbjct: 171 NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDLDTVDNGVI 230

Query: 186 ---TRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVG 242
                HL      +  WDVLI H LG+DH+GHK G     M  KQ + +E I+++   + 
Sbjct: 231 DYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIKRICEKLD 290

Query: 243 EDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNH---ETFPIKTK 299
           +DTL+ VMGDHGM+  GNHGG S  E  A L   S       KP   NH   + +     
Sbjct: 291 DDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYST------KPDMWNHLPQDAYNTSVL 344

Query: 300 NDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQL--KLMDNYLQ 357
            +++    +VNQIDLV ++S L   PIP N++G  + +V    SP++ +L  +   N ++
Sbjct: 345 GENH---REVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVKLFSETALNQIR 399

Query: 358 LTTISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFML 398
               + +++ +S   +++   + D   D++ +A +Y    L
Sbjct: 400 AYKDASNVITSSDKNELLNTLLADAMKDIS-HAPEYQRVFL 439

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  186 bits (471), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 178/328 (54%), Gaps = 31/328 (9%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F+ GF   ++VL   AE     D Q     K++K+VL+++DALR DFV   D ++ ++  
Sbjct: 61  FAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNP 116

Query: 79  GLLNRGQAWGYTAY-----------SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS 127
              N  +    TA+           ++PPT TL RLKG+TTGS P F+DA  N   D   
Sbjct: 117 NYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGD--- 173

Query: 128 SNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTR 187
             + ++D+ ++Q +++NK+I F GDDTW  LF      E+    S  V D + VD  V  
Sbjct: 174 --VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVIS 231

Query: 188 HLPKQLATQD---SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGED 244
           +L +    ++    +D+LI H LG+DH+GHK G     M  KQ ++DE++ ++ ++  ++
Sbjct: 232 YLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDN 291

Query: 245 TLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYS 304
           TL  VMGDHGM+  GNHGG S  E       +  +L  Y K    + +     T +   S
Sbjct: 292 TLYVVMGDHGMDHTGNHGGDSQDE-------LESVLWLYAKNANWSKDYDSYNTTDLGTS 344

Query: 305 YVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           Y  ++NQIDLVP++S L   PIP N++G
Sbjct: 345 Y-KQMNQIDLVPTLSLLLGIPIPFNNLG 371

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  185 bits (470), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 183/353 (51%), Gaps = 28/353 (7%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS----NF 74
           F+ GF   + VL   +  N    E   + P+FNK V++VIDALR DFV   D S    N 
Sbjct: 53  FTRGFLLSRHVLDNISTQN----ETTTLHPRFNKTVVLVIDALRFDFVIPVDESGSNHNL 108

Query: 75  EFVHGLLNRGQAWGYTA---------YSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125
            + + +L+   ++              ++PPT TL RLKG+TTGS P F+DA  N     
Sbjct: 109 NYHNNILSLYDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF---- 164

Query: 126 SSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV 185
               + E+D+ L+Q H+ NK +KF GDDTW+ LF     +++    S  V D + VD  V
Sbjct: 165 -DGTVIEEDNLLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDSVDKGV 223

Query: 186 TRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDT 245
             +    L     WDV+I H LG+DH+GHK G     M  KQ ++DE I  +  S+ E+T
Sbjct: 224 MDYFHDHLQQDQEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVDEFINWILKSIDENT 283

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
           L+ ++GDHGM+  GNHGG S  E  + L   S+    ++   + N++   I     DY  
Sbjct: 284 LLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNLWKLKDSSNYD---ISALGRDY-- 338

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQL 358
              V QIDLV S+S L   PIP N++G  + ++ R  +     + L  N LQL
Sbjct: 339 -RSVRQIDLVSSLSLLLGQPIPFNNLGWPIDEIARNDNEWSEFVGLAINQLQL 390

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  185 bits (469), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 132/401 (32%), Positives = 204/401 (50%), Gaps = 45/401 (11%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKD-------- 70
           F+ GF   ++VL+  A             PKF+K V++VIDALR DF    D        
Sbjct: 63  FARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFSIPIDPQENGYNP 115

Query: 71  --MSNFEFVH-GLLNRGQAWGYTAY-SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDS 126
              +N +  H G  ++  +     + S+PPT TL RLKG+TTGS P F+DA  N      
Sbjct: 116 YYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDAGSNF----- 170

Query: 127 SSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVT 186
           +  + E+D+ ++Q ++NNK I F GDDTW  LF       +    S  V D + VD  V 
Sbjct: 171 NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDLDTVDNGVI 230

Query: 187 RHLPKQLAT----QDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVG 242
            +  + L +    +  WDVLI H LG+DH+GHK G     M  KQ + +E I+++   + 
Sbjct: 231 DYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIKRICEKLD 290

Query: 243 EDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNH---ETFPIKTK 299
           +DTL+ VMGDHGM+  GNHGG S  E  A L   S       KP   NH   + +     
Sbjct: 291 DDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYS------TKPDMWNHLPQDAYNTSVL 344

Query: 300 NDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQL--KLMDNYLQ 357
            +++    +VNQIDLV ++S L   PIP N++G  + +V    SP++ +L  +   N ++
Sbjct: 345 GENH---REVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVKLFSETALNQIR 399

Query: 358 LTTISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFML 398
               + +++ +S   +++   + D   D++ +A +Y    L
Sbjct: 400 AYKDASNVITSSDKNELLNTLLADAMKDIS-HAPEYQRVFL 439

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  185 bits (470), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 120/337 (35%), Positives = 169/337 (50%), Gaps = 45/337 (13%)

Query: 19  FSAGFFPQKSVL----KGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFV-------- 66
           FS GF   + VL    K D++   Q       SPKF++ V++++DALR DFV        
Sbjct: 53  FSRGFLLSRHVLDNISKADSQLTLQS------SPKFDRAVVLIVDALRFDFVIPIEKEKA 106

Query: 67  -----------FQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFL 115
                      + K M N E    LL +  A       +PPT TL RLKG+TTGS P F+
Sbjct: 107 NSNYHNNINIMYDKFMDNSESCSSLLLKFMA-------DPPTTTLQRLKGLTTGSLPTFI 159

Query: 116 DAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFV 175
           DA  N   D       E+D+ ++Q ++++K + F GDDTW  LF     + +    S  V
Sbjct: 160 DAGSNFNGDT-----IEEDNLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLNV 214

Query: 176 SDFEEVDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIE 235
            D + VD  V       + +++ WDVL+ H LG+DH+GHK G     M  KQ +++E I 
Sbjct: 215 WDLDTVDNGVISFFNDHIHSKE-WDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIH 273

Query: 236 QVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFP 295
            V  S+ +DTL+ VMGDHGM+  GNHGG S  E  + L   S+    +      N   + 
Sbjct: 274 YVMQSLDDDTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGAMTDGNQSIYN 333

Query: 296 IKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           I      Y     VNQIDLV ++S +   PIP N++G
Sbjct: 334 ISDYGSSY---RSVNQIDLVSTLSLMLGTPIPFNNLG 367

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  184 bits (467), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/380 (33%), Positives = 198/380 (52%), Gaps = 42/380 (11%)

Query: 41  DEQRQISPKFNKLVLIVIDALRSDFVF----------QKDMSNF-----EFVHGLLNRGQ 85
           D  +  + KF+K V+++IDALR DFV           Q   +N      +F+    N+  
Sbjct: 64  DLNQDYTKKFDKAVILIIDALRFDFVIPVNSTDPLHNQNYHNNIITLYDQFISQNNNKDH 123

Query: 86  AWGYTAY-SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINN 144
           +     + ++PPT TL RLKG+TTGS P F+DA  N        ++ E+D+ ++Q ++ N
Sbjct: 124 SSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGTNF-----DGSVIEEDNLIKQLYLKN 178

Query: 145 KRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTR----HLPKQLATQDSWD 200
           + I F GDDTW  LF     + +    S  V D + VD  V      HL  Q      WD
Sbjct: 179 EEIYFVGDDTWDSLFNPFLSNHSKPFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWD 238

Query: 201 VLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGN 260
           +LI H LG+DH+GHK G     M  KQ +++  I  +  S+ +DTL+ +MGDHGM+  GN
Sbjct: 239 ILIGHMLGVDHVGHKYGPNHFTMREKQLQVNNFINDIIESIDDDTLLVIMGDHGMDHTGN 298

Query: 261 HGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSISS 320
           HGG S  E  + L   S+  + +E     N+    I+   D+Y     VNQIDLVP++S 
Sbjct: 299 HGGDSKDELESTLFMYSKKTDVWELGDPNNYN---IENSGDNY---RSVNQIDLVPTLSL 352

Query: 321 LFNFPIPKNSIGVVMPDVLRLLSPKDA----QLKLMDNYLQLTTISGDLMANSSDQDVIY 376
           L + PIP N++G  + ++ +  + ++      LK + NY +   +SG L+ N++++   Y
Sbjct: 353 LLDVPIPFNNLGWPINEISKNQNERNIFEQLTLKQLKNYQE---VSG-LVVNNTEK---Y 405

Query: 377 QHMRDIQGDLAKNATKYNYF 396
            H+  +  D   +++K   F
Sbjct: 406 FHLEQLYQDSLIDSSKATIF 425

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/336 (36%), Positives = 177/336 (52%), Gaps = 30/336 (8%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           F+ GF   + VL   +  N    E   + P+FNK V++VIDALR DF    + S+ +   
Sbjct: 53  FTRGFLLSRHVLDNISSRN----ETSDLPPRFNKAVVLVIDALRFDFAIPVNESDPDHNP 108

Query: 79  GLLNRGQAWGYTAYSN--------------PPTVTLPRLKGITTGSTPNFLDAILNVAED 124
              N   +  Y +++N              PPT TL RLKG+TTGS P F+DA  N    
Sbjct: 109 NYHNNILSL-YDSFTNDKNSSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF--- 164

Query: 125 DSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFN 184
                + E+D+ L+QF + NK +KF GDDTW  LF     +++    S  V D + VD  
Sbjct: 165 --DGTIIEEDNLLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLNVWDLDTVDNG 222

Query: 185 VTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGED 244
           V  +    L     WDV+I H LG+DH+GHK G     M  KQ ++D  I+ + NS+ +D
Sbjct: 223 VMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDRFIDWILNSIDDD 282

Query: 245 TLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYS 304
           TL+ ++GDHGM+  GNHGG S  E  + L   S+  E +    A N+      T +  Y+
Sbjct: 283 TLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPEMWRLKDAFNY-----NTSDSGYN 337

Query: 305 YVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLR 340
           Y S V QIDLV S+S L + PIP N++G  + ++ R
Sbjct: 338 YRS-VRQIDLVSSLSLLLDQPIPFNNLGWPIDEIAR 372

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  182 bits (463), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 188/369 (50%), Gaps = 36/369 (9%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS----NF 74
           F+ GF   + VL   +  N     +  I P+FNK V++V+DALR DFV   + S    N 
Sbjct: 53  FTRGFLLSRHVLDNISALN-----ETSIPPRFNKAVVLVVDALRFDFVIPVNESSSNHNL 107

Query: 75  EFVHGLLNRGQAWGYTA---------YSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125
            + + +L+   ++              ++PPT TL RLKG+TTGS P F+DA  N     
Sbjct: 108 NYHNNILSLYDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF---- 163

Query: 126 SSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV 185
               + E+D+ L+Q H+ NK +KF GDDTW+ LF     +++    S  V D + VD  V
Sbjct: 164 -DGTVIEEDNLLKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGV 222

Query: 186 TRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDT 245
             +    L     WDV+I H LG+DH+GHK G     M  KQ ++D+ I  +  S+ +DT
Sbjct: 223 MDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQFQVDQFIAWILKSIDDDT 282

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
           L+ ++GDHGM+  GNHGG S  E  + L   S+    +    A N+    I     DY  
Sbjct: 283 LLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNMWNFKDASNYN---ITNLGCDY-- 337

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLR-------LLSPKDAQLKLMDNYLQL 358
              V QIDLV S+S L   PIP N++G  + ++ R        +S    QL+L  + +Q+
Sbjct: 338 -RSVRQIDLVSSLSLLLGQPIPFNNLGWPIDEIARNDVERSQFVSSAINQLQLYKDTMQI 396

Query: 359 TTISGDLMA 367
              S +++ 
Sbjct: 397 HHSSDEILG 405

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  182 bits (462), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 172/332 (51%), Gaps = 33/332 (9%)

Query: 19  FSAGFFPQKSVLKGDAEF-NFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFV 77
           F  GF   ++VL   A   ++Q  E      KFNK V++V+DALR DFV   + SN ++ 
Sbjct: 53  FLKGFLLTRNVLDNVATLADYQSIENYG---KFNKSVILVVDALRFDFVIPVNQSNPDYN 109

Query: 78  HGLLNRGQAWGYTAY--------------SNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123
               N  +   Y  +              ++PPT TL RLKG+TTGS P F+DA  N   
Sbjct: 110 DYYHNNLKVL-YEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNF-- 166

Query: 124 DDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDF 183
                ++ E+D+ ++Q  +N+K++ F GDDTW  LF       +    S  V D + VD 
Sbjct: 167 ---DGSVIEEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWDLDTVDN 223

Query: 184 NVTRHLPKQL---ATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240
            V       L       SW+VLI H LG+DH+GHK G     M  KQ ++D+ I ++ +S
Sbjct: 224 GVISFFNDHLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKFIREIMDS 283

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
           + +DTL+ +MGDHGM+  GNHGG S  E  + L   S+    +      N++T   + + 
Sbjct: 284 IDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRNNAWNLQDTSNYDT---RNQG 340

Query: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           D Y     VNQIDLV ++S L   PIP N++G
Sbjct: 341 DRY---RSVNQIDLVSTLSFLLGLPIPFNNLG 369

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  182 bits (462), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 216/448 (48%), Gaps = 64/448 (14%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVF----------Q 68
           F+ GF   +S ++  A+++ +  E +    KF+K V++++DALR DFV           +
Sbjct: 60  FTKGFSFCRSPIRHTAQYSPEYSEVK----KFDKAVVLLVDALRFDFVVPINELDPIYNE 115

Query: 69  KDMSNFEFVHGLLN----------------RGQAWGYTAYSNPPTVTLPRLKGITTGSTP 112
              +N + +  LLN                +  +  +   + PPT T  RLKGITTG  P
Sbjct: 116 NYHNNIDIISELLNQNDNSTKNESKKDRVQKSSSLLFKFLAEPPTTTFHRLKGITTGLLP 175

Query: 113 NFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNS 172
           +FLD I+ + +      + E DS ++Q  + NK I F GDDTW ++F      ++    S
Sbjct: 176 SFLDGIMKLND-----RVVEDDSIIKQLFLRNKTIYFSGDDTWSRMFEPYLSPKSVPLES 230

Query: 173 FFVSDFEEVDFNVTR----HLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQR 228
           + + D   VD  V +    HL  +  +   WD+LI H +G+DH   K G     +  KQ 
Sbjct: 231 YNIWDLNTVDDGVFKFFNEHLTSKNTSNREWDILIGHIVGIDHAATKYGPNHITVKQKQI 290

Query: 229 EMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLA 288
           +++E I+Q+  S+ + TL+ VMGDHGM+  GNHGG S+GE  + L   S+    ++    
Sbjct: 291 QINEFIKQIVKSLDDQTLLIVMGDHGMDITGNHGGKSSGELESSLFLYSKKSSVWK---- 346

Query: 289 QNHETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQ 348
           Q H    +   N+D  +  K+NQID+VP+ S LF  PIP N++G  + ++       +  
Sbjct: 347 QEHS---LHENNND--FYKKINQIDIVPTFSLLFGIPIPYNNLGWPINEISLSDEENNIH 401

Query: 349 LKLMDNYLQLTTISGDLMANSSDQDVIYQHMRDIQGDLAK--------------NATKYN 394
           +KL    ++   +  D++ +  D + +       + D+ K              N   ++
Sbjct: 402 MKLALEQIRKYQLDSDIIQDKKDNNTLNTLYEQAKLDINKTHAFYEAVLSAFKSNWKSFD 461

Query: 395 YFMLGFGFSLLFITAIATFLLLK--PTI 420
           Y  +G G  LL ++     ++ K  P+I
Sbjct: 462 YLSIGTGIFLLLVSVTLLIIITKLIPSI 489

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 172/331 (51%), Gaps = 35/331 (10%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVF----QKDMSNF 74
           F+ GF   + VL   A        ++     F+K V++V+DALR DFV      +D  N 
Sbjct: 58  FTRGFLLTRHVLDNVAT-------KKSEYGTFDKAVVLVVDALRFDFVIPVSETQDYYNE 110

Query: 75  EFVHGL---------LNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125
            + + L         ++   +      ++PPT TL RLKG+TTGS P F+DA  N     
Sbjct: 111 NYHNNLEVLYEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF---- 166

Query: 126 SSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV 185
            +  + E+D+ ++Q  +N+K + F GDDTW  LF     +++    S  V D + VD  V
Sbjct: 167 -NGEVIEEDNLIKQMFLNDKTVFFAGDDTWNALFSPFLAEQSRPYESLNVWDLDTVDNGV 225

Query: 186 T----RHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV 241
                 HL ++   Q  WDVLI H LG+DH+GHK G     M  KQ ++D  I Q+  S+
Sbjct: 226 ISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMREKQLQVDNFIRQIMESI 285

Query: 242 GEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKND 301
            EDTL+ ++GDHGM+  GNHGG S  E  + L   S+    ++     + ET+       
Sbjct: 286 DEDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSKKHGMWDH---YSDETYDTSELGK 342

Query: 302 DYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332
           +Y    +VNQIDLVP++S L   PIP N++G
Sbjct: 343 NY---RQVNQIDLVPTLSLLLGLPIPFNNLG 370

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  180 bits (457), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 193/386 (50%), Gaps = 45/386 (11%)

Query: 49  KFNKLVLIVIDALRSDFVFQKDM------SNFE------FVHGLLNRGQAWGYTAYSNPP 96
           KF+K V++++DALR DFV   D        NF       +     ++G +      ++ P
Sbjct: 76  KFDKAVVLIVDALRFDFVIPVDQDHQGYSGNFHNNIDVLYESMFADQGSSLLLKFIADAP 135

Query: 97  TVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
           TVTL RLKG+TTGS P F+DA  N        ++ E+D+ ++Q +   K+I F GDDTW 
Sbjct: 136 TVTLQRLKGLTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQMYEQGKQIYFAGDDTWE 190

Query: 157 KLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQL---ATQDSWDVLILHFLGLDHIG 213
            LF       +    SF V D + VD  V  +  + L   A +D WDVLI H LG+DH+G
Sbjct: 191 SLFSPFLSPRSKYYESFNVWDLDTVDNGVISYFNEHLLETANRD-WDVLIGHMLGVDHVG 249

Query: 214 HKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGL 273
           HK G     M  KQ ++++ + ++  ++ +DTL+ +MGDHGM+  GNHGG S  E  + L
Sbjct: 250 HKYGPNHFTMREKQLQVNDFLIKIKETIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTL 309

Query: 274 IFISRL--LEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSI 331
              S+   + G   P   N          D  +Y  +VNQIDLVP++S L   PIP N++
Sbjct: 310 FLYSKRPNMWGLNDPSQYN--------TTDLGAYYREVNQIDLVPTLSILMGLPIPFNNL 361

Query: 332 GVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMANSSDQDVIYQHMRDIQGDLAKNA- 390
           G  + ++      +D   ++    L+L   + +++ N     ++     +  G+ +  A 
Sbjct: 362 GWPIEEIATSSEERDLYARIALEQLELYKKTSNMVTNPEKSTMLENAWIEAMGNPSLGAA 421

Query: 391 -------------TKYNYFMLGFGFS 403
                        T+++Y+ +G G +
Sbjct: 422 YQRQFLEVCKDLWTRFDYWSIGTGIT 447

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 157/308 (50%), Gaps = 34/308 (11%)

Query: 49  KFNKLVLIVIDALRSDFVFQKDMSNFEFVHGLLNR-----------------GQAWGYTA 91
           KF K V++VIDALR DFV   + +N  +     N+                   +     
Sbjct: 80  KFEKTVILVIDALRFDFVIPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKF 139

Query: 92  YSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFG 151
            ++PPT TL RLKG+TTGS P F+DA       +    + E+D+ ++Q ++NNK + F G
Sbjct: 140 LADPPTTTLQRLKGLTTGSLPTFIDA-----GSNFDGTVIEEDNLIKQMYLNNKEVFFVG 194

Query: 152 DDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQDS-------WDVLIL 204
           DDTW  LF     + +    S  V D + VD  V  +    L   +        W+VLI 
Sbjct: 195 DDTWDALFSPFLSNHSIPYESLNVWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIG 254

Query: 205 HFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGS 264
           H LG+DH+GHK G     M  KQ +++  I  + N + +DTL+ +MGDHGM+  GNHGG 
Sbjct: 255 HMLGVDHVGHKYGPNHFTMKEKQLQVNNFINDIINVIDDDTLLVIMGDHGMDHTGNHGGD 314

Query: 265 SAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNF 324
           S  E  + L   S+    ++  L  +H  + I     +Y     +NQIDLVP+++ L + 
Sbjct: 315 SIDELESTLFLYSKRQNVWK--LEDDHSVYNIDDLGSNY---KSINQIDLVPTLALLLDI 369

Query: 325 PIPKNSIG 332
           PIP N++G
Sbjct: 370 PIPFNNLG 377

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  174 bits (441), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 138/444 (31%), Positives = 223/444 (50%), Gaps = 61/444 (13%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNFEFVH 78
           FS GF   ++VL   +  N  P+      P+F+K V++++DALR +FV   D+ + ++  
Sbjct: 72  FSRGFLLTRNVLDNISTDN-NPNSILNDKPQFDKTVILIVDALRFNFVIPVDVDSMDYNP 130

Query: 79  GLLNRGQAWGYTAYSN--------------PPTVTLPRLKGITTGSTPNFLDAILNVAED 124
              N      Y  + N              PPT T+ RLKG+TTG+ P F+DA  N    
Sbjct: 131 NYHNNIDVL-YDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLTTGTLPTFIDAGSNF--- 186

Query: 125 DSSSNLKEQDSWLRQFHINN--KRIKFFGDDTWLKLFP----QEFFDETDGTNSFFVSDF 178
           D S  L  +D+ ++Q ++N     I F GDDTW  LF     Q+F    D  N   V D 
Sbjct: 187 DGSVIL--EDNLIKQLYLNKFWNDIYFVGDDTWDALFKPYLNQQFSRPFDSLN---VWDL 241

Query: 179 EEVDFNVTRHLPKQLATQDSWD-----VLILHFLGLDHIGHKGGAFSHFMAPKQREMDEV 233
           + VD  V  +  + L  Q S D      LI H LG+DH+GHK G     M  KQ ++++ 
Sbjct: 242 DTVDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHFTMKEKQLQINQF 301

Query: 234 IEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHET 293
           ++++ NS+ ++TL+ VMGDHGM+  GNHGG S  E  + L   ++    +   L +++ET
Sbjct: 302 LKEIINSIDDNTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAKKKNSFT--LDKDYET 359

Query: 294 -FPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLM 352
            + I    + Y    +VNQIDLVP++S L +  IP NS+G  + ++    +    QL++ 
Sbjct: 360 SYNISNFGESY---KQVNQIDLVPTLSLLLDLQIPFNSLGWPIDEI----AQNSQQLEMF 412

Query: 353 DNYL--QLTTI--SGDLMANSSDQDVIYQHM------RDIQGDLAKNA----TKYNYFML 398
            N    QL T   + +L+ +  +++++   +       D Q  L +       +++Y  +
Sbjct: 413 QNITVQQLHTFKETSNLLTSDDERNLLLDELFEKNLYHDYQIQLLEVCKDLWARFDYISI 472

Query: 399 GFGFSLLFITAIATFLL--LKPTI 420
             G + LFI+ +   +L  L P+I
Sbjct: 473 AIGITFLFISLVYLIILTQLIPSI 496

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 171/327 (52%), Gaps = 30/327 (9%)

Query: 19  FSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMS----NF 74
           F+ GF   + VL   A       ++     KF++LVL+V+DALR DFV   D++    N 
Sbjct: 61  FTRGFLLSRKVLDDVAN-----RDESTAPAKFDRLVLLVVDALRFDFVIPVDVAAEGYNS 115

Query: 75  EFVHGLLNRGQAWGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNL 130
            + + L    + W  +      ++PPT TL RLKG+TTGS P F+DA  N      +  +
Sbjct: 116 HYHNHLRALYERWDESILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNF-----NGIV 170

Query: 131 KEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTR--- 187
            ++   ++Q  + NK I F GDDTW  LF     + +    S  V D + VD  V     
Sbjct: 171 IDEGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLNVWDLDTVDNGVISFFE 230

Query: 188 -HLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHF-MAPKQREMDEVIEQVYNSVGEDT 245
            HL      +  WDVL+ H LG+DH+GHK G  SHF MA KQ ++D  I Q+ ++V EDT
Sbjct: 231 DHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGP-SHFSMAEKQSQVDGFIRQIIDAVDEDT 289

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
           L+ VMGDHGM+  GNHGG S  E  + L   ++    + +     + T  +        Y
Sbjct: 290 LLVVMGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQAPAAYNTTELG------RY 343

Query: 306 VSKVNQIDLVPSISSLFNFPIPKNSIG 332
              VNQIDLVPS+S L   PIP N++G
Sbjct: 344 YRAVNQIDLVPSLSLLLGLPIPFNNLG 370

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 126/334 (37%), Gaps = 62/334 (18%)

Query: 38  FQPDEQRQISPKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGY 89
           F+ +E+    P   +L LIV D LR+D  F K        + F   ++  L+     +G 
Sbjct: 40  FKSNEE----PPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYGI 95

Query: 90  TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS------SNLKEQDSWLRQFHIN 143
           +    P            T S P  +  I    ED S+       N  + DS   Q    
Sbjct: 96  SHTRMP------------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSVFNQ---- 139

Query: 144 NKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQL--A 194
           +     FG    L +F     D T      +  +FE       E+D  V RH+      A
Sbjct: 140 STHTYSFGSPDILPMFKSGASDPTKVDAWMYGHEFEDFTQSSIELDAYVFRHMDALFRNA 199

Query: 195 TQDS---------WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGE-- 243
           T DS          +V  LH LG D  GH    +S       + +D  +E++   V E  
Sbjct: 200 TVDSKLRHEMMQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFF 259

Query: 244 ---DTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300
              DT      DHGM+  G+HG      T   L+       G  +P+  +   +   T+N
Sbjct: 260 GDDDTAFVFTADHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNRPVLNDVPVYDNYTEN 316

Query: 301 DDYSYVSK--VNQIDLVPSISSLFNFPIPKNSIG 332
            D ++V +  VNQ D+   +S L     P NS+G
Sbjct: 317 WDLAHVRRNDVNQADIASLMSYLIGLNYPTNSVG 350

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 122/329 (37%), Gaps = 58/329 (17%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGYTAYSN 94
           Q   +P   +L LIV D LR+D  F K        + F   F+  L+     +G +    
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGISHTRM 100

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS------SNLKEQDSWLRQFHINNKRIK 148
           P            T S P  +  I    ED S+      SN  + DS+  Q    +    
Sbjct: 101 P------------TESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFNQ----SAHTY 144

Query: 149 FFGDDTWLKLFPQEFFDET-------DGTNSFFVSDFEEVDFNVTRHLPK---------- 191
            FG    L +F     D         D T   F     E+D  V RHL +          
Sbjct: 145 SFGSPDILPMFRDGASDPNKVDTWMYDHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNST 204

Query: 192 -QLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-T 245
                +   +V  LH LG D  GH    +S       + +D+    +IE+V     +D T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKT 264

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
                 DHGM+  G+HG      T   LI       G  KP+  ++  F   T+N + S 
Sbjct: 265 AFVFTADHGMSAFGSHGDGHPNNTRTPLIAWG---AGLNKPVHNSYPVFDNYTENWELSN 321

Query: 306 VSK--VNQIDLVPSISSLFNFPIPKNSIG 332
           + +  + Q D+   +S L     PKNS+G
Sbjct: 322 IKRNDIKQADIASLMSYLIGVNYPKNSVG 350

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 131/347 (37%), Gaps = 60/347 (17%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQKDMSNFE--------FVHGLLNRGQAWGYTAYSNPPTV 98
           +P   +L LIV D LR+D  F K              F+  L+     +G +    P   
Sbjct: 156 TPPAKRLFLIVGDGLRADTTFDKITHPVSGETTYLAPFIRSLVKNNATYGISHTRMP--- 212

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDSS------SNLKEQDSWLRQFHINNKRIKFFGD 152
                    T S P  +  I    ED S+       N  + DS+  Q    +     FG 
Sbjct: 213 ---------TESRPGHVAMIAGFYEDVSAVTKGWQENPVDFDSFFNQ----SAHTYSFGS 259

Query: 153 DTWLKLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQL--ATQDS----- 198
              L +F +   D        +  +FE       E+D  V RHL +    +T D+     
Sbjct: 260 PDILPMFKEGASDPHRVDAWMYGHEFEDFTQSSIELDAYVFRHLDQLFHNSTVDTALREE 319

Query: 199 ----WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-TLICV 249
                +V  LH LG D  GH    +S       R +DE    ++E+V +  G+D T    
Sbjct: 320 IMQHGNVFFLHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKVRDFFGDDDTAFIF 379

Query: 250 MGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK- 308
             DHGM+  G+HG      T   L+       G   P+      +   T   D + V + 
Sbjct: 380 TADHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNTPVRNEKPEYDNYTATWDLAEVRRN 436

Query: 309 -VNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDN 354
            VNQ D+   ++ L     P NS+G +   +  L   ++A+LK + N
Sbjct: 437 DVNQADIASLMAYLIGTNYPANSVGEL--PLAYLAGTEEAKLKALYN 481

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 122/329 (37%), Gaps = 58/329 (17%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGYTAYSN 94
           Q   +P   +L LIV D LR+D  F K        + F   F+  L+     +G +    
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGISHTRM 100

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS------SNLKEQDSWLRQFHINNKRIK 148
           P            T S P  +  I    ED S+      SN  + DS+  Q    +    
Sbjct: 101 P------------TESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFNQ----STHTY 144

Query: 149 FFGDDTWLKLFPQEFFDET-------DGTNSFFVSDFEEVDFNVTRHLPK---------- 191
            FG    L +F     D         D T   F     E+D  V +HL +          
Sbjct: 145 SFGSPDILPMFKDGASDPNKVDAWMYDHTFEDFTQSSIELDAYVFKHLDQLFRNSTLNST 204

Query: 192 -QLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-T 245
                +   +V  LH LG D  GH    +S       + +D+    +IE+V     +D T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKT 264

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSY 305
                 DHGM+  G+HG      T   L+       G  KP+  ++  F   T+N + S 
Sbjct: 265 AFVFTADHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVHTSYPVFDNYTENWELSS 321

Query: 306 VSK--VNQIDLVPSISSLFNFPIPKNSIG 332
           + +  V Q D+   +S L     PKNS+G
Sbjct: 322 IKRNDVKQADIASLMSYLIGVNYPKNSVG 350

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/321 (25%), Positives = 115/321 (35%), Gaps = 52/321 (16%)

Query: 48  PKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGYTAYSNPPTVT 99
           P   +L LIV D LR+D  F K        + F   F+  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITYPSAGEAEFLAPFIRSLVMNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWLK 157
                   T S P  +  I    ED S  +   KE           +     FG    L 
Sbjct: 102 --------TESRPGHVSMIAGFYEDVSAVTKGWKENPVNFDSVFNQSAHTYSFGSPDILP 153

Query: 158 LFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQLAT------------QDS 198
           +F     D    +   +  +FE       E+D  V RHL +                QD 
Sbjct: 154 MFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQDG 213

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICVMGDH 253
            +V  LH LG D  GH    +S       + +D+ I  + + V      +DT      DH
Sbjct: 214 -NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTAFLFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP+   H      TKN + S + +  VNQ
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVRNKHPIHDNYTKNWELSDIKRNDVNQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIASLMSYLIGANYPANSVG 350

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 122/332 (36%), Gaps = 64/332 (19%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGYTAYSN 94
           Q   +P   +L LIV D LR+D  F K        + F   F+  L+     +G +    
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVSGKTEFLAPFIRSLVMNNATYGISHTRM 100

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS------SNLKEQDSWLRQFHINNKRIK 148
           P            T S P  +  I    ED S+      SN    DS+  Q    +    
Sbjct: 101 P------------TESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQ----STHTY 144

Query: 149 FFGDDTWLKLFPQEFFDET-------DGTNSFFVSDFEEVDFNVTRHLPK---------- 191
            FG    L +F     D         D T   F     E+D  V RHL +          
Sbjct: 145 SFGSPDILPMFKDGASDPNKVDTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNST 204

Query: 192 -QLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-T 245
                +   +V  LH LG D  GH    +S       + +D+    +I++V     +D T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKT 264

Query: 246 LICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK---TKNDD 302
                 DHGM+  G+HG      T   L+       G  KP+   H  FP+    T+N +
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPV---HNPFPVSDNYTENWE 318

Query: 303 YSYVSK--VNQIDLVPSISSLFNFPIPKNSIG 332
            S + +  V Q D+   +S L     PKNS+G
Sbjct: 319 LSSIKRNDVKQADIASLMSYLIGVNYPKNSVG 350

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 132/335 (39%), Gaps = 47/335 (14%)

Query: 52  KLVLIVIDALRSDFVFQKDMSNFEFVHGLLN-------RGQAWGYTAYSNPPTVTLP--- 101
           +L LIV D LR+D  F K +      H  L        R +A    +++  PT + P   
Sbjct: 50  RLFLIVGDGLRADTTFDKILHPVTGEHDYLAPYIRDLVRNEATYGVSHTRMPTESRPGHV 109

Query: 102 --------RLKGITTG--STPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFG 151
                    +  +T G    P   D+  N ++   S    +     +     NK      
Sbjct: 110 AMIAGFYEDVSAVTKGWQENPVDFDSFFNQSKHTYSFGSPDILPMFKDGATPNKV----- 164

Query: 152 DDTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQDSWD--VLILHF 206
            D W+  +  EF D T  +   ++F      E+ FN T+   K L T+   D  V  LH 
Sbjct: 165 -DAWM--YGHEFEDFTQSSIELDAFVFRHIYEL-FNNTKS-NKTLETEIKQDGNVFFLHL 219

Query: 207 LGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICVMGDHGMNDLGNH 261
           LG D  GH    +S       + +D+ ++ +   V      EDT      DHGM+  G+H
Sbjct: 220 LGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDTAFIFTADHGMSAFGSH 279

Query: 262 GGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQIDLVPSIS 319
           G      T   L+       G  KP+      F   T+N + + + +  VNQ D+   +S
Sbjct: 280 GDGHPNNTRTPLVAWG---AGINKPVKNQAPIFDNYTENWNLADIKRNDVNQADIASLMS 336

Query: 320 SLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDN 354
            L     P NS+G +  + +   +P+D +L  + N
Sbjct: 337 YLIGANYPVNSVGELPLNFID--APEDKKLNALFN 369

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 149/367 (40%), Gaps = 96/367 (26%)

Query: 41  DEQRQISPKFNKLVLIVIDALRSDFVF---QKDMSNFEFVHGLLNRGQAWGYTAYSN--- 94
           DE   I+ KF K +LI+I  +  D +    ++ ++  E  H  LN         Y+N   
Sbjct: 77  DEAFNINSKFKKTMLIIISGISFDNLIPIPEESINYNESYHNNLN-------VLYNNFNQ 129

Query: 95  ---------------------PPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQ 133
                                PPT TL R+K IT GS P+F+D  +         ++ E+
Sbjct: 130 SLQNTSNEESSSSLLIKLKTYPPTDTLQRVKCITGGSVPSFIDTGITFY-----GSMIEE 184

Query: 134 DSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRH----- 188
           D+ L+Q ++NN+ I F GD  W  L+ + F +     N   + D+ +     T H     
Sbjct: 185 DNILKQMYLNNRSIYFTGDKFWNSLYSKYFQNFKLANNIDDIIDYFQKITTSTNHSYGES 244

Query: 189 -----LPKQLATQ--------------------DSWDVLILHFLGLDHIGHKGGAFSHFM 223
                 P  L T                       WD+LI H +  D +  K        
Sbjct: 245 NRSSDKPISLDTNLLQNISSIPTISNATVTTPSKDWDILIGHIME-DTMNEK-------- 295

Query: 224 APKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGY 283
              Q +++  +    NS+  DTL+ V+GD+   +  NH          GL   ++  + +
Sbjct: 296 -VTQLKVNSFLNDTINSIDNDTLLLVLGDYSTAN--NH------MLDTGLFMYTKKFKNF 346

Query: 284 EKPLAQNH-ETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLL 342
                QNH   + +    ++Y     ++Q D+VPS+S L   PIP N++G  + ++   +
Sbjct: 347 WN--LQNHLGEYNVDNFGENYRV---IDQFDVVPSLSLLLGLPIPFNNLGWPIDEI---I 398

Query: 343 SPKDAQL 349
           SP ++ L
Sbjct: 399 SPINSNL 405

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 124/321 (38%), Gaps = 42/321 (13%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQK------DMSNF--EFVHGLLNRGQAWGYTAYSN 94
           Q   +P   +L LIV D LR+D  F K        + F   ++  L+     +G  +++ 
Sbjct: 67  QSTSNPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPYIRSLVMNNATYG-ISHTR 125

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKEQDSWLRQFH 141
            PT + P            +  +T G  S P   D+  N +    S    +     +   
Sbjct: 126 MPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQSTHTYSFGSPDILPMFKDGA 185

Query: 142 INNKRIKFFGDDTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQDS 198
            +  R+     DTW+  +   F D T  +   +++      E+  N T +       +  
Sbjct: 186 SDPNRV-----DTWM--YDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEIRQD 238

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-TLICVMGDH 253
            +V  LH LG D  GH    +S       + +D+    +I++V     +D T      DH
Sbjct: 239 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADH 298

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP+  +   F   T N + S + +  V Q
Sbjct: 299 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVQNSFPVFDNYTDNWELSNIKRNDVKQ 355

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     PKNS+G
Sbjct: 356 ADIASLMSYLIGVNYPKNSVG 376

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 119/331 (35%), Gaps = 62/331 (18%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQ--------KDMSNFEFVHGLLNRGQAWGYTAYSN 94
           Q   +P   +L LIV D LR+D  F         K      ++  L+     +G +    
Sbjct: 41  QSTDNPPAKRLFLIVGDGLRADTTFDLITHPTSGKTEYLAPYIRSLVLNNATYGISHTRM 100

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGD 152
           P            T S P  +  I    ED S  +   KE       F   +     FG 
Sbjct: 101 P------------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGS 148

Query: 153 DTWLKLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQL--ATQDS----- 198
              L +F +   D +      +  +FE       E+D  V RHL      +T+DS     
Sbjct: 149 PDILPMFKEGASDPSRVDTWTYGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRDSTLNDE 208

Query: 199 ----WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICV 249
                +V+ LH LG D  GH    +S       + +D+ +  + + V      +DT    
Sbjct: 209 IRGDGNVVFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIF 268

Query: 250 MGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYV--- 306
             DHGM+  G+HG      T   L+       G  KPL  ++  F      D+Y++    
Sbjct: 269 TADHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPLKNDYPVF------DNYTFTWGL 319

Query: 307 -----SKVNQIDLVPSISSLFNFPIPKNSIG 332
                  V Q D+   +S L     P NS+G
Sbjct: 320 EDVQRHDVKQADIASLMSYLIGVNYPANSVG 350

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 113/321 (35%), Gaps = 50/321 (15%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQKDMSNFE--------FVHGLLNRGQAWGYTAYSNPPTV 98
           +P   +L LIV D LR+D  F K              F+  L+     +G +    P   
Sbjct: 45  NPPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
                    T S P  +  I    ED S  +   KE       F         FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDIL 152

Query: 157 KLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLP---------KQLATQDSWD 200
            +F     D        +  ++E       E+D  V RHL          K+L  Q   D
Sbjct: 153 PMFKDGASDPNKVDAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQD 212

Query: 201 --VLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGE-----DTLICVMGDH 253
                LH LG D  GH    +S         +D+ +E++   V E     DT      DH
Sbjct: 213 GNAFFLHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  +P+  +   F   T+N + + + +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNRPVRLDTPEFDEYTENWNLANIKRNDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIAALMSYLIGTNYPANSVG 350

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 116/321 (36%), Gaps = 50/321 (15%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQ------KDMSNF--EFVHGLLNRGQAWGYTAYSNPPTV 98
           +P   +L LIV D LR+D  F          + F   F+  L+     +G +    P   
Sbjct: 44  TPPAKRLFLIVGDGLRADTTFDLITHPTTGKTEFLAPFIRSLVKTNATYGISHTRMP--- 100

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
                    T S P  +  I    ED S  +   KE       F   +     FG    L
Sbjct: 101 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDIL 151

Query: 157 KLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQLATQDS----------- 198
            +F     D        +  ++E       E+D  V RHL        S           
Sbjct: 152 PMFKDGASDPNKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFKNSTSNVTLDHEIRQE 211

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVG-EDTLICVMGDH 253
            +V  LH LG D  GH    +S       + +DE    ++++V++  G EDT      DH
Sbjct: 212 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGDEDTAFIFTADH 271

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP+      +   T++   + + +  + Q
Sbjct: 272 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVKNEVPIYDNYTESWGLADIKRNDIKQ 328

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+ P +S L     P NS+G
Sbjct: 329 ADITPLMSYLIGANYPANSVG 349

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 119/321 (37%), Gaps = 52/321 (16%)

Query: 48  PKFNKLVLIVIDALRSDFVFQKDMSNFE--------FVHGLLNRGQAWGYTAYSNPPTVT 99
           P   +L LIV D LR+D  F+K              F+  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKITHPVSGETAHLAPFIRSLVLNNATYGVSHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWLK 157
                   T S P  +  I    ED S  +   KE       F   +     FG    L 
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILP 153

Query: 158 LFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLP------------KQLATQDS 198
           +F     D        +  +FE       E+D  V RHL             +Q  TQ S
Sbjct: 154 MFKDGATDPHKVDAWMYGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQ-S 212

Query: 199 WDVLILHFLGLDHIGHKGGAFS--HFMAPK--QREMDEVIEQVYNSVGED-TLICVMGDH 253
            +V  LH LG D  GH    +S  ++   K   +E+ +++ +V +  G+D T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP+      +   T+  D + + +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVKNPVPIYDNYTEGWDLATIQRNDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIASLMSYLIGANYPANSVG 350

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 117/322 (36%), Gaps = 54/322 (16%)

Query: 48  PKFNKLVLIVIDALRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKG-- 105
           P   +L LIV D LR+D  F K           +N     G T Y  P   ++   +G  
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDK-----------INHPIT-GETDYLAPFLRSIVLEEGTY 93

Query: 106 ------ITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGD----- 152
                 + T S P  +  I    ED S  +   KE       F   +K    FG      
Sbjct: 94  GISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQSKHTYSFGSPDILP 153

Query: 153 ------------DTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQD 197
                       DTW+  +  EF D T  +   +++      E+ FN T +       + 
Sbjct: 154 MFKDGASDINRIDTWM--YGHEFEDFTQSSIELDAYVFRHMNELFFNSTVNETLNYEIRQ 211

Query: 198 SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICVMGD 252
             +V  LH LG D  GH    +S       + +D+++ ++ + V       DT      D
Sbjct: 212 DGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFNDNDTAFIFTAD 271

Query: 253 HGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VN 310
           HGM+  G+HG      T   LI       G  KP+      F   T+  +   + +  V 
Sbjct: 272 HGMSAFGSHGDGHPNNTRTPLIAWG---AGINKPVKNEVPIFDNYTEGWNLGSIKRNDVK 328

Query: 311 QIDLVPSISSLFNFPIPKNSIG 332
           Q D+   +S L     P NS+G
Sbjct: 329 QADIASLMSYLIGANYPANSVG 350

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 118/321 (36%), Gaps = 50/321 (15%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQKDMSNFE--------FVHGLLNRGQAWGYTAYSNPPTV 98
           +P   +L LIV D LR+D  F+K              F+  L+     +G +    P   
Sbjct: 45  TPPAKRLFLIVGDGLRADTTFEKVTHPVTGKTEYLAPFIRSLVLNNATYGVSHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
                    T S P  +  I    ED S  +   KE       F   ++    FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSRHTYSFGSPDIL 152

Query: 157 KLFP---------------QEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQDS 198
            +F                 EF D T  +   +++   + +E+ +N T         +  
Sbjct: 153 PMFKDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRNLDELFYNSTIDATLDFEIKQE 212

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-TLICVMGDH 253
            +V  LH LG D  GH    +S       + +DE    +I +V++   +D T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP       +   T++ + S++ +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPQINKVPIYDNYTESWNLSHIKRNDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIASLMSYLIGTNYPVNSVG 350

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 121/321 (37%), Gaps = 42/321 (13%)

Query: 43  QRQISPKFNKLVLIVIDALRSDFVFQ--------KDMSNFEFVHGLLNRGQAWGYTAYSN 94
           Q    P   +L LIV D LR+D  F         K      F+  L+     +G  +++ 
Sbjct: 41  QSTDQPPAKRLFLIVGDGLRADTTFDYVRHPATGKKEFLAPFIRSLVLNNATYG-ISHTR 99

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKEQDSWLRQFH 141
            PT + P            +  +T G    P   D+  N +    S    +     +   
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSCFNQSTHTYSFGSPDILPMFKDGA 159

Query: 142 INNKRIKFFGDDTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQDS 198
            +  R+     D W+  +  EF D T  +   ++F     +++  N T +       +  
Sbjct: 160 SDPNRV-----DAWM--YGHEFEDFTQSSIEMDAFVFKHLDDLFHNSTINNTLNNEIRHD 212

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMD----EVIEQVYNSVGED-TLICVMGDH 253
            +V  LH LG D  GH    +S       + +D     ++EQV +  G+D T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFGDDETAFVFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP+      +   T+  D S++ +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVHNLKPVYDNYTQGWDLSHIKRHDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIASLMSYLIGANYPANSVG 350

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 116/321 (36%), Gaps = 50/321 (15%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKG- 105
           +P   +L LIV D LR+D  F             L      G TAY  P   ++    G 
Sbjct: 45  APPAKRLFLIVGDGLRADTTFD------------LITHPVSGETAYLAPYIRSIVLNNGT 92

Query: 106 -------ITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
                  + T S P  +  I    ED S  +   KE       F         FG    L
Sbjct: 93  YGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQTNHTYSFGSPDIL 152

Query: 157 KLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLPKQL--ATQDS--------- 198
            +F Q   D        +  +FE       E+D  V  H+ +    AT DS         
Sbjct: 153 PMFKQGASDPNKIDAWMYGHEFEDFSQSSLELDAFVFDHVNELFKNATLDSDLNEQIKQD 212

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMD----EVIEQVYNSVGED-TLICVMGDH 253
            +   LH LG D  GH    +S       + +D    +++E+V +  G+D T      DH
Sbjct: 213 GNCFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   L+       G  KP    +      T++  + Y+ +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWG---AGINKPEKHQYPIVNNYTESWGFDYIKRNDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   +S L     P NS+G
Sbjct: 330 ADIASLMSYLIGTNYPANSVG 350

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 116/321 (36%), Gaps = 50/321 (15%)

Query: 47  SPKFNKLVLIVIDALRSDFVFQK-------DMSNFE-FVHGLLNRGQAWGYTAYSNPPTV 98
           +P   +L LIV D LR+D  F K       + ++   F+  L+     +G +    P   
Sbjct: 45  APPAKRLFLIVGDGLRADTTFDKITHPTTGETAHLAPFLRSLVLNNATYGVSHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWL 156
                    T S P  +  I    ED S  +   KE       F   +     FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDIL 152

Query: 157 KLFPQEFFDETDGTNSFFVSDFE-------EVDFNVTRHLP---------KQLATQ--DS 198
            +F     D        +  +FE       E+D  V RHL          ++L  Q    
Sbjct: 153 PMFKDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQP 212

Query: 199 WDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSV-----GEDTLICVMGDH 253
            +V  LH LG D  GH    +S       + +D+ + ++   V      +DT      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQ 311
           GM+  G+HG      T   LI       G  +P+      +   T+  D + + +  V Q
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLIAWG---AGLNRPVLNKAPIYDNYTEGWDLANIQRNDVKQ 329

Query: 312 IDLVPSISSLFNFPIPKNSIG 332
            D+   ++ L     P NS+G
Sbjct: 330 ADIASLMTYLIGADYPANSVG 350

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 129/316 (40%), Gaps = 42/316 (13%)

Query: 48  PKFNKLVLIVIDALRSDFVFQ--------KDMSNFEFVHGLLNRGQAWGYTAYSNPPTVT 99
           P   +L LIV D LR+D  F         K      ++  L+     +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYLAPYIRSLVENNATYG-ISHTRMPTES 104

Query: 100 LP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKR 146
            P            +  +T G    P   D+  N +    S    +     +    ++ +
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMFKDGASDHNK 164

Query: 147 IKFFGDDTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLATQDSWDVLI 203
           +     D W  ++  EF D T  +   +++  +  +++ +N T +       + + +V  
Sbjct: 165 V-----DAW--MYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEIRQNGNVFF 217

Query: 204 LHFLGLDHIGHKGGAFS--HFMAPK--QREMDEVIEQVYNSV-GEDTLICVMGDHGMNDL 258
           LH LG D  GH    +S  ++   K   RE+++++++V+N    +DT      DHGM+  
Sbjct: 218 LHLLGCDTAGHSYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIFTADHGMSAF 277

Query: 259 GNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQIDLVP 316
           G+HG      T   L+       G  +P   +   +   TK  + S++ +  V Q D+  
Sbjct: 278 GSHGDGHPNNTRTPLVAWG---AGLNRPKLNDVPIYDNYTKPWNLSHIQRNDVKQADIAS 334

Query: 317 SISSLFNFPIPKNSIG 332
            +S L     P NS+G
Sbjct: 335 LMSYLIGANYPVNSVG 350

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 118/312 (37%), Gaps = 34/312 (10%)

Query: 48  PKFNKLVLIVIDALRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGIT 107
           P   +L LIV D LR+D  F  DM     V G       +  +   N  T  +   + + 
Sbjct: 46  PPAKRLFLIVGDGLRADTTF--DMITHP-VTGKTEFLAPYIRSLVLNNATYGISHTR-MP 101

Query: 108 TGSTPNFLDAILNVAEDDS--SSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFD 165
           T S P  +  I    ED S  +   KE       F   +     FG    L +F +   D
Sbjct: 102 TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSSHTYSFGSPDILPMFKEGATD 161

Query: 166 ETDGTNSFFVSDFE-------EVDFNVTRHLPKQL--ATQDS---------WDVLILHFL 207
                   +  ++E       E+D  V RHL      +T DS          +V  LH L
Sbjct: 162 PHKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHEIRQEGNVFFLHLL 221

Query: 208 GLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-TLICVMGDHGMNDLGNHG 262
           G D  GH    +S       + +DE    ++++V+   G+D T      DHGM+  G+HG
Sbjct: 222 GCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTADHGMSAFGSHG 281

Query: 263 GSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK--VNQIDLVPSISS 320
                 T   L+       G  KP+      +   T++   + + +  V Q D+   +S 
Sbjct: 282 DGHPNNTRTPLVAWG---AGLNKPVKNEVPIYDNYTESWKLADIKRNDVKQADITSLMSY 338

Query: 321 LFNFPIPKNSIG 332
           L     P NS+G
Sbjct: 339 LIGTNYPANSVG 350

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 123/324 (37%), Gaps = 43/324 (13%)

Query: 41  DEQRQI-SPKFNKLVLIVIDALRSDFVFQKDMSNFE--------FVHGLLNRGQAWGYTA 91
           D+ R   +P   +L L+V D LR+D  F K              F+  L+     +G  +
Sbjct: 38  DQYRSTDTPPAKRLFLVVGDGLRADTTFDKITHPVTGKTEYLAPFIRSLVLNNGTYG-IS 96

Query: 92  YSNPPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKEQDSWLR 138
           ++  PT + P            +  +T G    P   D+  N +    S    +     +
Sbjct: 97  HTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSVHTYSFGSPDILPMFK 156

Query: 139 QFHINNKRIKFFGDDTWLKLFPQEFFDETDGT---NSFFVSDFEEVDFNVTRHLPKQLAT 195
               +  R+     D W  ++  EF D T  +   ++F  +  + +  N T +       
Sbjct: 157 DGASDPSRV-----DAW--MYGHEFEDFTQSSIELDAFVFNHLDTLFKNSTTNNTLNAEI 209

Query: 196 QDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDE----VIEQVYNSVGED-TLICVM 250
           +   +V  LH LG D  GH    +S       + +D     ++++V    G+D T     
Sbjct: 210 RQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFT 269

Query: 251 GDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVSK-- 308
            DHGM+  G+HG      T   L+       G  KP+   +  +   T+  + + + +  
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWG---AGVNKPVRNEYPIYDNYTEGWNLADIKRND 326

Query: 309 VNQIDLVPSISSLFNFPIPKNSIG 332
           V Q D+   +S L     P NS+G
Sbjct: 327 VKQADIASLMSYLIGVNYPSNSVG 350

>Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {ON}
           complement(37667..40735) [3069 nt, 1023 aa]
          Length = 1022

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 88/441 (19%), Positives = 170/441 (38%), Gaps = 95/441 (21%)

Query: 41  DEQRQISPKFNKLVLIVIDALRSDFV-FQKDMSNFEFVHGL--------------LNRGQ 85
           D    I P+F+K +++V+D+L  D + F +  +N  F H L              L    
Sbjct: 77  DNIPDIDPQFSKAIVLVLDSLSLDSIAFSELSANDNFNHQLSSLTSPDDEISSQKLFSYV 136

Query: 86  AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNK 145
           +  YT  +   T    +L+ + +G+  +    + N      ++ L  +D++L + ++N K
Sbjct: 137 SKEYTFEAESSTHHTSKLQDLFSGTVTDLAKCVKNF-----TNCLLFEDNFLHKLNLNYK 191

Query: 146 RIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLATQ--------- 196
            + F  +  W         D  DG             F+  + LP  LA           
Sbjct: 192 NVYFANEHYW---------DSIDGI------------FSSNQRLPATLANNAEIDTYTID 230

Query: 197 --------------------DSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQ 236
                               + W+VLI H  GL             +   Q E+D++I  
Sbjct: 231 PNKDTINFLYETVIDKSNDIEKWEVLIGHLYGLKPHDENLETNDPSILRNQIEIDKLITD 290

Query: 237 VYNSVGEDTLICVMGDHGMNDLGNHGGSSAG--ETSAGLIFISRLLEGYEKPLAQNHETF 294
           +  S+  DTL+ V+        GN   S+    + +  ++++   +         ++   
Sbjct: 291 LKKSMDNDTLLMVVS-------GNSKFSTKDVIKNNKNILYLYSNVPNLWNYSVADNSNL 343

Query: 295 PIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDN 354
            I   N    Y S ++++D++PSIS L + P+P +S+G+ +P++       +  L +   
Sbjct: 344 IIGKDNSTLKY-SNIDKVDIIPSISLLLDLPLPVDSLGLFIPELANSEEHFNTYLNVNKL 402

Query: 355 YLQLTTISGDLMANSSDQDVIY-------------QHMRDIQGDLAKNATKYNYFMLGFG 401
            +Q    +  ++ N S + ++Y             +  + I        T ++Y+ L  G
Sbjct: 403 QIQYLLKNKKVITNDSTEYILYPVLPENSDYLSWKKFQQKILTSYKGFKTVFDYWYLSIG 462

Query: 402 FSLLFITAIATFLLLK--PTI 420
            S L I+ I  F + K  P+I
Sbjct: 463 VSFLIISLILLFSMTKLIPSI 483

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 609 LHKWNPDRKRFLHNIQAYCT--AFLILQTSPANIPQFLVYLILSEKLESVWRRREW---S 663
           +H+ +P RKR +H I  YC   A   L T  ++I + L + ILS+ + S  RR E    +
Sbjct: 656 VHQVSPRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVA 715

Query: 664 PSILMLAGIVLQNL 677
             ++   G++++N+
Sbjct: 716 AKVVKHGGLIVKNI 729

>KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {ON}
           some similarities with uniprot|P25353 Saccharomyces
           cerevisiae YCR026C NPP1
          Length = 621

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 209 LDHIGHK-GGAFSHFMAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMN 256
           +D +GHK G       +   +E+D+ +EQ++  V E+  I V+ DHGM+
Sbjct: 303 VDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFADVDENVNILVISDHGMS 351

>TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 511 QWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCLIYKATWS----IVNGEKVPSWLQRV 566
           ++L+  +   V    A NK L++F C+F+ S     + ATW     +V GE  P    RV
Sbjct: 351 EFLVAIIGTAVPNSTAANKTLIAFSCTFIAS-----FAATWGPLAWVVVGEIFP---LRV 402

Query: 567 VMKSFSIMNGEN 578
             KS +I  G N
Sbjct: 403 RAKSVAICAGSN 414

>Kpol_529.26 s529 complement(73634..78334) [4701 bp, 1566 aa] {ON}
           complement(73634..78334) [4701 nt, 1567 aa]
          Length = 1566

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 678 AFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLKILYSFPV 737
           A  +  NTN    VN+    NG+    N+  +G  +C  +F   I   ++ LKI  +FP 
Sbjct: 854 AIGKITNTN----VNIKTDCNGVEATTNVESLGLSLCADSFNTLISLLID-LKIPITFPD 908

Query: 738 KDKWKI 743
           +DK+ I
Sbjct: 909 EDKYNI 914

>TBLA0E02880 Chr5 (718872..720566) [1695 bp, 564 aa] {ON} Anc_5.574
           YML031W
          Length = 564

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 567 VMKSFSIM--NGENNSQADLKESLVPMARLFFKTILAVTLLEIV 608
           +MKSF+I   N E  ++  L E LVP+  LF  ++L++T L IV
Sbjct: 360 LMKSFNIFSFNNEKINKNKLAEKLVPIPMLFTSSMLSITSLLIV 403

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,884,202
Number of extensions: 3883952
Number of successful extensions: 10220
Number of sequences better than 10.0: 73
Number of HSP's gapped: 10171
Number of HSP's successfully gapped: 84
Length of query: 808
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 690
Effective length of database: 39,950,811
Effective search space: 27566059590
Effective search space used: 27566059590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 70 (31.6 bits)