Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_0.2121.399ON30330316310.0
KLTH0H12122g1.399ON30330316080.0
SAKL0D08756g1.399ON30330315490.0
Ecym_12931.399ON30330315120.0
AAL009C1.399ON30330314970.0
KLLA0D04840g1.399ON30330314920.0
TDEL0B059701.399ON30330314900.0
ZYRO0E04620g1.399ON30330314650.0
Skud_14.3211.399ON30330314530.0
Smik_14.3221.399ON30330314500.0
YNL006W (LST8)1.399ON30330314500.0
KAFR0H031401.399ON30330314490.0
Suva_14.3421.399ON30330314480.0
KNAG0H016901.399ON30330314450.0
CAGL0H03729g1.399ON30330314270.0
Kpol_487.71.399ON30330314160.0
NCAS0G036001.399ON32730713820.0
NDAI0C026001.399ON30330313680.0
TPHA0O007101.399ON30430412990.0
TBLA0D048701.399ON32732711451e-158
Kpol_1070.117.231ON6662922293e-20
KLLA0F27511g7.231ON6233072241e-19
ADL082C7.231ON5693022231e-19
TBLA0F042406.363ON7272942204e-19
YIL046W (MET30)7.231ON6402922195e-19
Smik_9.1447.231ON6303052161e-18
Kwal_27.120538.544ON7552752162e-18
Suva_9.1547.231ON6382922142e-18
KNAG0D016907.231ON6543112143e-18
ZYRO0D16742g7.231ON6082912133e-18
ZYRO0A12980g8.544ON8242992143e-18
Skud_9.1237.231ON6392952124e-18
KLTH0E12606g8.544ON7552722108e-18
SAKL0F08404g7.231ON6433102091e-17
NCAS0D047806.363ON6212322091e-17
Smik_2.3388.544ON8002812081e-17
KLTH0A04114g7.231ON6583042072e-17
TDEL0H021307.231ON5842942072e-17
Ecym_43437.231ON5833122063e-17
CAGL0M05335g8.544ON8062842063e-17
SAKL0H09988g8.544ON7492782036e-17
CAGL0L00781g7.231ON6733092036e-17
AEL269C7.534ON4552192001e-16
Kpol_1028.416.340ON5123342001e-16
KAFR0I018807.231ON5912972001e-16
TPHA0L016908.544ON8322902002e-16
Skud_2.3248.544ON8022821992e-16
CAGL0C00737g8.435ON8162521983e-16
Kwal_23.57697.231ON6273091956e-16
TDEL0B030208.544ON8313061966e-16
YBR198C (TAF5)8.544ON7982791956e-16
Ecym_25236.363ON6462351957e-16
TPHA0C011507.231ON6872981931e-15
Smik_3.1726.340ON5153341921e-15
Ecym_70388.544ON8002701922e-15
NCAS0A055206.363ON6713291903e-15
TBLA0F041306.340ON5143421903e-15
KAFR0F043506.340ON5153361903e-15
YCR072C (RSA4)6.340ON5153341893e-15
NDAI0C054908.544ON8592951903e-15
AGL234W6.363ON6292351903e-15
CAGL0E00561g6.363ON8362411904e-15
NDAI0I003506.340ON5153351894e-15
KLTH0E10120g8.435ON8262571894e-15
TPHA0M018306.340ON5152981885e-15
AEL246C8.544ON8152701895e-15
SAKL0H15532g8.324ON9412491885e-15
TBLA0D041307.231ON5743001876e-15
TBLA0H036208.544ON8122881886e-15
KLLA0F10263g6.363ON6822511886e-15
NCAS0G043001.534ON7252801877e-15
SAKL0A01276g6.340ON5153381868e-15
Suva_3.1096.340ON5153381868e-15
Suva_4.4528.544ON8002831869e-15
NCAS0D046106.340ON5153351851e-14
TPHA0G023802.431ON3182981831e-14
ZYRO0A09636g8.435ON8082611861e-14
TDEL0A075506.340ON5153361841e-14
AFR199C2.431ON3342441812e-14
Ecym_24986.340ON5422951832e-14
SAKL0H12760g8.435ON8412661842e-14
NCAS0B022008.544ON8222851842e-14
TPHA0M020006.363ON6992391832e-14
CAGL0J03476g6.340ON5173321822e-14
KNAG0A037008.544ON8172861832e-14
KNAG0E023102.431ON3193011803e-14
NCAS0A134307.231ON6082991823e-14
Kwal_27.115858.435ON8232541824e-14
Kpol_1028.236.363ON7442391814e-14
AER263C6.340ON5133391814e-14
KLLA0E23453g8.544ON8262801814e-14
Smik_12.2798.435ON8172491814e-14
Kwal_56.239208.324ON9372521814e-14
Skud_3.1456.340ON5153391804e-14
KAFR0E031808.544ON8142821814e-14
TBLA0C018408.672ON4232431795e-14
NCAS0A151707.534ON4742121795e-14
ZYRO0D08206g6.340ON5152951796e-14
ZYRO0D17292g6.363ON7182431806e-14
Ecym_41348.435ON8102651797e-14
NCAS0C027108.435ON8152521797e-14
Kpol_297.72.431ON3183011768e-14
Skud_3.1566.363ON7132401789e-14
KAFR0H017508.435ON7832351781e-13
ZYRO0F07282g8.672ON4272391771e-13
TDEL0A074006.325ON9012581781e-13
KAFR0C047406.363ON6652421781e-13
KLTH0A06380g6.325ON9152211781e-13
NDAI0A026107.231ON7673161781e-13
TDEL0A077806.363ON6572401771e-13
KNAG0I028406.340ON5193441771e-13
YCR084C (TUP1)6.363ON7132401771e-13
Skud_3.1336.325ON9162941772e-13
Suva_3.1216.363ON7002401762e-13
KAFR0J025506.325ON9062711762e-13
KAFR0C038302.663ON3812741733e-13
SAKL0A10406g1.534ON7112831753e-13
Smik_3.1836.363ON7092401743e-13
Suva_16.1598.672ON4512451733e-13
SAKL0A00660g6.363ON6602411743e-13
KLTH0A07282g6.363ON7252401743e-13
Ecym_24018.672ON4262261733e-13
KNAG0D002506.363ON6553111743e-13
Kwal_23.64296.363ON7502401744e-13
Kwal_23.62406.325ON9132211744e-13
Kpol_1024.428.544ON8432811744e-13
CAGL0C03608g6.363ON6432751734e-13
Suva_3.936.325ON9202931735e-13
YCR057C (PWP2)6.325ON9232991735e-13
NDAI0E034408.435ON8572541726e-13
Suva_10.3168.435ON8182501726e-13
ZYRO0G20152g2.431ON3192951697e-13
YLR222C (UTP13)8.435ON8172491727e-13
Kpol_1048.598.544ON8502771718e-13
Kwal_23.63246.340ON5142971718e-13
KNAG0I025406.325ON9182661719e-13
KLTH0A06754g6.340ON5142991701e-12
KLLA0C08547g6.340ON5153041701e-12
KLTH0D11132g8.672ON4372361691e-12
SAKL0H06666g8.672ON4412261691e-12
Skud_16.1318.672ON4512451691e-12
KNAG0A025108.435ON8492651701e-12
Kpol_1031.498.435ON7602741701e-12
Smik_6.3488.672ON4512381691e-12
KLTH0G12276g8.324ON9372391701e-12
TBLA0B091002.431ON3172991662e-12
TBLA0I022806.325ON9272661692e-12
YPL151C (PRP46)8.672ON4512431682e-12
Skud_12.2858.435ON8172501682e-12
TPHA0C008108.324ON9372311682e-12
KLLA0F13244g8.435ON8142601682e-12
KNAG0J016808.672ON3982351662e-12
Smik_3.1576.325ON9242971673e-12
ZYRO0F11110g7.322ON12012141673e-12
ZYRO0F10406g8.324ON9382291673e-12
Kpol_1054.601.534ON7192991663e-12
Kpol_1072.178.672ON4332381654e-12
Suva_13.2952.431ON3192981634e-12
Skud_13.2752.431ON3192981634e-12
Smik_13.3052.431ON3192981634e-12
YMR116C (ASC1)2.431ON3192981634e-12
TBLA0I025708.435ON8482371655e-12
KAFR0A005102.431ON3192971625e-12
CAGL0M02277g8.672ON4272451645e-12
Kpol_1028.546.325ON9052631655e-12
Ecym_20936.325ON9232731656e-12
TPHA0I018808.544ON10342761647e-12
TPHA0D038306.325ON9122151639e-12
TBLA0B043908.585ON3362991601e-11
NDAI0E024008.672ON4342431611e-11
CAGL0L03201g1.247ON5792701621e-11
Kwal_26.87768.672ON4331821611e-11
TDEL0B020108.435ON8052491621e-11
TPHA0L010808.435ON8351251612e-11
ACR137W8.672ON4252521592e-11
KNAG0H001802.663ON3892681582e-11
AGL196C8.324ON9352011602e-11
Ecym_42558.324ON9372661602e-11
CAGL0I03718g7.322ON12012141602e-11
KLTH0A00880g7.534ON4712521583e-11
CAGL0K09284g6.325ON9112661593e-11
NDAI0H027102.431ON3182971563e-11
CAGL0M04279g8.324ON9402311584e-11
TPHA0G016108.672ON4141801565e-11
SAKL0E03960g2.431ON3202021545e-11
NCAS0D044806.325ON9152211576e-11
TBLA0E007607.534ON3842221556e-11
Kpol_2001.657.322ON12062141567e-11
TBLA0A039508.324ON9362501567e-11
NCAS0C032608.324ON9832011567e-11
KAFR0A006002.450ON8943131559e-11
NDAI0A020907.322ON12002971551e-10
TDEL0A020702.431ON3192961521e-10
SAKL0A01738g6.325ON9092901541e-10
AGR180W8.435ON8062761541e-10
Kpol_1036.698.324ON9362311541e-10
YKL213C (DOA1)1.534ON7152821531e-10
KLLA0C08976g6.325ON9112741532e-10
SAKL0F15972g7.534ON4701751512e-10
KLLA0E12277g2.431ON3262971502e-10
ZYRO0D01122g7.534ON4662771512e-10
SAKL0F10648g7.322ON12032141522e-10
Ecym_80901.247ON7162861512e-10
NDAI0G025808.324ON9582341523e-10
KNAG0B027207.322ON12042141523e-10
NCAS0A139407.322ON12052141523e-10
KAFR0H022608.324ON9382271513e-10
Skud_4.1097.322ON12012141513e-10
AER114W4.309ON6331331513e-10
KNAG0F038707.534ON4652781503e-10
SAKL0A03872g6.239ON8781631513e-10
TBLA0F005206.363ON6632671504e-10
Suva_4.997.322ON12012141514e-10
Suva_11.71.534ON7192821504e-10
KLLA0E11331g3.344ON5121891494e-10
YDL145C (COP1)7.322ON12012141504e-10
TDEL0C022407.322ON12012141504e-10
Smik_4.907.322ON12012141504e-10
KLLA0E07965g2.663ON3902821484e-10
KAFR0H024508.672ON4172411486e-10
NCAS0F018502.431ON3182961476e-10
SAKL0B02244g8.67ON7732231486e-10
CAGL0K12188g3.344ON5351871486e-10
NCAS0A042702.431ON3182001467e-10
Ecym_70788.585ON3132041467e-10
TBLA0F022307.322ON12162141487e-10
TPHA0P014903.25ON4592781478e-10
Suva_10.2228.324ON9432961488e-10
TPHA0D045007.322ON12082911488e-10
KAFR0L013907.322ON12062141488e-10
NDAI0E015008.631ON4283081469e-10
NDAI0I004606.325ON9172371479e-10
KLLA0D16390g8.324ON9361541471e-09
TDEL0A061808.672ON4342281461e-09
NCAS0C044503.25ON4612781461e-09
Suva_13.3252.380ON3472291451e-09
Kwal_23.53517.534ON4742361461e-09
AER255C5.429ON4672231461e-09
KLLA0D07546g8.67ON6472311461e-09
KLTH0D15840g4.309ON6971341461e-09
Kpol_1001.234.309ON6101831461e-09
Smik_11.2332.663ON4152941451e-09
ADR077C7.322ON12042141461e-09
Kpol_1014.193.25ON4522181451e-09
KLTH0H03608g6.239ON8751631461e-09
KLTH0D04466g2.431ON3192271431e-09
ACR166W2.663ON3891231441e-09
Smik_11.101.534ON7172811451e-09
ZYRO0F14960g8.585ON3192031432e-09
Smik_12.1928.324ON9433041452e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_0.212
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...   632   0.0  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...   624   0.0  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...   601   0.0  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...   587   0.0  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...   581   0.0  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...   579   0.0  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....   578   0.0  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...   568   0.0  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...   564   0.0  
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...   563   0.0  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...   563   0.0  
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...   562   0.0  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...   562   0.0  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...   561   0.0  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...   554   0.0  
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...   550   0.0  
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...   536   0.0  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}     531   0.0  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...   504   0.0  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...   445   e-158
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    93   3e-20
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    91   1e-19
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    91   1e-19
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    89   4e-19
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    89   5e-19
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    88   1e-18
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    88   2e-18
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    87   2e-18
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    87   3e-18
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    87   3e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    87   3e-18
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    86   4e-18
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    86   8e-18
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    85   1e-17
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     85   1e-17
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    85   1e-17
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    84   2e-17
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    84   2e-17
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    84   3e-17
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    84   3e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    83   6e-17
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    83   6e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    82   1e-16
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    82   1e-16
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    82   1e-16
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    82   2e-16
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    81   2e-16
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    81   3e-16
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    80   6e-16
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    80   6e-16
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    80   6e-16
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    80   7e-16
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    79   1e-15
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    79   1e-15
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    79   2e-15
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    78   3e-15
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    78   3e-15
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    78   3e-15
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    77   3e-15
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             78   3e-15
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    78   3e-15
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    78   4e-15
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       77   4e-15
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    77   4e-15
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    77   5e-15
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    77   5e-15
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    77   5e-15
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    77   6e-15
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    77   6e-15
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    77   6e-15
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    77   7e-15
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    76   8e-15
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    76   8e-15
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    76   9e-15
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     76   1e-14
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    75   1e-14
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    76   1e-14
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    75   1e-14
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    74   2e-14
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    75   2e-14
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    75   2e-14
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    75   2e-14
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    75   2e-14
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    75   2e-14
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    75   2e-14
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    74   3e-14
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    75   3e-14
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    75   4e-14
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    74   4e-14
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    74   4e-14
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    74   4e-14
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    74   4e-14
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    74   4e-14
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    74   4e-14
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    74   4e-14
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    74   5e-14
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    74   5e-14
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    74   6e-14
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    74   6e-14
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    74   7e-14
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    74   7e-14
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    72   8e-14
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    73   9e-14
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    73   1e-13
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    73   1e-13
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    73   1e-13
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    73   1e-13
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    73   1e-13
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     73   1e-13
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    73   1e-13
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    73   1e-13
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    73   1e-13
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    73   2e-13
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    72   2e-13
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    72   2e-13
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    71   3e-13
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    72   3e-13
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    72   3e-13
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    71   3e-13
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    72   3e-13
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    72   3e-13
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    71   3e-13
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    72   3e-13
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    72   4e-13
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    72   4e-13
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    72   4e-13
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    71   4e-13
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    71   5e-13
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    71   5e-13
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    71   6e-13
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    71   6e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    70   7e-13
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    71   7e-13
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    70   8e-13
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    70   8e-13
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    70   9e-13
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    70   1e-12
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    70   1e-12
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    70   1e-12
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    70   1e-12
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    70   1e-12
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    70   1e-12
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    70   1e-12
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    70   1e-12
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    70   1e-12
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    69   2e-12
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    70   2e-12
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    69   2e-12
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    69   2e-12
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    69   2e-12
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    69   2e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    69   2e-12
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    69   3e-12
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    69   3e-12
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    69   3e-12
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    69   3e-12
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    68   4e-12
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    67   4e-12
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    67   4e-12
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    67   4e-12
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    67   4e-12
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    68   5e-12
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    67   5e-12
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    68   5e-12
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    68   5e-12
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    68   6e-12
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    68   7e-12
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    67   9e-12
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    66   1e-11
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     67   1e-11
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    67   1e-11
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    67   1e-11
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    67   1e-11
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    67   2e-11
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    66   2e-11
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    65   2e-11
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    66   2e-11
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    66   2e-11
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    66   2e-11
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    65   3e-11
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    66   3e-11
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    65   3e-11
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    65   4e-11
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    65   5e-11
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    64   5e-11
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    65   6e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               64   6e-11
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    65   7e-11
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    65   7e-11
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    65   7e-11
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    64   9e-11
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    64   1e-10
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    63   1e-10
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    64   1e-10
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    64   1e-10
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    64   1e-10
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    64   1e-10
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    64   2e-10
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    63   2e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    62   2e-10
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    63   2e-10
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    63   2e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    63   2e-10
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    63   3e-10
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    63   3e-10
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    63   3e-10
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    63   3e-10
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    63   3e-10
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    63   3e-10
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    62   3e-10
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    63   3e-10
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    62   4e-10
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    63   4e-10
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    62   4e-10
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    62   4e-10
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    62   4e-10
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    62   4e-10
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    62   4e-10
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    62   4e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    62   6e-10
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    61   6e-10
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    62   6e-10
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    62   6e-10
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    61   7e-10
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    61   7e-10
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    62   7e-10
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    61   8e-10
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    62   8e-10
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    62   8e-10
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    62   8e-10
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    61   9e-10
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       61   9e-10
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    61   1e-09
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    61   1e-09
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      61   1e-09
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    60   1e-09
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    61   1e-09
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    61   1e-09
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    61   1e-09
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    61   1e-09
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    61   1e-09
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    60   1e-09
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    61   1e-09
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    60   1e-09
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    61   1e-09
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    60   1e-09
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    60   1e-09
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    60   1e-09
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    60   2e-09
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    60   2e-09
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    60   2e-09
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    60   2e-09
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    60   2e-09
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    60   2e-09
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    60   2e-09
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    60   2e-09
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    60   2e-09
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    60   2e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    60   3e-09
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    60   3e-09
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    60   3e-09
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    60   3e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    60   3e-09
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    59   3e-09
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    59   3e-09
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    59   3e-09
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    59   3e-09
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    59   4e-09
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    59   4e-09
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    59   4e-09
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    59   4e-09
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    59   4e-09
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    59   4e-09
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    59   4e-09
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    59   4e-09
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    59   4e-09
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      59   4e-09
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    59   4e-09
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     59   5e-09
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    59   6e-09
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    58   6e-09
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      59   6e-09
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    59   6e-09
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    59   6e-09
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    59   7e-09
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    59   7e-09
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    59   7e-09
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    58   7e-09
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    58   8e-09
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    58   8e-09
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    59   8e-09
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    58   9e-09
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    58   9e-09
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    58   1e-08
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    58   1e-08
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    58   1e-08
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    58   1e-08
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    57   1e-08
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    58   1e-08
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    58   1e-08
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    57   1e-08
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    58   1e-08
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    57   1e-08
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    58   1e-08
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    57   1e-08
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    58   1e-08
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    57   2e-08
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    57   2e-08
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    57   2e-08
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    57   2e-08
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    57   2e-08
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    57   2e-08
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    57   2e-08
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    56   2e-08
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    57   2e-08
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    57   2e-08
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    57   2e-08
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    55   2e-08
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      57   3e-08
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    57   3e-08
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    56   3e-08
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    57   3e-08
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    57   3e-08
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    57   3e-08
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    56   3e-08
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    56   3e-08
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     56   3e-08
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    56   3e-08
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    56   3e-08
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    56   3e-08
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    56   3e-08
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    56   4e-08
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    56   4e-08
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    56   4e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    56   4e-08
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    56   4e-08
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    56   4e-08
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    55   5e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    55   5e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    55   6e-08
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    55   6e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    55   6e-08
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    55   6e-08
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    55   7e-08
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    55   7e-08
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    55   7e-08
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    55   7e-08
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    55   7e-08
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    55   7e-08
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    55   8e-08
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    55   8e-08
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    55   8e-08
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    55   8e-08
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    55   8e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    55   8e-08
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    55   8e-08
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    55   8e-08
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    55   9e-08
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    55   9e-08
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    55   9e-08
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    55   9e-08
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    55   9e-08
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    55   9e-08
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    55   9e-08
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    55   9e-08
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    55   9e-08
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    55   1e-07
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    55   1e-07
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    55   1e-07
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    55   1e-07
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    55   1e-07
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    55   1e-07
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    55   1e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    55   1e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    55   1e-07
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    55   1e-07
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    54   1e-07
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    54   1e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    54   1e-07
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    54   1e-07
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    55   1e-07
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    54   1e-07
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    55   1e-07
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    54   2e-07
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    54   2e-07
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    54   2e-07
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    54   2e-07
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    54   2e-07
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    54   2e-07
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    54   2e-07
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    54   2e-07
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    54   2e-07
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    54   2e-07
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    54   2e-07
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    53   2e-07
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    54   2e-07
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    54   2e-07
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    54   2e-07
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       54   2e-07
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    54   2e-07
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    54   2e-07
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    54   3e-07
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    54   3e-07
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    54   3e-07
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    54   3e-07
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    54   3e-07
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    53   3e-07
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    54   3e-07
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    53   3e-07
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    54   3e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    53   3e-07
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    54   3e-07
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    54   3e-07
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    53   3e-07
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    54   3e-07
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    53   3e-07
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    53   3e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    53   4e-07
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    53   4e-07
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    53   4e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    53   4e-07
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    53   4e-07
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    53   4e-07
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    53   4e-07
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    52   4e-07
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    53   4e-07
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    53   4e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    53   4e-07
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    53   4e-07
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     53   4e-07
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    53   4e-07
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    52   5e-07
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    53   5e-07
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    53   5e-07
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    52   5e-07
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    53   5e-07
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    53   5e-07
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    53   5e-07
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    53   5e-07
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    52   6e-07
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    52   6e-07
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    53   6e-07
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    52   6e-07
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    52   6e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    52   6e-07
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    52   7e-07
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    52   7e-07
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    52   7e-07
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    52   8e-07
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    52   8e-07
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    52   8e-07
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    52   8e-07
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    52   9e-07
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    52   9e-07
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    51   9e-07
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    52   9e-07
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    52   9e-07
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    52   9e-07
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    52   9e-07
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    52   9e-07
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    52   9e-07
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    52   1e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    52   1e-06
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    52   1e-06
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    52   1e-06
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    52   1e-06
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    51   1e-06
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    52   1e-06
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    52   1e-06
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    52   1e-06
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    52   1e-06
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    51   1e-06
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    52   1e-06
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    52   1e-06
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    52   1e-06
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    52   1e-06
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    51   1e-06
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    51   1e-06
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    51   1e-06
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    51   1e-06
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    51   1e-06
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    51   1e-06
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    51   1e-06
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    51   2e-06
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    50   2e-06
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    51   2e-06
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    51   2e-06
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    51   2e-06
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    51   2e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    51   2e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    51   2e-06
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    50   2e-06
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    51   2e-06
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    51   2e-06
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    51   2e-06
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    50   2e-06
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    50   2e-06
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    50   2e-06
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    51   3e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    51   3e-06
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    50   3e-06
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    50   3e-06
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    50   3e-06
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    50   3e-06
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    50   3e-06
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    50   3e-06
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    50   3e-06
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    50   3e-06
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    50   3e-06
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    50   3e-06
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    50   3e-06
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    50   3e-06
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    49   3e-06
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    50   3e-06
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    50   4e-06
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    50   4e-06
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    50   4e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    50   4e-06
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    50   4e-06
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    50   4e-06
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    50   4e-06
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    50   4e-06
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    50   4e-06
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    49   4e-06
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    50   4e-06
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    50   4e-06
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    49   4e-06
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    49   5e-06
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    50   5e-06
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    50   5e-06
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    49   5e-06
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    50   5e-06
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    49   5e-06
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    49   5e-06
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    49   5e-06
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    49   5e-06
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    50   5e-06
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    50   6e-06
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    49   6e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    50   6e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    49   6e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    49   6e-06
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    49   7e-06
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    49   7e-06
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    49   7e-06
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    49   8e-06
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    49   8e-06
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    49   8e-06
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    49   8e-06
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      49   9e-06
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    49   9e-06
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    49   9e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    49   9e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    49   9e-06
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    49   9e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    49   9e-06
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    49   9e-06
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    49   1e-05
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    49   1e-05
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    49   1e-05
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    49   1e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    49   1e-05
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    49   1e-05
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    48   1e-05
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    48   1e-05
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    49   1e-05
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    49   1e-05
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    49   1e-05
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    48   1e-05
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    48   1e-05
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    48   2e-05
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    48   2e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    48   2e-05
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    48   2e-05
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    48   2e-05
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    47   2e-05
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    47   2e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    48   2e-05
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    48   2e-05
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    48   2e-05
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    47   2e-05
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    48   2e-05
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    48   2e-05
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    47   2e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    47   2e-05
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    47   2e-05
ZYRO0C12188g Chr3 (953145..959606) [6462 bp, 2153 aa] {ON} simil...    48   3e-05
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    47   3e-05
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    47   3e-05
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    47   3e-05
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    47   3e-05
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    47   3e-05
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     47   3e-05
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    47   3e-05
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    47   3e-05
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    47   3e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    47   3e-05
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    47   3e-05
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    47   4e-05
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      47   4e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    47   4e-05
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    47   4e-05
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    46   4e-05
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    47   4e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    47   4e-05
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    47   4e-05
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    47   4e-05
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    47   4e-05
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    47   4e-05
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    47   4e-05
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    47   4e-05
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    47   4e-05
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    47   4e-05
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    47   4e-05
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    47   5e-05
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    47   5e-05
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    47   5e-05
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    47   5e-05
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    47   5e-05
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    46   5e-05
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    46   5e-05
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    46   6e-05
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    46   6e-05
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    46   6e-05
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    46   6e-05
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    46   6e-05
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    46   6e-05
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    46   7e-05
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    46   7e-05
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    46   7e-05
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    46   8e-05
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    46   8e-05
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    46   8e-05
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    46   8e-05
ABL096W Chr2 (217132..218472) [1341 bp, 446 aa] {ON} Syntenic ho...    46   8e-05
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    46   8e-05
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    46   8e-05
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    46   8e-05
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    46   9e-05
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    45   9e-05
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    45   9e-05
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    45   9e-05
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    45   9e-05
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    45   9e-05
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     46   9e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    45   1e-04
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    46   1e-04
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    45   1e-04
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    45   1e-04
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    45   1e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    45   1e-04
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    45   1e-04
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    45   1e-04
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    45   1e-04
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    45   1e-04
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    45   1e-04
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    45   1e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    45   1e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    45   1e-04
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    45   1e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    45   1e-04
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    45   1e-04
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    45   1e-04
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    45   2e-04
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    44   2e-04
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    45   2e-04
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    45   2e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    45   2e-04
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    45   2e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   2e-04
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    44   2e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    45   2e-04
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    45   2e-04
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    45   2e-04
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    45   2e-04
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    45   2e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   2e-04
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    45   2e-04
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    45   2e-04
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    44   2e-04
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    44   2e-04
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    45   2e-04
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    44   2e-04
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    44   2e-04
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    44   2e-04
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    44   3e-04
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    44   3e-04
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    44   3e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    44   3e-04
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    44   3e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    44   3e-04
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    44   3e-04
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    44   3e-04
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    44   3e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    44   3e-04
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    44   3e-04
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    44   3e-04
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    44   3e-04
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    44   3e-04
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    44   3e-04
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    44   3e-04
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    44   3e-04
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    44   4e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    44   4e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   4e-04
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    44   4e-04
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    44   4e-04
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    43   4e-04
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    43   5e-04
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    43   5e-04
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    43   5e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    44   5e-04
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    44   5e-04
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    44   5e-04
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    43   6e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    44   6e-04
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    43   6e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               43   6e-04
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    43   6e-04
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    43   6e-04
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    43   6e-04
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    43   6e-04
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    43   7e-04
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    43   7e-04
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    43   7e-04
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    43   8e-04
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    43   8e-04
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    43   8e-04
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    43   9e-04
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    43   0.001
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    42   0.001
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    42   0.001
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    42   0.001
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    42   0.001
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    42   0.001
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    42   0.001
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    42   0.001
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    42   0.001
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    42   0.001
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    42   0.001
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    42   0.001
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    42   0.001
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    42   0.001
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.001
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    42   0.001
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    42   0.001
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    42   0.001
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    42   0.001
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    42   0.001
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    42   0.001
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    42   0.001
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    42   0.001
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    42   0.001
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    42   0.001
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    42   0.002
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    42   0.002
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    42   0.002
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    42   0.002
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    42   0.002
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    42   0.002
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    42   0.002
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    42   0.002
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    41   0.002
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    42   0.002
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    41   0.002
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    42   0.002
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    41   0.002
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    42   0.002
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    42   0.002
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    41   0.002
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    41   0.002
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    41   0.002
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    41   0.002
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    41   0.002
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    41   0.002
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    41   0.002
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    41   0.002
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    41   0.003
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    41   0.003
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    41   0.003
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    41   0.003
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    41   0.003
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    41   0.003
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    41   0.003
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    41   0.003
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    40   0.003
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    41   0.003
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    41   0.003
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    41   0.003
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    41   0.003
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    41   0.003
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    41   0.003
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    41   0.003
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    40   0.004
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    41   0.004
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    41   0.004
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    41   0.004
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    40   0.004
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    40   0.004
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    40   0.004
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    41   0.004
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    41   0.004
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    40   0.004
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    40   0.004
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    40   0.004
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    40   0.004
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    40   0.005
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    40   0.005
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    40   0.005
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    40   0.005
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    40   0.005
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    40   0.005
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    40   0.005
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    40   0.005
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    40   0.006
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    40   0.006
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    40   0.006
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    40   0.006
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    40   0.006
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    40   0.006
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    40   0.006
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    40   0.006
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    40   0.006
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    40   0.006
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    40   0.006
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    40   0.006
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    40   0.007
TDEL0F01000 Chr6 (176870..178516) [1647 bp, 548 aa] {ON} Anc_8.1...    40   0.007
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    40   0.007
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    40   0.007
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    40   0.007
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    40   0.007
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    40   0.007
TDEL0D02290 Chr4 complement(442275..443876) [1602 bp, 533 aa] {O...    40   0.007
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    40   0.007
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    40   0.007
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    39   0.007
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    40   0.007
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    40   0.008
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    39   0.008
Smik_11.117 Chr11 (199819..202362) [2544 bp, 847 aa] {ON} YKL121...    40   0.008
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    39   0.008
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    39   0.008
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    40   0.008
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    39   0.008
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    40   0.008
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    39   0.009
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    39   0.009
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.009
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    39   0.009
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    39   0.009
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    39   0.009
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    39   0.009
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    39   0.009
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    40   0.010
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    39   0.010
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    39   0.010
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    39   0.010
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    39   0.010
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    39   0.011
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    39   0.011
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    39   0.011
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    39   0.011
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    39   0.011
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    39   0.011
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    39   0.011
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    39   0.011
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    39   0.012
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    39   0.012
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    39   0.012
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.013
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    39   0.013
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    39   0.013
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    39   0.014
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    39   0.014
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    39   0.015
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.015
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.015
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    39   0.016
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    39   0.016
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    39   0.016
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    39   0.016
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    38   0.016
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    39   0.016
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    39   0.016
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.018
Ecym_8312 Chr8 complement(636090..638663) [2574 bp, 857 aa] {ON}...    39   0.018
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    38   0.018
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    39   0.018
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    38   0.019
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    38   0.020
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    38   0.021
TDEL0F01750 Chr6 (325359..328655) [3297 bp, 1098 aa] {ON} Anc_6....    39   0.021
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    38   0.022
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    38   0.022
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    38   0.023
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    38   0.023
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    38   0.023
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    38   0.023
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    38   0.024
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    38   0.025
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    38   0.026
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    38   0.026
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    38   0.026
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    38   0.026
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    38   0.027
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    38   0.027
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    38   0.028
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    38   0.028
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    38   0.029
Kpol_1006.15 s1006 complement(54320..55933) [1614 bp, 537 aa] {O...    38   0.030
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    38   0.032
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    38   0.033
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    37   0.034
TPHA0C00610 Chr3 complement(112452..113798) [1347 bp, 448 aa] {O...    37   0.035
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    37   0.035
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    37   0.035
KLLA0F01991g Chr6 complement(179904..182510) [2607 bp, 868 aa] {...    38   0.036
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    37   0.037
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    37   0.037
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    37   0.038
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    37   0.038
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    37   0.040
TPHA0E03510 Chr5 (741718..748116) [6399 bp, 2132 aa] {ON} Anc_1....    38   0.041
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    37   0.043
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    37   0.044
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    37   0.044
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    37   0.044
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    37   0.045
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    37   0.045
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    37   0.046
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.048
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    37   0.048
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    37   0.049
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    37   0.049
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    37   0.049
SAKL0F15730g Chr6 (1278090..1279715) [1626 bp, 541 aa] {ON} simi...    37   0.051
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    37   0.054
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    37   0.054
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    37   0.055
KLLA0A08129g Chr1 (722217..726026) [3810 bp, 1269 aa] {ON} simil...    37   0.055
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    37   0.056
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    37   0.056
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    37   0.056
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.056
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    37   0.057
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    37   0.058
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    37   0.060
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    37   0.060
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               37   0.063
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    37   0.063
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    37   0.064
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    37   0.064
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    37   0.065
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    37   0.065
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    37   0.069
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.070
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    37   0.071
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    37   0.072
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    36   0.073
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    37   0.074
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    37   0.074
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    37   0.074
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    37   0.075
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    37   0.076
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    37   0.076
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    36   0.077
Kpol_1018.67 s1018 (194053..195033) [981 bp, 326 aa] {ON} (19405...    36   0.078
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    36   0.078
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    37   0.078
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    36   0.081
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    37   0.083
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    36   0.083
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    36   0.084
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    36   0.085
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    37   0.088
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    36   0.089
TBLA0C02620 Chr3 (622295..624985) [2691 bp, 896 aa] {ON} Anc_1.3...    36   0.090
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    36   0.091
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    36   0.091
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.092
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    36   0.096
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               36   0.096
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    36   0.096
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    36   0.097
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    36   0.097
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    36   0.098
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    36   0.099
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    36   0.099
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    36   0.100
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    36   0.10 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    36   0.10 
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    36   0.10 
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    36   0.11 
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    36   0.11 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    36   0.11 
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    36   0.11 
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    36   0.11 
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    36   0.11 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    36   0.11 
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    36   0.11 
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    36   0.11 
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    36   0.12 
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    36   0.12 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    36   0.12 
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    36   0.12 
KAFR0A04350 Chr1 (865961..869305) [3345 bp, 1114 aa] {ON} Anc_6....    36   0.12 
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    36   0.12 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    36   0.12 
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    36   0.13 
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    36   0.13 
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    36   0.13 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    36   0.13 
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    35   0.13 
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    36   0.13 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    36   0.13 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    35   0.14 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    36   0.14 
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    35   0.14 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    35   0.14 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    35   0.15 
YJL069C Chr10 complement(310922..312706) [1785 bp, 594 aa] {ON} ...    35   0.16 
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    35   0.16 
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    35   0.16 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    35   0.16 
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    35   0.16 
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    35   0.17 
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    35   0.17 
Kwal_0.49 s0 (20604..22358) [1755 bp, 584 aa] {ON} YJL069C (UTP1...    35   0.17 
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    35   0.18 
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    35   0.18 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    35   0.19 
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    35   0.19 
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    35   0.19 
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    35   0.19 
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    35   0.19 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    35   0.20 
ZYRO0G00946g Chr7 complement(72544..74184) [1641 bp, 546 aa] {ON...    35   0.20 
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    35   0.20 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   0.20 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    35   0.20 
Kwal_47.18825 s47 complement(989263..991137) [1875 bp, 624 aa] {...    35   0.21 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   0.21 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    35   0.21 
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    35   0.21 
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    35   0.21 
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    35   0.21 
NDAI0F00770 Chr6 (185453..188332) [2880 bp, 959 aa] {ON} Anc_5.6...    35   0.22 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    35   0.22 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    35   0.23 
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    35   0.23 
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    35   0.23 
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    35   0.23 
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    35   0.23 
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    35   0.23 
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    35   0.23 
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    35   0.24 
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    35   0.25 
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    35   0.25 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    35   0.26 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    35   0.26 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    35   0.26 
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    35   0.26 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    35   0.26 
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    35   0.27 
TPHA0D01010 Chr4 complement(204354..206117) [1764 bp, 587 aa] {O...    35   0.27 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    35   0.27 
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    35   0.28 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    35   0.28 
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    35   0.29 
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    35   0.29 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    35   0.29 
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    34   0.30 
KLTH0H11022g Chr8 (947447..949195) [1749 bp, 582 aa] {ON} simila...    35   0.31 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    35   0.31 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    35   0.31 
KNAG0J01580 Chr10 (290362..291768) [1407 bp, 468 aa] {ON}              35   0.31 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    35   0.31 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    34   0.32 
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    35   0.32 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    35   0.32 
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    35   0.33 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    34   0.33 
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    34   0.34 
CAGL0K02277g Chr11 (203760..205463) [1704 bp, 567 aa] {ON} simil...    34   0.34 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    34   0.34 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    35   0.34 
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    34   0.34 
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    34   0.35 
ZYRO0G03564g Chr7 complement(281481..284786) [3306 bp, 1101 aa] ...    35   0.35 
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    34   0.36 
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    34   0.36 
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    34   0.36 
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    34   0.37 
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    34   0.38 
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    34   0.38 
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    34   0.38 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    34   0.38 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    34   0.40 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    34   0.40 
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    34   0.41 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    34   0.41 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    34   0.41 
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    34   0.41 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    34   0.41 
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    34   0.43 
Ecym_6275 Chr6 complement(519744..521456) [1713 bp, 570 aa] {ON}...    34   0.44 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    34   0.44 
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    33   0.44 
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    34   0.44 
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    34   0.44 
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    34   0.44 
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    34   0.45 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    34   0.45 
Smik_7.189 Chr7 complement(325444..328791) [3348 bp, 1115 aa] {O...    34   0.46 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    34   0.46 
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    34   0.46 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    34   0.47 
SAKL0H16346g Chr8 (1434415..1434435,1434509..1436419) [1932 bp, ...    34   0.48 
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    34   0.48 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    34   0.49 
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    34   0.49 
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   0.50 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    34   0.50 
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    33   0.51 
SAKL0H22638g Chr8 complement(1968593..1972378) [3786 bp, 1261 aa...    34   0.51 
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    34   0.51 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    34   0.52 
SAKL0C04422g Chr3 complement(431806..438456) [6651 bp, 2216 aa] ...    34   0.52 
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    34   0.52 
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    34   0.54 
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    34   0.56 
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    34   0.57 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    34   0.57 
Kwal_26.7573 s26 (424345..424644) [300 bp, 99 aa] {OFF} YMR116C ...    32   0.57 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    34   0.59 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    34   0.60 
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    33   0.60 
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    33   0.60 
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    33   0.61 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    33   0.61 
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    34   0.62 
KAFR0A01660 Chr1 complement(339554..341353) [1800 bp, 599 aa] {O...    33   0.63 
TBLA0D04560 Chr4 (1130244..1131584) [1341 bp, 446 aa] {ON} Anc_7...    33   0.63 
KLTH0H14256g Chr8 complement(1238169..1241963) [3795 bp, 1264 aa...    34   0.64 
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    33   0.64 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    33   0.64 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    33   0.64 
NCAS0B08480 Chr2 (1619636..1626055) [6420 bp, 2139 aa] {ON} Anc_...    34   0.65 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    33   0.65 
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    33   0.66 
NCAS0B04140 Chr2 complement(748270..751122) [2853 bp, 950 aa] {O...    33   0.66 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    33   0.67 
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    33   0.68 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    33   0.68 
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    33   0.69 
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    33   0.69 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    33   0.69 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    33   0.69 
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    33   0.70 
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    33   0.71 
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    33   0.72 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    33   0.73 
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    33   0.73 
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    33   0.73 
YGL094C Chr7 complement(331118..334465) [3348 bp, 1115 aa] {ON} ...    33   0.74 
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    33   0.74 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    33   0.74 
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    33   0.75 
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    33   0.75 
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    33   0.75 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    33   0.76 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    33   0.76 
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    33   0.78 
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    33   0.78 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   0.79 
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    33   0.80 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               33   0.82 
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    33   0.83 
CAGL0H02937g Chr8 complement(269645..271477) [1833 bp, 610 aa] {...    33   0.83 
YER124C Chr5 complement(407342..409063) [1722 bp, 573 aa] {ON}  ...    33   0.83 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    33   0.86 
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    33   0.86 
Suva_7.175 Chr7 complement(323780..327127) [3348 bp, 1115 aa] {O...    33   0.88 
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    33   0.88 
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    33   0.88 
KNAG0B02990 Chr2 (577427..579097) [1671 bp, 556 aa] {ON} Anc_7.2...    33   0.88 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    33   0.88 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    33   0.89 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    33   0.89 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    33   0.89 
NCAS0H02330 Chr8 complement(458362..460311) [1950 bp, 649 aa] {O...    33   0.89 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    33   0.90 
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    33   0.93 
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    33   0.93 
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    33   0.95 
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    33   0.96 
ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]...    33   0.99 
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    33   1.00 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    33   1.0  
Smik_15.204 Chr15 (345627..346652) [1026 bp, 341 aa] {ON} YOR026...    33   1.0  
Smik_4.319 Chr4 (570640..573624) [2985 bp, 994 aa] {ON} YDR080W ...    33   1.0  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    33   1.0  
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    33   1.0  
Ecym_3559 Chr3 complement(1060241..1061944) [1704 bp, 567 aa] {O...    33   1.0  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    33   1.0  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    33   1.0  
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    33   1.0  
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    33   1.1  
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   1.1  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    33   1.1  
TPHA0O01210 Chr15 complement(238057..239778) [1722 bp, 573 aa] {...    33   1.1  
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    33   1.1  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    33   1.2  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   1.2  
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    33   1.2  
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    33   1.2  
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   1.2  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    33   1.3  
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    33   1.3  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   1.3  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    33   1.3  
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    33   1.3  
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    32   1.3  
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    32   1.3  
Skud_4.335 Chr4 (579305..582289) [2985 bp, 994 aa] {ON} YDR080W ...    33   1.3  
AEL153W Chr5 (343247..344950) [1704 bp, 567 aa] {ON} Syntenic ho...    33   1.3  
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    33   1.3  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    32   1.4  
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    33   1.4  
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    32   1.4  
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    33   1.4  
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    33   1.4  
TDEL0A01650 Chr1 (298190..299332) [1143 bp, 380 aa] {ON} Anc_6.1...    32   1.4  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    32   1.4  
Kwal_0.356 s0 (169040..170620) [1581 bp, 526 aa] {ON} YFR021W (A...    32   1.5  
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    32   1.5  
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    32   1.5  
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    32   1.5  
SAKL0F13640g Chr6 (1089998..1093051) [3054 bp, 1017 aa] {ON} hig...    32   1.6  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   1.6  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    32   1.6  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    32   1.6  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    32   1.6  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    32   1.6  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    32   1.6  
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    32   1.6  
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              32   1.6  
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    32   1.7  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    32   1.7  
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    32   1.7  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    32   1.7  
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    32   1.7  
CAGL0K10692g Chr11 (1040242..1041759) [1518 bp, 505 aa] {ON} sim...    32   1.7  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    32   1.7  
Skud_7.188 Chr7 complement(334278..337625) [3348 bp, 1115 aa] {O...    32   1.7  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    32   1.8  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    32   1.8  
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     32   1.8  
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    32   1.9  
NCAS0B04530 Chr2 complement(823022..824746) [1725 bp, 574 aa] {O...    32   1.9  
Skud_8.262 Chr8 (460838..462565) [1728 bp, 575 aa] {ON} YHR196W ...    32   1.9  
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    32   1.9  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    32   1.9  
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    32   1.9  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    32   1.9  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    32   1.9  
Skud_5.254 Chr5 (412459..414180) [1722 bp, 573 aa] {ON} YER124C ...    32   1.9  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    32   1.9  
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    32   2.0  
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    32   2.0  
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    32   2.0  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    32   2.0  
TDEL0A07480 Chr1 complement(1303665..1306520) [2856 bp, 951 aa] ...    32   2.0  
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    32   2.0  
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    32   2.0  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    32   2.0  
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    32   2.1  
KLLA0E06425g Chr5 complement(574273..577239) [2967 bp, 988 aa] {...    32   2.1  
Ecym_5534 Chr5 complement(1080033..1082465) [2433 bp, 810 aa] {O...    32   2.1  
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    32   2.1  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    32   2.1  
Smik_3.135 Chr3 (177658..184158) [6501 bp, 2166 aa] {ON} YCR032W...    32   2.1  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    32   2.2  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    32   2.2  
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    32   2.3  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    32   2.3  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    32   2.3  
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    32   2.3  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    32   2.3  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    32   2.4  
KAFR0E00720 Chr5 (153164..154477) [1314 bp, 437 aa] {ON} Anc_8.5...    32   2.4  
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    32   2.4  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   2.5  
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    32   2.6  
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    32   2.6  
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    32   2.7  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    32   2.7  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    32   2.7  
KNAG0J00150 Chr10 complement(11793..13643) [1851 bp, 616 aa] {ON...    32   2.7  
YDR080W Chr4 (604008..606986) [2979 bp, 992 aa] {ON}  VPS41Vacuo...    32   2.8  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    32   2.8  
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    32   2.8  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    31   2.8  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    32   2.9  
YOR026W Chr15 (379781..380806) [1026 bp, 341 aa] {ON}  BUB3Kinet...    31   2.9  
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    32   3.0  
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    32   3.0  
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    31   3.0  
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    32   3.1  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    32   3.2  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    31   3.2  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    31   3.2  
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    31   3.3  
Ecym_8134 Chr8 (277019..283225) [6207 bp, 2068 aa] {ON} similar ...    32   3.4  
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    31   3.4  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    32   3.4  
TPHA0F02850 Chr6 complement(633867..635480) [1614 bp, 537 aa] {O...    31   3.4  
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    31   3.4  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    31   3.5  
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    31   3.5  
NDAI0J00810 Chr10 complement(179995..181353) [1359 bp, 452 aa] {...    31   3.5  
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    31   3.5  
AFR153W Chr6 (711168..712898) [1731 bp, 576 aa] {ON} Syntenic ho...    31   3.6  
NCAS0D03400 Chr4 complement(635698..636840) [1143 bp, 380 aa] {O...    31   3.7  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    31   3.8  
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    31   3.9  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    31   3.9  
Smik_7.332 Chr7 (556142..557641) [1500 bp, 499 aa] {ON} YFR021W ...    31   4.0  
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    31   4.0  
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    31   4.1  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    31   4.2  
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    31   4.2  
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    31   4.2  
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    31   4.3  
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    31   4.7  
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    31   4.7  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    31   4.8  
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    31   4.8  
TBLA0B02980 Chr2 complement(688324..690663) [2340 bp, 779 aa] {O...    31   4.9  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    30   4.9  
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    31   5.0  
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    31   5.0  
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    31   5.2  
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    31   5.2  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    31   5.3  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    31   5.3  
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    30   5.4  
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    30   5.4  
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    30   5.7  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    31   5.7  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    30   5.8  
Smik_5.269 Chr5 complement(416222..417940) [1719 bp, 572 aa] {ON...    30   5.9  
TPHA0H00350 Chr8 complement(67735..69354) [1620 bp, 539 aa] {ON}...    30   6.2  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    30   6.4  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    30   6.4  
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    30   6.4  
KLTH0E08360g Chr5 complement(762740..766468) [3729 bp, 1242 aa] ...    30   6.5  
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    30   6.5  
YBL104C Chr2 complement(18177..21293) [3117 bp, 1038 aa] {ON}  S...    30   6.6  
NDAI0G04860 Chr7 (1169649..1173797) [4149 bp, 1382 aa] {ON} Anc_...    30   6.6  
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    30   6.6  
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    30   6.8  
KLLA0F10615g Chr6 (978492..979604) [1113 bp, 370 aa] {ON} highly...    30   6.9  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    30   7.0  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    30   7.0  
AAR048W Chr1 (425661..428696) [3036 bp, 1011 aa] {ON} Syntenic h...    30   7.1  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    30   7.3  
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    30   7.5  
Suva_4.21 Chr4 complement(45539..48805) [3267 bp, 1088 aa] {ON} ...    30   7.5  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    30   7.6  
AFL022W Chr6 (397359..398474) [1116 bp, 371 aa] {ON} Syntenic ho...    30   7.6  
CAGL0I03542g Chr9 (299881..301485) [1605 bp, 534 aa] {ON} simila...    30   7.7  
KLLA0F02013g Chr6 (183770..185470) [1701 bp, 566 aa] {ON} simila...    30   7.8  
TPHA0A01250 Chr1 (240466..241863) [1398 bp, 465 aa] {ON} Anc_8.5...    30   7.8  
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    30   8.1  
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               30   8.1  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    30   8.2  
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    30   8.4  
YPL100W Chr16 (361872..363362) [1491 bp, 496 aa] {ON}  ATG21Phos...    30   8.5  
KNAG0F02350 Chr6 (441601..442767) [1167 bp, 388 aa] {ON} Anc_6.1...    30   9.0  
ZYRO0D08382g Chr4 (724961..728035) [3075 bp, 1024 aa] {ON} simil...    30   9.1  
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    30   9.2  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    30   9.2  
AFR620W Chr6 (1553963..1560286) [6324 bp, 2107 aa] {ON} Syntenic...    30   9.6  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    30   9.7  
Smik_16.136 Chr16 (245086..246576) [1491 bp, 496 aa] {ON} YPL100...    30   9.9  
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    30   9.9  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    30   10.0 

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK
Sbjct: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF
Sbjct: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/303 (98%), Positives = 301/303 (99%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI+SDKRFLAAAGHLNVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKH AAVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCDQDGN++IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVWQMPHQTDAANP+PVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF
Sbjct: 181 GNCYVWQMPHQTDAANPRPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           QLETTLD HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/303 (93%), Positives = 295/303 (97%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEI+SDKRFLAAAGHL+VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPVTSFEGHRGNVTSI+FQQ+NKWMVSSSEDGTIKVWDVRAPSVQRNYKH A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCDQDGN+RIWDLGENQC HQL PEDDTPLQSLS+ASDGSMLVAGNNK
Sbjct: 121 EVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVWQMP+ TDAAN KPVTKFRSH KYITRVLLSSDVKHLATCSADHTARVWSI+DNF
Sbjct: 181 GNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/303 (91%), Positives = 290/303 (95%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEI+SDKR+LAA GHL+VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAGGHLHVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPVTSFEGHRGNVTSIAFQQ+NKWMVSSSEDGTIKVWDVR PSVQRNYKH A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRTPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCDQDGN++IWDLGENQC HQLA EDDTPLQSLS+ASDGSMLVAG+NK
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTHQLALEDDTPLQSLSIASDGSMLVAGSNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TD AN KPVTKFRSH KYITRVLLS DVKHLATCSADHTARVWSI+DNF
Sbjct: 181 GNCYVWKMPNHTDTANLKPVTKFRSHTKYITRVLLSVDVKHLATCSADHTARVWSIEDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           QLETTLD H RWVWDCAFSADSAYLVTACSDHY+RLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDTHSRWVWDCAFSADSAYLVTACSDHYIRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL006W
           (LST8)
          Length = 303

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/303 (90%), Positives = 292/303 (96%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEI+SDKR+LAAAGHL+VR+YDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPVTSFEGHRGNVTSIAFQQ+NKWMVSSSEDGTIKVWDVR+PSVQRNYKH A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCDQDGN++IWDLGENQC +QLA ED+T LQSLS+ASDGSMLVAGNNK
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TD A+ KPVTKFRSH+KYITRVLLS DVKHLATCSADHTARVWS++DNF
Sbjct: 181 GNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           QLETTLD H RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/303 (88%), Positives = 291/303 (96%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVILASAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEI+SDK++LAAAGHL+VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           R+ NPNPV+SFEGH+GNVTSIAFQQEN+WMVSSSEDGTIKVWDVR+PSVQRNYKH A VN
Sbjct: 61  RSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EV IHPNQGELISCDQDGN+RIWDLGENQC +QL PED+TPLQSLSVASDGSMLVAGNNK
Sbjct: 121 EVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MPH TDA+  +PVTKF+SH KYITRVLLS+DVKHLATCSADHTARVW+I+DNF
Sbjct: 181 GNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTACSDHYVRLWDLST EIVRQYGGHHKGA+CVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/303 (89%), Positives = 289/303 (95%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSV+L SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI+SDK+ LAAAGH NVRLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTSI+FQQ+NKWMVSSSEDGTIKVWDVRAPSV RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDTPLQSLS+ASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANSK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP++TDA+N KPVTKFRSHA YITR+LLSSDVKHLATCSADHTARVWSID+NF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLST+EIVRQYGGHHKGA+CVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/303 (87%), Positives = 286/303 (94%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LAAAGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+NKWM +SSEDGTIKVWDVRAPS+ RNYK  A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DG++RIWDLGENQC HQL PEDDTPLQSLS+ASDGSMLVA NNK
Sbjct: 121 EVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP++TDA+N KPVTKFRSH  YITR+LLSSDVKHLATCSADHTARVWS+DDNF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYL+TA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 286/303 (94%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDT LQSLS+ASDGSML A N+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP++TDA++ KPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSIDD+F
Sbjct: 181 GNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 284/303 (93%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDT LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TDA++ KPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSIDD+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 284/303 (93%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDT LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TDA++ KPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSIDD+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/303 (85%), Positives = 285/303 (94%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ L AAGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV +FEGH+GNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PSV RNYKH A VN
Sbjct: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PED+TPLQSLSVASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TDA+N KPVTKF++H+ YITR+LLSSDVKHLATCSAD TAR WS+DDNF
Sbjct: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/303 (85%), Positives = 285/303 (94%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDT LQSLS+ASDGSML A N+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TDA++ KPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSI+D+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/303 (85%), Positives = 283/303 (93%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LAAAGH NVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPNPV SFEGH+GNVTS++FQQ+NKWMVSSSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDD PLQS+SVASDGSMLVA N K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNC+VW+MP+ TDA+N KPVTKF++H  YITR+LLSSDVKHLATCSADHT RVWSID+NF
Sbjct: 181 GNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTRE+VRQYGGHHKG +CVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/303 (83%), Positives = 281/303 (92%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSV+L SAGYDHTIRFWEALTGVC RTIQH DSQVNRLEI++DK+ LAAAGH N+RLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           +T+N NPV SFEGHRGNVTS++FQQ+NKWMV+SSEDGTIKVWD+R+PSV RNYKH A VN
Sbjct: 61  KTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDD PLQSLSVASDGSMLVA NNK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP+ TDA+N KP TKF++H  YITRVLLSSDVKH+ATCSADHTAR+WS++DNF
Sbjct: 181 GNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            LE+TLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTR+I+RQYGGHHKGA+CVAL
Sbjct: 241 NLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/303 (83%), Positives = 279/303 (92%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL I++DK+ LAAAGH NV+LYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
            TTNPNPV SFEGHRGNVTS++FQ +N+WMV+SSEDGTIKVWDVR+PSV R YKH A VN
Sbjct: 61  NTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EV IHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDTP+QSLS+A+DGSMLVA N+K
Sbjct: 121 EVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSK 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCYVW+MP++TDA+N KPVTKFR+H  YITR+LLSSDVK LATCSADHTAR+WSIDDNF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            L TTLD HQRWVWDCAFSADSAYL+TA SDHYVRLWDLSTREIVRQY GHHKGA+CVAL
Sbjct: 241 NLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/307 (81%), Positives = 280/307 (91%), Gaps = 4/307 (1%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LAAAG+ NVRLYDI
Sbjct: 21  MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDI 80

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           RTTNPN V +FEGH+GNVTS++FQQ+NKWMV+SSEDGTIKVWDVR+PSV RNYKH A VN
Sbjct: 81  RTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 140

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDD-TPLQSLSVASDGSMLVAGNN 179
           EVVIHPNQGELISCD+DG ++IWDLGENQC HQL P+DD T LQSLSVASDGSMLVA NN
Sbjct: 141 EVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANN 200

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI--- 236
           KG+CYVW+MP+ TDA+N KP+ KF +H  YITRV+LSSDVKH+ATCSAD TA++WS+   
Sbjct: 201 KGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGET 260

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           +D+F LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+
Sbjct: 261 EDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 320

Query: 297 CVALNDV 303
           CVALNDV
Sbjct: 321 CVALNDV 327

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/303 (79%), Positives = 276/303 (91%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSV+L SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL+I++DK+ LAAAGHLNV+LYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLQITNDKKLLAAAGHLNVKLYDI 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
            TTNPNPV SFEGH+GNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PSV RNYKH A VN
Sbjct: 61  NTTNPNPVGSFEGHKGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQ+ PE+D  L+SLS+ASDGSML A N++
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQITPEEDVSLESLSIASDGSMLAAANDR 180

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
           GNCY+W+MP+ TDA+N KPV  F +H  Y+TRVLLSSDVKHLATCSAD +AR+WS+++ F
Sbjct: 181 GNCYIWEMPNHTDASNLKPVKTFSAHETYVTRVLLSSDVKHLATCSADQSARIWSVENGF 240

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           Q E  L+ HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QRECALEGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           +DV
Sbjct: 301 DDV 303

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 266/304 (87%), Gaps = 1/304 (0%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH DSQVN+LEI++DK+ LAAAG  N++LYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPDSQVNKLEITNDKKLLAAAGSNNIKLYDV 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
            T+N NP+ SF+GH+ NVTSI FQ ENKWMV+SSED TIK+WD+R+PS  R YKH   VN
Sbjct: 61  NTSNSNPIASFDGHKNNVTSINFQVENKWMVTSSEDNTIKLWDIRSPSSPRTYKHNCPVN 120

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPED-DTPLQSLSVASDGSMLVAGNN 179
           EV+IHPNQGELISCD+DGN+RIWDLGENQC HQL PED D  +QS+S+A+DGSMLVA NN
Sbjct: 121 EVIIHPNQGELISCDKDGNIRIWDLGENQCTHQLTPEDNDISIQSISLANDGSMLVAANN 180

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
           KGNCYVW MP++ DA+N KP+TKF++H  YIT++LLSSDVK++ATCSADHTAR+WS++DN
Sbjct: 181 KGNCYVWDMPNKIDASNLKPITKFKAHDSYITKILLSSDVKYMATCSADHTARIWSVEDN 240

Query: 240 FQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           F L+ TL  HQRWVWDCAFSADSAYLVTA SDHYVRLWDLST EIVRQY GH KGA CVA
Sbjct: 241 FTLDKTLTGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTNEIVRQYSGHQKGATCVA 300

Query: 300 LNDV 303
           LND+
Sbjct: 301 LNDI 304

>TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {ON}
           Anc_1.399 YNL006W
          Length = 327

 Score =  445 bits (1145), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 212/327 (64%), Positives = 253/327 (77%), Gaps = 24/327 (7%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH +SQVNRLEISSDK  LAAA + +VRLYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPESQVNRLEISSDKTLLAAAANQSVRLYDL 60

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQ--- 116
           ++ NP P+   +GH GNVT++AFQ+E +W+ ++SEDG ++VWDVR+P  Q R Y H    
Sbjct: 61  QSANPTPLACLDGHGGNVTAVAFQRERQWIATASEDGAVRVWDVRSPPTQPRIYLHGSSG 120

Query: 117 -------------------AAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPE 157
                              A VN+V IHPNQ EL+SCD+ G +R+WDL   +  HQL PE
Sbjct: 121 SSSSTSGNSSSASSVGTGAAPVNDVAIHPNQAELVSCDRSGTLRVWDLAGGRSTHQLVPE 180

Query: 158 DDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS 217
           DD PLQSLS++ DGS LVA N KGNCYVW MP++TDA++ KP++ F++H  YITR LLSS
Sbjct: 181 DDIPLQSLSLSPDGSTLVAANTKGNCYVWDMPNRTDASSLKPLSVFKAHNTYITRALLSS 240

Query: 218 DVKHLATCSADHTARVWSID-DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRL 276
           D KH+ATCSADHTA++WSID ++  LE TLD HQRWVWDCAFSADSAYLVTA SDHYVRL
Sbjct: 241 DGKHIATCSADHTAKIWSIDNESVNLEITLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 300

Query: 277 WDLSTREIVRQYGGHHKGAICVALNDV 303
           WDLST+EIVRQYGGH KG ICVALND+
Sbjct: 301 WDLSTKEIVRQYGGHQKGVICVALNDI 327

>Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON}
           (30012..32012) [2001 nt, 667 aa]
          Length = 666

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 123/292 (42%), Gaps = 26/292 (8%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +  +   V  L    D++ +  +    +R+++  T 
Sbjct: 321 LLFTGSYDSTIAIWDLSTGKLLRRLTGNGDGVKTLHFD-DQKLITGSLDKTIRVWNYVTG 379

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  +V SI      K +VS S D T+KVW + + +      H   VN V 
Sbjct: 380 EC--ISTYRGHTDSVMSI--DSYKKIIVSGSADKTVKVWHIESRACYTLRGHTEWVNCVK 435

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      SC  D  +R+WD+  N C+     H    +   PL  L V +    LV   
Sbjct: 436 LHPKSFSCFSCSDDTTIRMWDIRSNSCLKVFRGHVGQVQKVIPLTILDVEN----LVVDQ 491

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
              N    +     D  +     K      Y T         HL +CS D+T ++W +  
Sbjct: 492 VPDNLSSSETQESNDEEDTSENVKLDESLPYPT---------HLLSCSLDNTIKLWDVKT 542

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
              + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 543 GNCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGTIKIWDLQSGKCMHTFAG 591

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 73/176 (41%), Gaps = 13/176 (7%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127
           +  F+GH   V ++ F    + + + S D TI +WD+    + R            +H +
Sbjct: 302 LQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIAIWDLSTGKLLRRLTGNGD-GVKTLHFD 358

Query: 128 QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187
             +LI+   D  +R+W+    +C+       D+    +S+ S   ++V+G+      VW 
Sbjct: 359 DQKLITGSLDKTIRVWNYVTGECISTYRGHTDS---VMSIDSYKKIIVSGSADKTVKVWH 415

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
           +         +     R H +++  V L        +CS D T R+W I  N  L+
Sbjct: 416 I-------ESRACYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRSNSCLK 464

>KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} similar
           to uniprot|P39014 Saccharomyces cerevisiae YIL046W MET30
           F-box protein containing five copies of the WD40 motif
           controls cell cycle function sulfur metabolism and
           methionine biosynthesis as part of the ubiquitin ligase
           complex interacts with and regulates Met4p localizes
           within the nucleus
          Length = 623

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 136/307 (44%), Gaps = 35/307 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  +G   R +      V  +    D++ + A+    +R+++  T 
Sbjct: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD-DQKMITASLDKTIRVWNYITG 382

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
           +   ++++ GH+ +V S+      K +VS+S D T+KVW V + +      H   VN V 
Sbjct: 383 SC--ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      S   D  +R+WD+  N C+     H    +   PL       D   LV   
Sbjct: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL----TIKDTENLVVDE 494

Query: 179 NKGNCYVWQMPH---QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
                 + ++P+   + D A+      F  + KY T         HL +CS D+T ++W 
Sbjct: 495 K-----IEKVPNPELEEDFAD-DCTGIFDPNLKYPT---------HLLSCSLDNTIKLWE 539

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA 295
           +     + T    H   VWD A  AD+  +V+   D  +++WDL   + ++ + GH    
Sbjct: 540 VSSGRCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596

Query: 296 ICVALND 302
           +CV + D
Sbjct: 597 VCVGIGD 603

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 104/266 (39%), Gaps = 52/266 (19%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V S+ F   ++ + + S D T+ +WD ++ + ++R   H   V    I+ 
Sbjct: 305 IQLFKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYF 360

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  ++I+   D  +R+W+     C+       D+    LSV S   ++V+ +      VW
Sbjct: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVW 417

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI---------- 236
            +  +T           R H +++  V L        + S D T R+W I          
Sbjct: 418 HVESRT-------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470

Query: 237 ----------------------DDNFQLETTLDNHQRWVWDCA--FSADSAY---LVTAC 269
                                 D+  +     +  + +  DC   F  +  Y   L++  
Sbjct: 471 GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530

Query: 270 SDHYVRLWDLSTREIVRQYGGHHKGA 295
            D+ ++LW++S+   +R   GH +G 
Sbjct: 531 LDNTIKLWEVSSGRCIRTQFGHVEGV 556

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 79/191 (41%), Gaps = 17/191 (8%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIR 61
           S    S+  D T+R W+  T  C +  +    QV ++        L      N+ + +  
Sbjct: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP------LTIKDTENLVVDEKI 496

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKW---MVSSSEDGTIKVWDVRAPS-VQRNYKHQA 117
              PNP    E    + T I F    K+   ++S S D TIK+W+V +   ++  + H  
Sbjct: 497 EKVPNPELE-EDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            V ++    +   ++S   D ++++WDL   +C+         P+  + +    S  V+G
Sbjct: 555 GVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH-KAPIVCVGIGD--SSFVSG 609

Query: 178 NNKGNCYVWQM 188
           +  G   +W  
Sbjct: 610 DELGEVKMWHF 620

>ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL046W
           (MET30)
          Length = 569

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 133/302 (44%), Gaps = 26/302 (8%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 271 LLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTG 329

Query: 64  NPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
               V+++ GH+ +V S+ +F+   K +VS S D T+KVW V + +      H   VN V
Sbjct: 330 AC--VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +HP      S   D  +R+WD+  N CV          +Q +   + GS L+   +  +
Sbjct: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLI--EDPKD 441

Query: 183 CYVWQMPHQTDAANPKPV--TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
             V   P  T  A+   V    F     Y T         HL +CS D+T ++W++    
Sbjct: 442 AVV--PPDATAPAHDPSVQAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGA 490

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            + T    H   VWD A  AD+  +V+   D   ++WDL T + +  + G H    CV +
Sbjct: 491 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547

Query: 301 ND 302
            D
Sbjct: 548 GD 549

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 73/173 (42%), Gaps = 15/173 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V S+  Q  NK +++ S D T+ +WD+     ++R   H   V    +  
Sbjct: 252 IQEFKGHMDGVLSL--QLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVK--ALRF 307

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+     CV       D+    LSV S   ++V+G+      VW
Sbjct: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDS---VLSVDSFRKLIVSGSADKTVKVW 364

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
            +  +T           R H  ++  V L        + S D T R+W I  N
Sbjct: 365 HVESRT-------CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L++  K L T S D T  +W +    +L   L  H   V   A  
Sbjct: 252 IQEFKGHMDGVLSLQLTN--KLLLTGSYDSTVAIWDLATG-KLIRRLSGHTDGVK--ALR 306

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T   V  Y GH    + V
Sbjct: 307 FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV 345

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 122/294 (41%), Gaps = 40/294 (13%)

Query: 38  LEISSDKRFLAAAGHLNVRLYDIRT----------------TNPNPVTSFEGHRGNVTSI 81
           +  S+D +FLA   +   R+Y   T                +N    T+ E     + S+
Sbjct: 404 VRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSV 463

Query: 82  AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNV 140
            F  + K++ + +ED  I++WD+    +    K H+  +  +   P+  +L+S   D  V
Sbjct: 464 CFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTV 523

Query: 141 RIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW---------QMPHQ 191
           RIWDL   QC   L+ ED     S S  ++G  + AG+   +  +W         ++  Q
Sbjct: 524 RIWDLRTGQCSLTLSIEDGVTTVS-SSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQ 582

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID-----DNFQLETTL 246
           TD  N         H   I  V  + D K L + S D + ++W++D      N   E T 
Sbjct: 583 TDLQN--------GHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTF 634

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             H+ +V     S +  Y+++   D  V  WD ++   +    GH    I VA+
Sbjct: 635 IGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 107/263 (40%), Gaps = 17/263 (6%)

Query: 29  QHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQEN 87
           + SD  +  +  S D +FLAA      +R++DI T     V   +GH  ++ S+ +    
Sbjct: 454 ESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQI--VMILKGHEQDIYSLDYFPSG 511

Query: 88  KWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQ-DGNVRIWDLG 146
           + +VS S D T+++WD+R          +  V  V   PN G+ I+    D + RIWD  
Sbjct: 512 EKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTE 571

Query: 147 ENQCVHQLAPEDDT------PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPV 200
               + +L  + D        + S+S   DG  LV+G+   +  +W +    + +N    
Sbjct: 572 TGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCE 631

Query: 201 TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA--- 257
             F  H  ++  V  S + +++ + S D     W  +    L   L  H+  V   A   
Sbjct: 632 VTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPL-LMLQGHKNSVISVAVAN 690

Query: 258 ---FSADSAYLVTACSDHYVRLW 277
                 +     T   D   ++W
Sbjct: 691 GQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 15/154 (9%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D         ++ +F+ AAG L+   R++D  T
Sbjct: 514 LVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFI-AAGSLDRSARIWDTET 572

Query: 63  ----TNPNPVTSFE-GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK--- 114
                  +  T  + GH+ ++ S++F ++ K +VS S D ++K+W++   +   N     
Sbjct: 573 GFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEV 632

Query: 115 ----HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
               H+  V  V    N   ++S  +D  V  WD
Sbjct: 633 TFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWD 666

>YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box
           protein containing five copies of the WD40 motif,
           controls cell cycle function, sulfur metabolism, and
           methionine biosynthesis as part of the ubiquitin ligase
           complex; interacts with and regulates Met4p, localizes
           within the nucleus
          Length = 640

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 120/292 (41%), Gaps = 20/292 (6%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      SC  D  +R+WD+  N C+     H    +   PL       D   L   N
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDVENLATDN 484

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
                     P  TD A+                +   +   HL +C  D+T ++W +  
Sbjct: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKT 541

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
              + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 542 GKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 17/184 (9%)

Query: 109 VQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA 168
           +Q    H   V  + +  N   L +   D  + IWDL   + + +L+   D  +++L   
Sbjct: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDG-VKTLYF- 350

Query: 169 SDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
            D   L+ G+      VW      +    + ++ +R H+  +  V   S  K + + SAD
Sbjct: 351 -DDRKLITGSLDKTIRVW------NYITGECISTYRGHSDSVLSV--DSYQKVIVSGSAD 401

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQ 287
            T +VW ++   +   TL  H  WV +C      ++   +CSD   +R+WD+ T   ++ 
Sbjct: 402 KTVKVWHVES--RTCYTLRGHTEWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV 458

Query: 288 YGGH 291
           + GH
Sbjct: 459 FRGH 462

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 350

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

>Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W
           (REAL)
          Length = 630

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 124/305 (40%), Gaps = 46/305 (15%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 304 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD-DRKLITGSLDRTIRVWNYITG 362

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 363 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 418

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSV--ASDG 171
           +HP      SC  D  +R+WD+  N C          V ++ P      ++L+    SDG
Sbjct: 419 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGHVGQVQKVVPLTIKDTENLATDNTSDG 478

Query: 172 SML------VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATC 225
           S L        G N+      +     D   P P                     HL +C
Sbjct: 479 STLQDDSAMADGVNESETPSDEQEIALDETIPYPT--------------------HLLSC 518

Query: 226 SADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV 285
             D+T ++W +     + T    H   VWD A  AD+  +++   D  +++WDL +   +
Sbjct: 519 GLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGRCM 575

Query: 286 RQYGG 290
             + G
Sbjct: 576 HTFNG 580

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 90/215 (41%), Gaps = 18/215 (8%)

Query: 79  TSIAFQQENKWMVSSSEDGTIKV-WDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQD 137
           T +  Q    W V   E   ++  W      +Q    H   V  + +  N   L +   D
Sbjct: 254 TDVQAQGTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGV--LTLQFNYRLLFTGSYD 311

Query: 138 GNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANP 197
             + IWDL   + + +L+   D  +++L    D   L+ G+      VW      +    
Sbjct: 312 STIGIWDLFTGKLIRRLSGHSDG-VKTLYF--DDRKLITGSLDRTIRVW------NYITG 362

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           + ++ +R H+  +  V   S  K + + SAD T +VW ++   +   TL  H  WV +C 
Sbjct: 363 ECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTLRGHTEWV-NCV 417

Query: 258 FSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291
                ++   +CSD   +R+WD+ T   ++ + GH
Sbjct: 418 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGH 452

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 285 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 340

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 341 -DDRKLITGSLDRTIRVWNYITGECISTYRGHSDSVLSV 378

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 125/275 (45%), Gaps = 30/275 (10%)

Query: 23  VCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI---------------RTTNP 65
           VC  T  +++S++  LE S D R LAAAG  +  ++++ +               RT N 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVR-LAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNE 476

Query: 66  NPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVI 124
             V    GH G V S +F  +N++++S+SED T+++W     +   NYK H   + +V  
Sbjct: 477 TLV----GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAF 532

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCY 184
            P      +   D   R+W       +   A   +  + ++S   +G+ +  G++   C 
Sbjct: 533 SPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDTVSFHPNGTYVFTGSSDKTCR 591

Query: 185 VWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET 244
           +W      D  +   V  F  H   +T   +S D + L+T S D    VW I    +L+ 
Sbjct: 592 MW------DITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQ 645

Query: 245 TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
              + +  V+  ++S +   L++  +DH VR+WD+
Sbjct: 646 MRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T       +  +  +  +  S    + A A H    RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC--D 554

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-PSVQRNYKHQAAVNEV 122
           +  P+  F GH  +V +++F     ++ + S D T ++WD+ +  SV+    H A V   
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTST 614

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS + +G +L++G    +
Sbjct: 615 AVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHS 674

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYIT 211
             VW +   T     +P   F  ++  +T
Sbjct: 675 VRVWDVKKSTAEPGSEPEQPFTGYSGDVT 703

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 206 HAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYL 265
           H+  +     S D ++L + S D T R+WS D    L      H   +WD AFS    Y 
Sbjct: 481 HSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSL-VNYKGHNHPIWDVAFSPLGHYF 539

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALNDV 303
            TA  D   RLW       +R + GH        LNDV
Sbjct: 540 ATASHDQTARLWSCDHIYPLRIFAGH--------LNDV 569

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSIDD--------NFQLE----TTLDNHQRWVWDCA 257
           +T +  S DV+  A    D   ++WS+D         + Q E     TL  H   V+  +
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           FS D+ YL++A  D  VRLW   T   +  Y GH+
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHN 524

>Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W
           (REAL)
          Length = 638

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 121/292 (41%), Gaps = 24/292 (8%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 312 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYFD-DRKLITGSLDKTIRVWNYITG 370

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 371 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 426

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      SC  D  +R+WD+  N C+     H    +   PL       D   L   N
Sbjct: 427 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDAENLATDN 482

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
                     P  ++ AN          A     +   +   HL +C  D+T ++W +  
Sbjct: 483 TSSQ----NEPAMSNDANASETPSSDQEAVLDETIPYPT---HLLSCGLDNTIKLWEVRT 535

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
              + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 536 GKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQG 584

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 77/177 (43%), Gaps = 15/177 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           +  F+GH   V ++ F    + + + S D TI +WD+     ++R   H   V    ++ 
Sbjct: 293 IQEFKGHMDGVLTLQFN--FRLLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVK--TLYF 348

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+    +C+       D+    LSV S   ++V+G+      VW
Sbjct: 349 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDS---VLSVDSYQKVIVSGSADKTVKVW 405

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +  +T           R H +++  V L        +CS D T R+W I  N  L+
Sbjct: 406 HVESRT-------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 455

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L +   D  + IWDL   + + +L+   D  +++L    D   L+ G+      VW    
Sbjct: 313 LFTGSYDSTIGIWDLFTGKLIRRLSGHTDG-VKTLYF--DDRKLITGSLDKTIRVW---- 365

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             +    + ++ +R H+  +  V   S  K + + SAD T +VW ++   +   TL  H 
Sbjct: 366 --NYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTLRGHT 419

Query: 251 RWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291
            WV +C      ++   +CSD   +R+WD+ T   ++ + GH
Sbjct: 420 EWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 460

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 293 IQEFKGHMDGV--LTLQFNFRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHTDGVKTLYF- 348

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 349 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 386

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 13/76 (17%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE----ISSDK-RFLAAAGHLNVRLYD 59
           L S G D+TI+ WE  TG C RT      Q   +E    I++D  R ++ +   +++++D
Sbjct: 519 LLSCGLDNTIKLWEVRTGKCIRT------QFGHVEGVWDIAADNFRIISGSHDGSIKIWD 572

Query: 60  IRTTNPNPVTSFEGHR 75
           +++     + +F+G R
Sbjct: 573 LQSG--KCMHTFQGRR 586

>KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.231
           YIL046W
          Length = 654

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 134/311 (43%), Gaps = 32/311 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
            L +  YD T+  W+  TG   R +      V  L     K  +  +    +R+++  T 
Sbjct: 290 FLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTLFFDGQK-LITGSLDKTIRVWNYMTG 348

Query: 64  NPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
               ++++ GH  +V S+ +F+   K +VS S D T+KVW V + +      H   VN V
Sbjct: 349 EC--ISTYRGHTNSVMSVDSFK---KIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCV 403

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAG 177
            +HP      SC  D  +R+WD+  N C+     H    +   PL  L +    ++++  
Sbjct: 404 KLHPKSFCCFSCSDDTTIRMWDIRTNTCLKVFTGHVGQVQKVIPLTILDIE---NLVMDS 460

Query: 178 NNKGNCYVWQMPHQTDAANPKPV--TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
           N+  +  V  +    +   P  V  ++      Y T         HL +CS D+T ++W 
Sbjct: 461 NSADDETVTGVDESVNEETPPLVVGSQLDGTIPYPT---------HLLSCSLDNTIKLWE 511

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH--- 292
           +     + T    H   VWD A  AD+  +V+   D  +++WDL +   +  + G +   
Sbjct: 512 VKSGKCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDGSIKIWDLQSGRCMHTFHGKNLQK 568

Query: 293 KGAICVALNDV 303
           +G +  +  DV
Sbjct: 569 EGMVASSSGDV 579

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 80/177 (45%), Gaps = 15/177 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           V  F+GH   + S+ F    +++ + S DGT+ +WD+     ++R   HQ  V  +    
Sbjct: 271 VKEFKGHMDGILSMKFN--FRFLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTLFF-- 326

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+    +C+       ++    +SV S   ++V+G+      VW
Sbjct: 327 DGQKLITGSLDKTIRVWNYMTGECISTYRGHTNS---VMSVDSFKKIIVSGSADKTVKVW 383

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +  +T           R H++++  V L        +CS D T R+W I  N  L+
Sbjct: 384 HVESRT-------CYTLRGHSEWVNCVKLHPKSFCCFSCSDDTTIRMWDIRTNTCLK 433

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 123/291 (42%), Gaps = 32/291 (10%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T  
Sbjct: 298 LFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYFD-DQKLITGSLDKTIRVWNYLTGE 356

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124
              ++++ GH  +V S+      K +VS S D T+KVW V + +      H   VN V +
Sbjct: 357 C--ISTYRGHTDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNCVKL 412

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGNN 179
           HP      SC  D  +R+WD+  N C+     H    +   PL  +    D   LV  + 
Sbjct: 413 HPKSFLCFSCSDDTTIRMWDIRTNVCLKVFRGHLGQVQKVVPLTII----DSENLVVDDK 468

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
             +        Q D  N + V     +  Y T         HL +CS D+T ++W I   
Sbjct: 469 AED----DGEEQGDDENAQDV--LTENLPYPT---------HLLSCSLDNTIKLWDIKKG 513

Query: 240 FQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
             + T    H   VWD A  AD+  +V+   D  V++WDL + + +  + G
Sbjct: 514 RCIRTQF-GHVEGVWDLA--ADNFRIVSGSHDGKVKVWDLQSGKCIHTFQG 561

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 105/263 (39%), Gaps = 49/263 (18%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           +  F+GH   V  +A Q   +++ + S D TI +WD+     V+R   H   V    ++ 
Sbjct: 278 IKEFKGHMDGV--LALQFNTRYLFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVK--ALYF 333

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+    +C+       D+    LSV S   ++V+G+      VW
Sbjct: 334 DDQKLITGSLDKTIRVWNYLTGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVW 390

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE--- 243
            +  +T           R H +++  V L        +CS D T R+W I  N  L+   
Sbjct: 391 HVESRT-------CYSLRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNVCLKVFR 443

Query: 244 ------------TTLDNHQRWVWDCA----------------FSADSAY---LVTACSDH 272
                       T +D+    V D A                 + +  Y   L++   D+
Sbjct: 444 GHLGQVQKVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPYPTHLLSCSLDN 503

Query: 273 YVRLWDLSTREIVRQYGGHHKGA 295
            ++LWD+     +R   GH +G 
Sbjct: 504 TIKLWDIKKGRCIRTQFGHVEGV 526

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 50/207 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFL--AAAGHLNVRLYDIR 61
           I+ S   D T++ W   +  C     H++  VN +++   K FL  + +    +R++DIR
Sbjct: 377 IIVSGSADKTVKVWHVESRTCYSLRGHTE-WVNCVKLHP-KSFLCFSCSDDTTIRMWDIR 434

Query: 62  TTNPNPVTSFEGHRGNVTSIA----FQQEN------------------------------ 87
           T     V  F GH G V  +        EN                              
Sbjct: 435 TNVCLKV--FRGHLGQVQKVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPY 492

Query: 88  -KWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
              ++S S D TIK+WD++    ++  + H   V ++    +   ++S   DG V++WDL
Sbjct: 493 PTHLLSCSLDNTIKLWDIKKGRCIRTQFGHVEGVWDLA--ADNFRIVSGSHDGKVKVWDL 550

Query: 146 GENQCVHQLAPEDDTPLQSLSVASDGS 172
              +C+H          +SL   SDG+
Sbjct: 551 QSGKCIHTFQG------KSLEQRSDGT 571

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + ++L T S D T  +W +    +L   L +H   V   A  
Sbjct: 278 IKEFKGHMDGV--LALQFNTRYLFTGSYDSTIAIWDLCTG-RLVRRLSSHTDGVK--ALY 332

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 333 FDDQKLITGSLDKTIRVWNYLTGECISTYRGHTDSVLSV 371

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 75/197 (38%), Gaps = 54/197 (27%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE----------ISSDK------- 44
           S +  S   D TIR W+  T VC +  +    QV ++           +  DK       
Sbjct: 416 SFLCFSCSDDTTIRMWDIRTNVCLKVFRGHLGQVQKVVPLTIIDSENLVVDDKAEDDGEE 475

Query: 45  -------------------RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQ 85
                                L+ +    ++L+DI+      + +  GH   V  +A   
Sbjct: 476 QGDDENAQDVLTENLPYPTHLLSCSLDNTIKLWDIK--KGRCIRTQFGHVEGVWDLA--A 531

Query: 86  ENKWMVSSSEDGTIKVWDVRAPSV----------QRNYKHQAAVNEVV----IHPNQGEL 131
           +N  +VS S DG +KVWD+++             QR+   + AV++V     +     E 
Sbjct: 532 DNFRIVSGSHDGKVKVWDLQSGKCIHTFQGKSLEQRSDGTEPAVHKVAPIACVGIGDSEF 591

Query: 132 ISCDQDGNVRIWDLGEN 148
            S D+ G V+++   E+
Sbjct: 592 FSGDELGYVKMYKFDED 608

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
           A   ++ YL T   D  + +WDL T  +VR+   H  G   +  +D
Sbjct: 290 ALQFNTRYLFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYFDD 335

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 130/299 (43%), Gaps = 24/299 (8%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTTN---------PNP 67
           AL  VC  T  +++  +  LE S D R LAAAG  +  ++L+ +  +          P  
Sbjct: 483 ALPSVCMYTFHNTNRDMTSLEFSDDCR-LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPED 541

Query: 68  VTS--FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVI 124
            TS    GH G V S +F  +N+++VSSSED T+++W +   S   +YK H   V +V  
Sbjct: 542 ATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKF 601

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCY 184
            P      +   D   R+W       +   A   +  +  +S   +G  L  G++   C 
Sbjct: 602 SPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYLFTGSSDKTCR 660

Query: 185 VWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET 244
           +W      D A    V  F      +    +S D + L+T S D    VW I    +L+ 
Sbjct: 661 MW------DIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQ 714

Query: 245 TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALNDV 303
              + +  ++  A+  +   L++  +DH VR+WDL  ++   + G   + A    L DV
Sbjct: 715 MRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL--KKATTESGPEPEQAFVGYLGDV 771

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 4/201 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S+  D T+R W   T     + +  +  V  ++ S    + A A H    RL+     
Sbjct: 566 LVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWSCDHI 625

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WD+      R +    A V   
Sbjct: 626 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVIST 683

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SL+   +G+ L++G    +
Sbjct: 684 CVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHS 743

Query: 183 CYVWQMPHQTDAANPKPVTKF 203
             VW +   T  + P+P   F
Sbjct: 744 VRVWDLKKATTESGPEPEQAF 764

>Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W
           (REAL)
          Length = 639

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 126/295 (42%), Gaps = 27/295 (9%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYFD-DRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPL---QSLSVASDGSMLV 175
           +HP      SC  D  +R+WD+  N C+     H    +   PL    + ++A+D +   
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDAENLATDNTSDG 488

Query: 176 AGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
            G+ +    +   P     A  +          Y T         HL +C  D+T ++W 
Sbjct: 489 GGSLQDGSAMIDEPEA--VAGDQEAAALDESIPYPT---------HLLSCGLDNTIKLWD 537

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
           +     + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 538 VKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFQG 589

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L +   D  + IWDL   + + +L+   D  +++L    D   L+ G+      VW    
Sbjct: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHTDG-VKTLYF--DDRKLITGSLDKTIRVW---- 367

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             +    + ++ +R H+  +  V   S  K + + SAD T +VW ++   +   TL  H 
Sbjct: 368 --NYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTLRGHT 421

Query: 251 RWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291
            WV +C      ++   +CSD   +R+WD+ T   ++ + GH
Sbjct: 422 EWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHTDGVKTLYF- 350

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 124/272 (45%), Gaps = 24/272 (8%)

Query: 23  VCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTS------------ 70
           VC  T  +++S++  LE S D R LA+AG  +  +  I + +  P++S            
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVR-LASAGFQD-SIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 71  --FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPN 127
               GH G V S AF  +N++++S+SED T+++W     +   +YK H   + +V   P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 128 QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187
                +   D   R+W       +   A   +  + ++S   +G+ +  G++   C +W 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDTVSFHPNGTYVFTGSSDKTCRMWD 594

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLD 247
           M      +    V  F  H   +T   +S D + L+T S D    VW I    +L+    
Sbjct: 595 M------STGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 648

Query: 248 NHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           + +  V+  ++S +   LV+  +DH +R+WD+
Sbjct: 649 HGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T     + +  +  +  +  S    + A A H    RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC--D 554

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
           +  P+  F GH  +V +++F     ++ + S D T ++WD+    SV+    H A V   
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTAT 614

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS + +G +LV+G    +
Sbjct: 615 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHS 674

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYIT 211
             VW +   T     +P   F S +  +T
Sbjct: 675 LRVWDVKKSTAEPGSEPEQPFTSFSGDVT 703

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 70/178 (39%), Gaps = 19/178 (10%)

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDT------------PLQSLSVASDGSMLVAGNNKGNC 183
           QD  V+IW L       +L  + D              + S + + D   L++ +     
Sbjct: 447 QDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTV 506

Query: 184 YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +W     T       +  ++ H   I  V  S    + AT S D TAR+WS D  + L 
Sbjct: 507 RLWSTDTYTS------LVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLR 560

Query: 244 TTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
                H   V   +F  +  Y+ T  SD   R+WD+ST + VR + GH       A++
Sbjct: 561 I-FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVS 617

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 42/98 (42%), Gaps = 9/98 (9%)

Query: 206 HAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYL 265
           H+  +     S D ++L + S D T R+WS D    L  +   H   +WD AFS    Y 
Sbjct: 481 HSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSL-VSYKGHNHPIWDVAFSPLGHYF 539

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALNDV 303
            TA  D   RLW       +R + GH        LNDV
Sbjct: 540 ATASHDQTARLWSCDHIYPLRIFAGH--------LNDV 569

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 12/95 (12%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSID------------DNFQLETTLDNHQRWVWDCA 257
           +T +  S DV+  +    D   ++WS+D            D      TL  H   V+  A
Sbjct: 430 MTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYSTA 489

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           FS D+ YL++A  D  VRLW   T   +  Y GH+
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHN 524

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 128/310 (41%), Gaps = 41/310 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           L +  YD T+  W+  +G   R +      V  +    D++ +  +    +R+++ +T  
Sbjct: 345 LFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYFD-DQKLITGSLDKTIRVWNYQTGA 403

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124
              ++++ GH  +V S+      K +VS S D T+KVW V + +      H   VN V +
Sbjct: 404 C--ISTYRGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCVKL 459

Query: 125 HPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSV--ASDGS 172
           HP      S   D  +R+WD+  N C          V ++ P     +++L V    +  
Sbjct: 460 HPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGHVGQVQKVIPLKIVDVENLVVDKQEEAQ 519

Query: 173 MLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTAR 232
            L+   N G   V  +    D   P P                     H+ +CS D+T +
Sbjct: 520 ELIPEPN-GEGAVDDVTGTMDPNLPYPT--------------------HILSCSLDNTIK 558

Query: 233 VWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           +W +     + T    H   VWD A  AD+  +++   D  V++WDL + + +  + GH 
Sbjct: 559 LWEVRSGKCVRTHF-GHVEGVWDIA--ADNFRVISGAHDRTVKIWDLQSGKCMHTFTGHQ 615

Query: 293 KGAICVALND 302
               CV + D
Sbjct: 616 APIACVDIGD 625

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           +  F+GH   V S+ F   ++++ + S D T+ +WD+     ++R   H   V  V    
Sbjct: 325 IQEFKGHMDGVLSLQFN--HRYLFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF-- 380

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+     C+       D+    LSV S   ++V+G+      VW
Sbjct: 381 DDQKLITGSLDKTIRVWNYQTGACISTYRGHSDS---VLSVDSYKKIIVSGSADKTVKVW 437

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
            +  +T           R H++++  V L        + S D T R+W I  N
Sbjct: 438 HVESRT-------CYTLRGHSEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRSN 483

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 13/165 (7%)

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           N   L +   D  V IWDL   + + +L    D      SV  D   L+ G+      VW
Sbjct: 341 NHRYLFTGSYDSTVAIWDLCSGKLIRRLTGHHDG---VKSVYFDDQKLITGSLDKTIRVW 397

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
              +QT A     ++ +R H+  +  V   S  K + + SAD T +VW ++   +   TL
Sbjct: 398 N--YQTGAC----ISTYRGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVES--RTCYTL 447

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
             H  WV        S    +   D  +R+WD+ +   ++ + GH
Sbjct: 448 RGHSEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGH 492

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 92/228 (40%), Gaps = 52/228 (22%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH--LNVRLYDIR 61
           I+ S   D T++ W   +  C     HS+  VN +++   K F   +G     +R++DIR
Sbjct: 424 IIVSGSADKTVKVWHVESRTCYTLRGHSE-WVNCVKLHP-KSFTCFSGSDDTTIRMWDIR 481

Query: 62  TTNPNPVTSFEGHRGNVTSIA-------------FQQENKWMV----------------- 91
           +     +  F+GH G V  +               Q+E + ++                 
Sbjct: 482 SNTC--IKVFKGHVGQVQKVIPLKIVDVENLVVDKQEEAQELIPEPNGEGAVDDVTGTMD 539

Query: 92  ----------SSSEDGTIKVWDVRA-PSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNV 140
                     S S D TIK+W+VR+   V+ ++ H   V ++    +   +IS   D  V
Sbjct: 540 PNLPYPTHILSCSLDNTIKLWEVRSGKCVRTHFGHVEGVWDIA--ADNFRVISGAHDRTV 597

Query: 141 RIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188
           +IWDL   +C+H        P+  + +    S  V+G+  G   +++ 
Sbjct: 598 KIWDLQSGKCMHTFTGH-QAPIACVDIGD--SEFVSGDELGCVKLYRF 642

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 264 YLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
           YL T   D  V +WDL + +++R+  GHH G   V  +D
Sbjct: 344 YLFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYFDD 382

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + ++L T S D T  +W +    +L   L  H   V    F 
Sbjct: 325 IQEFKGHMDGV--LSLQFNHRYLFTGSYDSTVAIWDLCSG-KLIRRLTGHHDGVKSVYF- 380

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T   +  Y GH    + V
Sbjct: 381 -DDQKLITGSLDKTIRVWNYQTGACISTYRGHSDSVLSV 418

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 107/232 (46%), Gaps = 15/232 (6%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + SI F  + +++ + +ED  I++W+++   +    K H+  +  +   P+  +L+S   
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D ++RIWDL   QC   L+ ED     ++S  ++G ++ AG+   +  +W      +  +
Sbjct: 404 DRSIRIWDLKTGQCSLTLSIEDGVTTVAVS-PNEGKLIAAGSLDRSVRIWDSSTGFLVER 462

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN----FQLETTLD 247
            D+ N         H   +  V  + D +H+ + S D T ++W++ D      + E T  
Sbjct: 463 LDSDN----ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYI 518

Query: 248 NHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
            H+ +V   A S D  Y+ +   D  V +WD  +   +    GH    I VA
Sbjct: 519 GHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVA 570

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI-- 60
           L S   D +IR W+  TG CS T+   D  V  + +S ++  L AAG L+  VR++D   
Sbjct: 398 LVSGSGDRSIRIWDLKTGQCSLTLSIEDG-VTTVAVSPNEGKLIAAGSLDRSVRIWDSST 456

Query: 61  -----RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104
                R  + N   S  GH+ +V S+AF ++ + +VS S D T+K+W++
Sbjct: 457 GFLVERLDSDN--ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+W++  R+IV    GH +
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQ 384

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 128/281 (45%), Gaps = 28/281 (9%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTT---NPNPVTSFE- 72
           AL  VC  T Q+++  ++ L+ S D R +AAAG  +  ++++ +  +   NPN V + E 
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCR-VAAAGFQDSYIKIWSLDGSSLNNPNIVLNNET 511

Query: 73  -------------GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAA 118
                        GH G V S +F  +NK+++S SED T+++W +   +   +YK H   
Sbjct: 512 NYKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP 571

Query: 119 VNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN 178
           V +V   P      +   D   R+W       +   A   +  +  +S   +G  L  G+
Sbjct: 572 VWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYLFTGS 630

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
           +   C +W +      +    V  F  H   +  + +S D + L+T S D    VW I  
Sbjct: 631 SDKTCRMWNV------STGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
             +L+    + +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 97/219 (44%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  +  S    + A A H    RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++W+V    SV+    H A V  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISI 659

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS + +G++L++G    +
Sbjct: 660 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T   + +P   F  +   +T   ++ D+K 
Sbjct: 720 VRVWDLKKATTEPSAEPDEPFIGYLGDVT-ASINQDIKE 757

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           S S + D   L++G+      +W M   T       +  ++ H   +  V  S    + A
Sbjct: 532 STSFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           T S D TAR+WS D  + L      H   V   +F  +  YL T  SD   R+W++ST +
Sbjct: 586 TASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGD 644

Query: 284 IVRQYGGHHKGAICVAL 300
            VR + GH    I +A+
Sbjct: 645 SVRLFLGHTAPVISIAV 661

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 206 HAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYL 265
           H+  +     S D K+L + S D T R+WS+D +  L  +   H   VWD  FS    Y 
Sbjct: 526 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL-VSYKGHNHPVWDVNFSPLGHYF 584

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            TA  D   RLW       +R + GH     CV+ 
Sbjct: 585 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 619

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 18/108 (16%)

Query: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSID------------------DNFQLET 244
           F++  K ++ +  S D +  A    D   ++WS+D                  D+     
Sbjct: 462 FQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCK 521

Query: 245 TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           TL  H   V+  +FS D+ YL++   D  VRLW + T   +  Y GH+
Sbjct: 522 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

>KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 658

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 123/304 (40%), Gaps = 28/304 (9%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 360 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYFD-DQKLITGSLDRTIRVWNYVTG 418

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               V+++ GH  +V S+      K +VS S D T+K+W V + +      H   V  V 
Sbjct: 419 AC--VSTYRGHSDSVLSV--DSYKKIIVSGSADKTVKMWHVESRTCYTLRGHSEWVGCVK 474

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      S   D  +R+WD+  N C+     H    +   PL  L    D   LV   
Sbjct: 475 LHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGHVGQVQKVLPLNIL----DTENLVTD- 529

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
                     P      N +P     S  +            HL +CS D+T ++W +  
Sbjct: 530 ----------PASEAQRNDEPAANDPSEGQLAPLDDSLPYPSHLLSCSLDNTIKLWDVRT 579

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
              + T    H   +WD A  AD+  +++   D  V++WDL + + +  +  HH    CV
Sbjct: 580 GKCVRTHF-GHLEGIWDIA--ADNFRIISGAHDKTVKVWDLQSGKCIHTFDSHHAPITCV 636

Query: 299 ALND 302
            + D
Sbjct: 637 GIGD 640

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 106/266 (39%), Gaps = 53/266 (19%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V ++ F    + + + S D T+ +WD+     V+R   H+  V    ++ 
Sbjct: 341 IQDFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--TLYF 396

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+     CV       D+    LSV S   ++V+G+      +W
Sbjct: 397 DDQKLITGSLDRTIRVWNYVTGACVSTYRGHSDS---VLSVDSYKKIIVSGSADKTVKMW 453

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET-- 244
            +  +T           R H++++  V L        + S D T R+W I  N  L+   
Sbjct: 454 HVESRT-------CYTLRGHSEWVGCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFR 506

Query: 245 ------------TLDNHQRWVWDCAFSAD------------------------SAYLVTA 268
                        + + +  V D A  A                          ++L++ 
Sbjct: 507 GHVGQVQKVLPLNILDTENLVTDPASEAQRNDEPAANDPSEGQLAPLDDSLPYPSHLLSC 566

Query: 269 CSDHYVRLWDLSTREIVRQYGGHHKG 294
             D+ ++LWD+ T + VR + GH +G
Sbjct: 567 SLDNTIKLWDVRTGKCVRTHFGHLEG 592

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDK-RFLAAAGHLNVRLYDIRTT 63
           L S   D+TI+ W+  TG C RT  H        +I++D  R ++ A    V+++D+++ 
Sbjct: 563 LLSCSLDNTIKLWDVRTGKCVRT--HFGHLEGIWDIAADNFRIISGAHDKTVKVWDLQSG 620

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKV 101
               + +F+ H   +T +         VS  E G +K+
Sbjct: 621 --KCIHTFDSHHAPITCVGIGDSE--FVSGDELGCVKL 654

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY- 113
           ++L+D+RT     V +  GH   +  IA   +N  ++S + D T+KVWD+++      + 
Sbjct: 572 IKLWDVRTGKC--VRTHFGHLEGIWDIA--ADNFRIISGAHDKTVKVWDLQSGKCIHTFD 627

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRI 142
            H A +  V I     E +S D+ G V++
Sbjct: 628 SHHAPITCVGI--GDSEFVSGDELGCVKL 654

>TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.231
           YIL046W
          Length = 584

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 127/294 (43%), Gaps = 32/294 (10%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIR 61
           S +L +  YD T+  W+  +G   R +      V  L    +++ +  +    +R+++  
Sbjct: 270 SRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVKALHFD-EQKLVTGSLDKTIRVWNYI 328

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNE 121
           T     ++++ GH  +V S+      K +VS S D T+KVW V + +      H   VN 
Sbjct: 329 TGEC--ISTYRGHTDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNC 384

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVA 176
           V +HP      SC  D  +R+WD+  N C+     H    +   PL  + + +    LV 
Sbjct: 385 VKLHPKSFLCFSCSDDTTIRMWDIRTNACLRVFRGHVGQVQKVIPLTIVDIDN----LVV 440

Query: 177 GNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
            + + N    +   + D    + V K      Y T         HL +CS D+T ++W I
Sbjct: 441 DDRQIN----RSTQEEDTEEDQDVLK--EDLPYPT---------HLLSCSLDNTIKMWDI 485

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
                + T    H   VWD A  AD+  +V+   D  V+LWDL + + +  + G
Sbjct: 486 RTGKCVRTQF-GHVEGVWDIA--ADNFRIVSGSHDGKVKLWDLQSGKCIHTFQG 536

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 106/263 (40%), Gaps = 49/263 (18%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           +  F+GH   V ++ F   ++ + + S D T+ +WD+     ++R  +H   V    +H 
Sbjct: 253 IQEFKGHMDGVLTLQF--SSRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVK--ALHF 308

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           ++ +L++   D  +R+W+    +C+       D+    LSV S   ++V+G+      VW
Sbjct: 309 DEQKLVTGSLDKTIRVWNYITGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVW 365

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE--- 243
            +  +T           R H +++  V L        +CS D T R+W I  N  L    
Sbjct: 366 HVESRT-------CYSLRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNACLRVFR 418

Query: 244 ------------TTLDNHQRWVWDCAFSADS-------------------AYLVTACSDH 272
                       T +D     V D   +  +                    +L++   D+
Sbjct: 419 GHVGQVQKVIPLTIVDIDNLVVDDRQINRSTQEEDTEEDQDVLKEDLPYPTHLLSCSLDN 478

Query: 273 YVRLWDLSTREIVRQYGGHHKGA 295
            +++WD+ T + VR   GH +G 
Sbjct: 479 TIKMWDIRTGKCVRTQFGHVEGV 501

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  +  SS  + L T S D T  +W +    +L   L  H   V   A  
Sbjct: 253 IQEFKGHMDGVLTLQFSS--RLLFTGSYDSTVAIWDLCSG-RLIRRLSRHGDGVK--ALH 307

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   LVT   D  +R+W+  T E +  Y GH    + V
Sbjct: 308 FDEQKLVTGSLDKTIRVWNYITGECISTYRGHTDSVLSV 346

>Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii ADL082C
          Length = 583

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 134/312 (42%), Gaps = 44/312 (14%)

Query: 4   ILASAGYDHTIRFWEALTG-VCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIR 61
           +L +  YD T+  W+  +G +  R   H+D  +  R +   D++ +  +    +R+++  
Sbjct: 282 LLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFD---DQKLITGSLDKTIRVWNYV 338

Query: 62  TTNPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           T     V+++ GH+ +V S+ +F+   K +VS S D T+KVW V + +      H   +N
Sbjct: 339 TGKC--VSTYRGHQDSVLSVDSFR---KIIVSGSADKTVKVWHVESRTCYTLRGHTKWIN 393

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSVASD 170
            V +HP      S   D  +R+WD+  N C          V ++ P +      +  A D
Sbjct: 394 CVKLHPKSFTCFSGSDDTTIRMWDIRTNTCIKIFRGHVGQVQKVIPLNLVDENLVQDAED 453

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
            +++    N         P   D + P P                     +L +CS D+T
Sbjct: 454 ATVISDVENTDVEDPTVNPENWDDSLPYP--------------------NYLLSCSLDNT 493

Query: 231 ARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
            ++W +  +  + T    H   VWD A  AD+  +V+   D   ++WDL T + +  + G
Sbjct: 494 IKLWDVKTSKCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRTCKVWDLQTGKCMHTFTG 550

Query: 291 HHKGAICVALND 302
           +     CV + D
Sbjct: 551 NQAPIACVGIGD 562

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 99/266 (37%), Gaps = 51/266 (19%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127
           V  F GH   V S+ F   +  + + S D T+ +WD+ +  + R         + V   +
Sbjct: 263 VQEFMGHMDGVLSLQFT--HSLLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFDD 320

Query: 128 QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187
           Q +LI+   D  +R+W+    +CV       D+    LSV S   ++V+G+      VW 
Sbjct: 321 Q-KLITGSLDKTIRVWNYVTGKCVSTYRGHQDS---VLSVDSFRKIIVSGSADKTVKVWH 376

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN-------- 239
           +  +T           R H K+I  V L        + S D T R+W I  N        
Sbjct: 377 VESRT-------CYTLRGHTKWINCVKLHPKSFTCFSGSDDTTIRMWDIRTNTCIKIFRG 429

Query: 240 --------FQLETTLDNHQRWVWDCAFSADSA----------------------YLVTAC 269
                     L    +N  +   D    +D                        YL++  
Sbjct: 430 HVGQVQKVIPLNLVDENLVQDAEDATVISDVENTDVEDPTVNPENWDDSLPYPNYLLSCS 489

Query: 270 SDHYVRLWDLSTREIVRQYGGHHKGA 295
            D+ ++LWD+ T + +R   GH +G 
Sbjct: 490 LDNTIKLWDVKTSKCIRTQFGHVEGV 515

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 86/220 (39%), Gaps = 51/220 (23%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH--LNVRLYDIR 61
           I+ S   D T++ W   +  C  T++     +N +++   K F   +G     +R++DIR
Sbjct: 362 IIVSGSADKTVKVWHVESRTCY-TLRGHTKWINCVKLHP-KSFTCFSGSDDTTIRMWDIR 419

Query: 62  TTNPNPVTSFEGHRGNVTSI-------------------------------AFQQEN--- 87
           T     +  F GH G V  +                                   EN   
Sbjct: 420 TNTC--IKIFRGHVGQVQKVIPLNLVDENLVQDAEDATVISDVENTDVEDPTVNPENWDD 477

Query: 88  -----KWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVR 141
                 +++S S D TIK+WDV+ +  ++  + H   V +  I  +   ++S   D   +
Sbjct: 478 SLPYPNYLLSCSLDNTIKLWDVKTSKCIRTQFGHVEGVWD--IAADNFRIVSGSHDRTCK 535

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           +WDL   +C+H     +  P+  + +    S  V+G+  G
Sbjct: 536 VWDLQTGKCMHTFTG-NQAPIACVGIGD--SEFVSGDELG 572

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 123/284 (43%), Gaps = 35/284 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI---------------- 60
           AL  VC  T  +++  +  LE S D R LAAAG  +  ++++ +                
Sbjct: 460 ALPSVCMYTFHNTNRDMTSLEFSDDCR-LAAAGFQDSYIKIWSLDGSSLINPKYSSSQFD 518

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAV 119
           R +  N  ++  GH G V S +F  +N ++VS SED T+K+W +   +   NYK H   V
Sbjct: 519 RFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPV 578

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVH----QLAPEDDTPLQSLSVASDGSMLV 175
            +V   P      S   D   R+W      C H    ++       + ++S   +G  + 
Sbjct: 579 WDVKFSPLGHYFASASHDQTARLW-----ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVF 633

Query: 176 AGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
            G++   C +W      D +    V  F  H   +    +S D + LAT S D    +W 
Sbjct: 634 TGSSDKTCRMW------DVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWD 687

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           I    +++    + +  V   +F+ +   L++  +DH VR+WD+
Sbjct: 688 IGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 101/220 (45%), Gaps = 5/220 (2%)

Query: 3   VILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIR 61
           + L S   D T++ W   T       +  +  V  ++ S    + A+A H    RL+   
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW--A 603

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVN 120
             +  P+  F GH  +V +++F     ++ + S D T ++WDV    SV+    H A V 
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVL 663

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
              + P+   L +  +DG + +WD+G  + + Q+       + SLS   +G++L++G   
Sbjct: 664 STQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGAD 723

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVK 220
            +  VW + H T    P+P   F +H   IT   ++ D+K
Sbjct: 724 HSVRVWDVKHGTTEQGPEPEQPFNAHVGDIT-ASINQDIK 762

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 17/107 (15%)

Query: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSID--------------DNFQLE---TT 245
           F +  + +T +  S D +  A    D   ++WS+D              D F  +   +T
Sbjct: 469 FHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCST 528

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           L  H   V+  +FS D+ YLV+   D  V+LW + T   +  Y GH+
Sbjct: 529 LVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHN 575

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 121/278 (43%), Gaps = 28/278 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTTNPNPV-------- 68
           A   VC  T  +++  +  LE S D   LAAAG  +  ++L+ +  T   P+        
Sbjct: 408 AAPSVCMYTFHNTNRDMTCLEFSDDAT-LAAAGFQDSYIKLWSLDGT---PLDSKLPSKQ 463

Query: 69  ------TSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNE 121
                 T+  GH G V S +F  +NK+++S+SED T+++W +   S   +YK H   V +
Sbjct: 464 REKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWD 523

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           V   P      +   D   R+W       +   A   +  +  +S   +G+ +  G+   
Sbjct: 524 VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGTYVFTGSTDK 582

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQ 241
            C +W      D      V  F  H   +    +S D + L+T S D    VW I    +
Sbjct: 583 TCRMW------DIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 636

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           L+    + +  V+  ++S +   LV+  +DH VR+WDL
Sbjct: 637 LKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 91/204 (44%), Gaps = 4/204 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T     + +  +  V  +  S    + A A H    RL+     
Sbjct: 491 LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 550

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WD+    SV+    H A V   
Sbjct: 551 YP--LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIST 608

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS + +G++LV+G    +
Sbjct: 609 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHS 668

Query: 183 CYVWQMPHQTDAANPKPVTKFRSH 206
             VW +   T   N +P   F S+
Sbjct: 669 VRVWDLKRSTAEPNTEPEQPFTSY 692

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 91/241 (37%), Gaps = 22/241 (9%)

Query: 70  SFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW-------DVRAPSVQRN-------YKH 115
           +F     ++T + F  +     +  +D  IK+W       D + PS QR          H
Sbjct: 416 TFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGH 475

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLV 175
              V      P+   L+S  +D  VR+W +     +      +  P+  +S +  G    
Sbjct: 476 SGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNH-PVWDVSFSPLGHYFA 534

Query: 176 AGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
             ++     +W   H        P+  F  H   +  V    +  ++ T S D T R+W 
Sbjct: 535 TASHDQTARLWSCDHI------YPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWD 588

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA 295
           I     +   L  H   V   A S D  +L T   D  + +WD+ T + ++Q  GH K A
Sbjct: 589 IGTGDSVRLFL-GHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNA 647

Query: 296 I 296
           +
Sbjct: 648 V 648

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 201 TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA 260
           T    H+  +     S D K+L + S D T R+WS+D    L  +   H   VWD +FS 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSL-VSYKGHNHPVWDVSFSP 528

Query: 261 DSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              Y  TA  D   RLW       +R + GH     CV+ 
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 568

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 75/179 (41%), Gaps = 21/179 (11%)

Query: 136 QDGNVRIWDLGENQCVHQLAPE-----DDTPL-------QSLSVASDGSMLVAGNNKGNC 183
           QD  +++W L       +L  +     ++T L        S S + D   L++ +     
Sbjct: 441 QDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTV 500

Query: 184 YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +W M   +       +  ++ H   +  V  S    + AT S D TAR+WS D  + L 
Sbjct: 501 RLWSMDTYSS------LVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLR 554

Query: 244 TTLDNHQRWVWDC-AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
                H   V DC +F  +  Y+ T  +D   R+WD+ T + VR + GH    I  A++
Sbjct: 555 I-FAGHLNDV-DCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVS 611

>CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar to
           uniprot|P39014 Saccharomyces cerevisiae YIL046w MET30
          Length = 673

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 125/309 (40%), Gaps = 56/309 (18%)

Query: 4   ILASAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L +  YD T+  W+  TG +  R   HSD  V  L    D++ +  +    +R+++  T
Sbjct: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYFD-DQKLITGSLDKTIRVWNYIT 403

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
                ++++ GH  +V S+      K +VS S D T+KVW V + +      H   VN V
Sbjct: 404 GEC--ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCV---------------------HQLAPEDDTP 161
            +HP      SC  D  +R+WD+  N C+                       L   +  P
Sbjct: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
            +   +AS+G+      N  N        + D   P P                     H
Sbjct: 520 GEEDDIASNGTGEDDPENGVN-----GQRELDKKMPYPT--------------------H 554

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
           L +C+ D+T ++W +     + T    H   VWD A  AD+  +++   D  +++WDL +
Sbjct: 555 LLSCALDNTIKLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQS 611

Query: 282 REIVRQYGG 290
            + +  + G
Sbjct: 612 GKCMHTFHG 620

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 94/224 (41%), Gaps = 24/224 (10%)

Query: 76  GNVTSIAFQQEN------KWMVSSSEDGTIKV-WDVRAPSVQRNYKHQAAVNEVVIHPNQ 128
           G+ +S   QQEN       W +   E   ++  W     ++Q    H   V  + +  N 
Sbjct: 287 GSKSSGQGQQENGRCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGV--LTLQFNY 344

Query: 129 GELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188
             L +   D  V IWDL   + + +L    D  +++L    D   L+ G+      VW  
Sbjct: 345 RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYF--DDQKLITGSLDKTIRVW-- 399

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
               +    + ++ +R H   +  V   S  K + + SAD T +VW ++   +   TL  
Sbjct: 400 ----NYITGECISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTLKG 451

Query: 249 HQRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291
           H  WV +C      ++   +CSD   +R+WD+ T   +R + GH
Sbjct: 452 HTEWV-NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 327 IQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTLYF- 382

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 383 -DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (43%), Gaps = 9/219 (4%)

Query: 74  HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELIS 133
           H G +  + +  +   ++S   D  +K+WD+ + S +    H   V+ V +HP+     S
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAAS 273

Query: 134 CDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTD 193
              D    +WDL E +   QL       + +++  SDG++L +      C +W      D
Sbjct: 274 ASFDLTWILWDL-ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIW------D 326

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
             + +P+ K   HA  I+ V  S +   LAT  AD T RVW I  N   E+ L  HQ   
Sbjct: 327 LRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI-RNVGTESALLAHQVAA 385

Query: 254 WDCAFSADSAYLVTACS-DHYVRLWDLSTREIVRQYGGH 291
            D  F  ++   + +C  D  V +++    + +    GH
Sbjct: 386 LDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGH 424

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 83/186 (44%), Gaps = 6/186 (3%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRT 62
           + ASA +D T   W+    V  +  +     V  +   SD   LA+AG   V  ++D+R+
Sbjct: 270 LAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRS 329

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-YKHQAAVNE 121
             P  +   EGH G ++ + +      + ++  DGT++VWD+R    +     HQ A  +
Sbjct: 330 GEP--IMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALD 387

Query: 122 VVIHPNQGE-LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           V    N G  L+SC  D  V I++    Q +  L    D    ++ +  DGS + +G   
Sbjct: 388 VKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVF-TVDITEDGSTIYSGGKD 446

Query: 181 GNCYVW 186
            +   W
Sbjct: 447 RSLKQW 452

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 89/234 (38%), Gaps = 13/234 (5%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV- 104
            L+  G   V+L+D+ +   N      GH G V+ +      +   S+S D T  +WD+ 
Sbjct: 230 LLSGGGDNLVKLWDMTS---NSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLE 286

Query: 105 RAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQS 164
           R   +Q    H  AV  +    +   L S   D    IWDL   + + +L       +  
Sbjct: 287 RKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH-AGAISG 345

Query: 165 LSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV-LLSSDVKHLA 223
           +  + +G  L      G   VW      D  N    +   +H      V    ++   L 
Sbjct: 346 VDWSPNGYQLATAGADGTVRVW------DIRNVGTESALLAHQVAALDVKFKKNNGTFLV 399

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           +C  D    +++  DN+Q   +L+ H   V+    + D + + +   D  ++ W
Sbjct: 400 SCGHDRLVNIFNA-DNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 135/334 (40%), Gaps = 54/334 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +  S D   +A     N VRL++ +T 
Sbjct: 156 MVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTG 215

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
            P    +  GH   +TS++++        E   + +SS+DGTIK+WD             
Sbjct: 216 KPFG-DALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGH 274

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVH--------------------QLA 155
            +    V    Q  L S   D  VR+WD+    +C++                    ++ 
Sbjct: 275 TSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVG 334

Query: 156 PEDDTPLQSLSV------------------ASDGSMLVAGNNKGNCYVWQMPHQTDAANP 197
           P D T  Q  +                     +  ++V  ++    ++W  P +T     
Sbjct: 335 PFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWD-PLRTT---- 389

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           KP+ +   H K +  V  S D +H+ + S D++ ++W   D  +  TT   H   V+  A
Sbjct: 390 KPIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDG-KFITTFRGHVASVYQVA 448

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+   D  +++WD+ TR++     GH
Sbjct: 449 WSSDCRLLVSCSKDTTLKVWDIRTRKLSVDLPGH 482

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 133/325 (40%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWE---------ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN 54
           ++A+   D+T+R WE         AL G        S   ++ +      R   ++    
Sbjct: 197 LIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGT 256

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV----RAPSVQ 110
           ++++D  TT      +  GH  +V+ + +  +N ++ S S D T++VWD+    R  ++ 
Sbjct: 257 IKIWD--TTRRVCTMTLSGHTSSVSCVKWGGQN-FLYSGSHDKTVRVWDMKNSGRCINIL 313

Query: 111 RNYKH-----------------------QAAVNEV-----------VIHPNQGE---LIS 133
           +N+ H                       Q A  E+           V   N  E   +++
Sbjct: 314 KNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVT 373

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +WD L   + + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 374 ASDDFTMFLWDPLRTTKPIARMTGHQKL-VNHVAFSPDGRHIVSASFDNSIKLW------ 426

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D+ + K +T FR H   + +V  SSD + L +CS D T +VW I    +L   L  H+  
Sbjct: 427 DSRDGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDIRTR-KLSVDLPGHKDE 485

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  VR+W
Sbjct: 486 VYTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 50/134 (37%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+     H  ++  V  S D + +AT S D+T 
Sbjct: 154 SRMVTGAGDNTARIWDCDTQT------PMATLTGHHNWVLCVSWSPDGELIATGSMDNTV 207

Query: 232 RVWSIDDNFQLETTLDNHQRWV----WD---CAFSADSAYLVTACSDHYVRLWDLSTREI 284
           R+W           L  H +W+    W+        +   L T+  D  +++WD + R  
Sbjct: 208 RLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVC 267

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 268 TMTLSGHTSSVSCV 281

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD  T+  +    GHH   +CV+
Sbjct: 153 SSRMVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVS 190

>KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.231
           YIL046W
          Length = 591

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 124/297 (41%), Gaps = 44/297 (14%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           L +  YD T+  W+    +  R +      V  L    DK+ +  +    +++++  T  
Sbjct: 265 LFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFD-DKKLITGSLDKTIKIWNYVTGQ 323

Query: 65  PNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
              ++++ GH  +V S+ AF+   K +VS S D T+KVW + + +      H   VN V 
Sbjct: 324 C--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKVWHIESRTCYTLKGHTEWVNCVK 378

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSVASDGSM 173
           +HP      SC  D  +R+WD+  N C          V ++ P     +++L        
Sbjct: 379 LHPKSFTCFSCSDDTTIRMWDIRTNTCIKVFKGHVGQVQKVIPLTIIDIENLVSDISNDE 438

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
               NN+ +    ++    D + P P                     HL +CS D+T ++
Sbjct: 439 DSDENNEDD----ELNQPLDDSIPYPT--------------------HLLSCSLDNTIKL 474

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
           W++     + T    H   VWD A  AD+  +++   D  +++WDL   + +  + G
Sbjct: 475 WNVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGCLKVWDLQNGQCLHTFQG 528

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 107/263 (40%), Gaps = 49/263 (18%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126
           +  F+GH   V S+ F    K++ + S D T+ +WD+     ++R   H   V    ++ 
Sbjct: 245 IIDFKGHLDGVLSLQFNY--KYLFTGSYDSTVAIWDLYNNILIRRLNGHTDGVK--ALYF 300

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  ++IW+    QC+       D+    +SV +   ++V+G+      VW
Sbjct: 301 DDKKLITGSLDKTIKIWNYVTGQCISTYRGHTDS---VMSVDAFKKIIVSGSADKTVKVW 357

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET-- 244
            +  +T           + H +++  V L        +CS D T R+W I  N  ++   
Sbjct: 358 HIESRT-------CYTLKGHTEWVNCVKLHPKSFTCFSCSDDTTIRMWDIRTNTCIKVFK 410

Query: 245 ------------TLDNHQRWVWDCAFSADS--------------------AYLVTACSDH 272
                       T+ + +  V D +   DS                     +L++   D+
Sbjct: 411 GHVGQVQKVIPLTIIDIENLVSDISNDEDSDENNEDDELNQPLDDSIPYPTHLLSCSLDN 470

Query: 273 YVRLWDLSTREIVRQYGGHHKGA 295
            ++LW++ T + +R   GH +G 
Sbjct: 471 TIKLWNVKTGKCIRTQFGHVEGV 493

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 76/189 (40%), Gaps = 44/189 (23%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRF--LAAAGHLNVRLYDIR 61
           I+ S   D T++ W   +  C     H++  VN +++   K F   + +    +R++DIR
Sbjct: 344 IIVSGSADKTVKVWHIESRTCYTLKGHTE-WVNCVKLHP-KSFTCFSCSDDTTIRMWDIR 401

Query: 62  TTNPNPVTSFEGHRGNVTSIA----FQQEN------------------------------ 87
           T     +  F+GH G V  +        EN                              
Sbjct: 402 TNTC--IKVFKGHVGQVQKVIPLTIIDIENLVSDISNDEDSDENNEDDELNQPLDDSIPY 459

Query: 88  -KWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
              ++S S D TIK+W+V+    ++  + H   V ++    +   +IS   DG +++WDL
Sbjct: 460 PTHLLSCSLDNTIKLWNVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGCLKVWDL 517

Query: 146 GENQCVHQL 154
              QC+H  
Sbjct: 518 QNGQCLHTF 526

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           +  F+ H   +  + L  + K+L T S D T  +W + +N  L   L+ H   V   A  
Sbjct: 245 IIDFKGHLDGV--LSLQFNYKYLFTGSYDSTVAIWDLYNNI-LIRRLNGHTDGVK--ALY 299

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T   D  +++W+  T + +  Y GH    + V
Sbjct: 300 FDDKKLITGSLDKTIKIWNYVTGQCISTYRGHTDSVMSV 338

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 263 AYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
            YL T   D  V +WDL    ++R+  GH  G   +  +D
Sbjct: 263 KYLFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFDD 302

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 127/290 (43%), Gaps = 40/290 (13%)

Query: 5   LASAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           LA+AG+ D  I+ W +L G         +S+  +++ S  +  L A   L+ ++ +   +
Sbjct: 489 LAAAGFKDSYIKVW-SLDGTTL------ESKATKIQPSKSQAALRAG--LDNKINEKTRS 539

Query: 64  NPNPVTSFE--GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVN 120
              P+T+ +  GH G + S +F  +NK +VS+SED TI++W +   +    YK H   V 
Sbjct: 540 QETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVW 599

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS----------VASD 170
           +V   P      +   D   R+W      C H        PL+  S             +
Sbjct: 600 DVQFSPVGHYFATASHDQTARLW-----SCDHIF------PLRIFSGHISDVDCVTFHPN 648

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G  +  G++   C +W      D    + V  F  H   I  V ++ D   LAT S D  
Sbjct: 649 GCYIFTGSSDKTCRMW------DITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGV 702

Query: 231 ARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280
             +W I     L+  + + +  V   +++ +S  LV+  SD+ VR+WDL+
Sbjct: 703 IHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 4/187 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRT 62
           +L SA  D TIR W   T     T +  +  V  ++ S    + A A H    RL+    
Sbjct: 567 LLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSC-- 624

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNE 121
            +  P+  F GH  +V  + F     ++ + S D T ++WD+    SV+    H A +  
Sbjct: 625 DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILS 684

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           V + P+   L +  +DG + IWD+G  + + +L     + + SLS   + ++LV+G +  
Sbjct: 685 VAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDN 744

Query: 182 NCYVWQM 188
           +  +W +
Sbjct: 745 SVRIWDL 751

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 107/254 (42%), Gaps = 28/254 (11%)

Query: 55  VRLYDIRTTNPNP-VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-------RA 106
           V LYD++T  P+  + +F      + S+++  + +   +  +D  IKVW +       +A
Sbjct: 454 VPLYDLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKA 513

Query: 107 PSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166
             +Q + K QAA+    +     E     +     +  +G +  ++           S S
Sbjct: 514 TKIQPS-KSQAAL-RAGLDNKINEKTRSQETPITTVKLVGHSGAIY-----------STS 560

Query: 167 VASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCS 226
            + D  +LV+ +      +W M  +T       +  ++ H   +  V  S    + AT S
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTT------LVTYKGHNHPVWDVQFSPVGHYFATAS 614

Query: 227 ADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVR 286
            D TAR+WS D  F L      H   V    F  +  Y+ T  SD   R+WD++T E VR
Sbjct: 615 HDQTARLWSCDHIFPLRI-FSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVR 673

Query: 287 QYGGHHKGAICVAL 300
            + GH    + VA+
Sbjct: 674 LFIGHTAPILSVAV 687

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 126/282 (44%), Gaps = 29/282 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTT---NPNPV----- 68
           AL  VC  T Q+++  ++ L  S D R +AAAG  +  ++++ +  +   NPN +     
Sbjct: 454 ALPSVCMYTFQNTNKDMSCLNFSDDCR-IAAAGFQDSYIKIWSLDGSSLNNPNIMLNSAN 512

Query: 69  ----------TSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQA 117
                      +  GH G V S +F  +NK+++S SED T+++W +   +   +YK H  
Sbjct: 513 NNYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNH 572

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            V +V   P      +   D   R+W       +   A   +  +  +S   +G  +  G
Sbjct: 573 PVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYVFTG 631

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           ++   C +W      D +    V  F  H   +  + +S D + L+T S D    +W I 
Sbjct: 632 SSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIG 685

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
              +L+    + +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 686 TGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 97/219 (44%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  +  S    + A A H    RL+     
Sbjct: 544 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 603

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WDV    SV+    H A V  +
Sbjct: 604 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 661

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + IWD+G  + + Q+       + SLS + +G++L++G    +
Sbjct: 662 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 721

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T   + +P   F  +   +T   ++ D+K 
Sbjct: 722 VRVWDLKKATTEPSAEPDEPFIGYLGDVT-ASINQDIKE 759

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 62/137 (45%), Gaps = 7/137 (5%)

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           S S + D   L++G+      +W M   T       +  ++ H   +  V  S    + A
Sbjct: 534 STSFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFA 587

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           T S D TAR+WS D  + L      H   V   +F  +  Y+ T  SD   R+WD+ST +
Sbjct: 588 TASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 646

Query: 284 IVRQYGGHHKGAICVAL 300
            VR + GH    IC+A+
Sbjct: 647 SVRLFLGHTAPVICIAV 663

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 19/109 (17%)

Query: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSID------DNFQLET------------ 244
           F++  K ++ +  S D +  A    D   ++WS+D       N  L +            
Sbjct: 463 FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTC 522

Query: 245 -TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
            TL  H   V+  +FS D+ YL++   D  VRLW + T   +  Y GH+
Sbjct: 523 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 571

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 118/252 (46%), Gaps = 36/252 (14%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY------KHQAA 118
           P  V  +EGH   + S+A  ++ +W+ ++S+D T  +W     S +R Y       H A+
Sbjct: 380 PIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTS-KRFYIYATFVGHAAS 438

Query: 119 VNEVVIHPNQGE------LISCDQDGNVRIW-------DLGE------NQCVHQLAPEDD 159
           V+ V + PN  E      +I+   D  V+ W       DL E      +    + A E D
Sbjct: 439 VSAVCL-PNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKD 497

Query: 160 TPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV 219
             + ++S+A + S+    +    C +W +         +PV    +H + +  V      
Sbjct: 498 --INAISMAPNDSIFATASYDKTCKLWNVD------TGEPVATLANHKRGLWDVSFCESE 549

Query: 220 KHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           K +ATCS D T ++WS++ +F +  TL+ H   V  C+F      LV+A +D  +++WD+
Sbjct: 550 KWIATCSGDKTVKIWSLE-SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDI 608

Query: 280 STREIVRQYGGH 291
           ++ + ++   GH
Sbjct: 609 ASGDCIKNLDGH 620

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 72/185 (38%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           I A+A YD T + W   TG                                         
Sbjct: 509 IFATASYDKTCKLWNVDTG----------------------------------------- 527

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
              PV +   H+  +  ++F +  KW+ + S D T+K+W + + +V +  + H  AV   
Sbjct: 528 --EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRC 585

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                Q +L+S   DG +++WD+    C+  L    +  + +LSV  DG ++++ +    
Sbjct: 586 SFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNR-IWALSVLEDGDLIISADADSV 644

Query: 183 CYVWQ 187
              W+
Sbjct: 645 FQFWK 649

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 13/133 (9%)

Query: 21  TGVCSRTIQ-HSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVT 79
           TGV +R+++  S S V   + +S    L A G  +  +  I   N     SF+GH G ++
Sbjct: 93  TGVITRSLKVSSPSYVMTCDPTST---LVAIGGTDGSITVIDIENGYIAHSFKGHGGTIS 149

Query: 80  SIAFQQE---NKWMVSSSE-DGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE---- 130
           S+ F  E   N W++ S + +G  KVWD+     +   + H +A+  +    N  +    
Sbjct: 150 SLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLN 209

Query: 131 LISCDQDGNVRIW 143
           LI+  +D  + +W
Sbjct: 210 LITGGRDNVLNLW 222

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/222 (19%), Positives = 88/222 (39%), Gaps = 21/222 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQD 137
           +T I+   + K+++  S+   +K+ +V    + R+ K  +    +   P    +     D
Sbjct: 65  ITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVAIGGTD 124

Query: 138 GNVRIWDLGENQCVHQLAPEDDTPLQSLS----VASDGSMLVAGNNKGNCYVWQMPHQTD 193
           G++ + D+      H       T + SL     + ++  +L +G+  G   VW      D
Sbjct: 125 GSITVIDIENGYIAHSFKGHGGT-ISSLKFYGELGTNIWLLGSGDTNGMAKVW------D 177

Query: 194 AANPKPVTKFRSHAKYITRVLLS----SDVKHLATCSADHTARVWSID---DNFQLETTL 246
               K     + H+  I  +  +     DV +L T   D+   +W  +    + +L  T+
Sbjct: 178 LVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTI 237

Query: 247 DNHQRWVWDCAFSA--DSAYLVTACSDHYVRLWDLSTREIVR 286
             H + +  C F    D  +  TA  D   ++ DL+   +V+
Sbjct: 238 PAHLQ-IEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVK 278

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 59/311 (18%), Positives = 112/311 (36%), Gaps = 38/311 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS----DKRFLAAAGH---LNVR 56
           +L S   +   + W+ +T  C  T+Q   S +  ++ +     D   L   G    LN+ 
Sbjct: 163 LLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQEN--KWMVSSSEDGTIKVWDVRAPSVQRNYK 114
            ++I+  +   V +   H   + +  F   N   +  ++  D   ++ D+   SV +  K
Sbjct: 223 RFNIKGKSSKLVKTIPAHL-QIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTK 281

Query: 115 HQAAVNEV----VIHPNQG-ELISCDQDGNVRIWDLGEN---------QCVHQLAPEDDT 160
               + E+    VI  NQG +  +   D  +++               Q    +A    T
Sbjct: 282 K--PIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEFIQIQEYIAGNHGT 339

Query: 161 PLQSLSVASDGSMLVAGNNKGNCYVWQMPH----QTDAANPKPVTKFRSHAKYITRVLLS 216
                 V  +   +    N  +  +  +P       D   P  V  +  H+  +  +  +
Sbjct: 340 VADLCLVTKNKDCIALATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACT 399

Query: 217 SDVKHLATCSADHTARVW---SIDDNFQLETTLDNHQRWVWDCAF-----SADSAYLVTA 268
            D + LAT S D TA +W   +    F +  T   H   V               Y++TA
Sbjct: 400 EDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITA 459

Query: 269 CSDHYVRLWDL 279
            +D  V+ W++
Sbjct: 460 SNDLTVKKWEI 470

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 63/150 (42%), Gaps = 20/150 (13%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPV-TKFRSHAKYITRVLLSSDV- 219
           L SL+   DG  L   +      +W   H  + +    +   F  HA  ++ V L + + 
Sbjct: 393 LNSLACTEDGQWLATASKDKTAILW---HWNNTSKRFYIYATFVGHAASVSAVCLPNVME 449

Query: 220 ----KHLATCSADHTARVWSI-----DDN---FQLETTLDN---HQRWVWDCAFSADSAY 264
               K++ T S D T + W I     D N   F +++++     H++ +   + + + + 
Sbjct: 450 KNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSI 509

Query: 265 LVTACSDHYVRLWDLSTREIVRQYGGHHKG 294
             TA  D   +LW++ T E V     H +G
Sbjct: 510 FATASYDKTCKLWNVDTGEPVATLANHKRG 539

>Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa]
           {ON} YIL046W (MET30) - Met30p contains five copies of
           WD40 motif and interacts with and regulates Met4p
           [contig 11] FULL
          Length = 627

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 120/309 (38%), Gaps = 38/309 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  +     K    +   + +R+++  T 
Sbjct: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTG 387

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               V ++ GH  +V S+      K +VS S D T+KVW V + +      H   V  V 
Sbjct: 388 AC--VAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +HP      S   D  +R+WD+  N CV     H    +   PL  L   +  +   +  
Sbjct: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503

Query: 179 NKGNCYVWQMP-----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
            +      Q P        D + P P                     HL +CS D+T ++
Sbjct: 504 PRNEATTAQDPPDGQLSALDDSLPYP--------------------SHLLSCSLDNTIKL 543

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           W +     + T    H   +WD A  AD+  +V+   D  V++WDL + + +  +  H  
Sbjct: 544 WEVRTGKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600

Query: 294 GAICVALND 302
              CV + D
Sbjct: 601 PITCVGIGD 609

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V S+ F    + + + S D T+ +WD+     V+R   H+  V    I+ 
Sbjct: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +LI+   D  +R+W+     CV       D+    LSV S   ++V+G+      VW
Sbjct: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDS---VLSVDSYKKIIVSGSADKTVKVW 422

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
            +  +T           R H +++  V L        + S D T R+W I  N
Sbjct: 423 HVESRT-------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 84/220 (38%), Gaps = 51/220 (23%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH--LNVRLYDIR 61
           I+ S   D T++ W   +  C     H++  V  +++   K F   +G     +R++DIR
Sbjct: 409 IIVSGSADKTVKVWHVESRTCYTLRGHTE-WVGTVKLHP-KSFTCFSGSDDTTIRMWDIR 466

Query: 62  TTNPNPVTSFEGHRGNVTSIA----FQQEN------------------------------ 87
           +     V  F GH G V  +        EN                              
Sbjct: 467 SNTC--VKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDD 524

Query: 88  -----KWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVR 141
                  ++S S D TIK+W+VR    V+ ++ H   + ++    +   ++S   D  V+
Sbjct: 525 SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVK 582

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           +WDL   +C+H        P+  + +    S  V+G+  G
Sbjct: 583 VWDLQSGKCIHTFDSH-QAPITCVGIGD--SEFVSGDELG 619

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDK-RFLAAAGHLNVRLYDIRTT 63
           L S   D+TI+ WE  TG C RT  H        +I++D  R ++ A    V+++D+++ 
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKV 101
               + +F+ H+  +T +         VS  E G +KV
Sbjct: 590 --KCIHTFDSHQAPITCVGIGDSE--FVSGDELGCVKV 623

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 126/306 (41%), Gaps = 31/306 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH--------------LNVRLYDIRT-- 62
           AL  VC  T  ++D  +  LE S D R LAAAG               LN +L +     
Sbjct: 483 ALPSVCMYTFHNTDRDMTSLEFSDDCR-LAAAGFQDSQIKIFSLDGSSLNSKLTESNKKT 541

Query: 63  ----TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQA 117
                N    ++  GH G V S +F  +N+++VS SED T+++W +   +   +YK H  
Sbjct: 542 NKLLNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNH 601

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            V +V   P      +   D   R+W       +   A   +  +  +S   +G  L  G
Sbjct: 602 PVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYLFTG 660

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           ++   C +W      D      V  F      +    +S D + L+T S D    VW I 
Sbjct: 661 SSDKTCRMW------DITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIG 714

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
              +L+    + +  ++  +++ +   L++  +DH VR+WDL  ++   + G   +    
Sbjct: 715 TGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL--KKATTESGAEPEEPFV 772

Query: 298 VALNDV 303
             L DV
Sbjct: 773 GYLGDV 778

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 95/219 (43%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  +E S    + A A H    RL+     
Sbjct: 573 LVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHI 632

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WD+    SV+      A V   
Sbjct: 633 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMST 690

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS   +G++L++G    +
Sbjct: 691 SVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHS 750

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T  +  +P   F  +   +T   ++ D+K 
Sbjct: 751 VRVWDLKKATTESGAEPEEPFVGYLGDVT-TSINQDIKE 788

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 125/279 (44%), Gaps = 26/279 (9%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTT------------- 63
           AL  VC  T Q+++  ++ L+ S D R +AAAG  +  ++++ +  +             
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCR-IAAAGFQDSYIKIWSLDGSSLNNPNIALNNND 511

Query: 64  -NPNPV-TSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVN 120
            + +P   +  GH G V S +F  +NK+++S SED T+++W +   +   +YK H   V 
Sbjct: 512 KDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVW 571

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
           +V   P      +   D   R+W       +   A   +  +  +S   +G  +  G++ 
Sbjct: 572 DVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYVFTGSSD 630

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
             C +W      D +    V  F  H   +  + +  D + L+T S D    VW I    
Sbjct: 631 KTCRMW------DVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGK 684

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +L+    + +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 685 RLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  +  S    + A A H    RL+     
Sbjct: 540 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 599

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WDV    SV+    H A V  +
Sbjct: 600 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISI 657

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+       + SLS + +G++L++G     
Sbjct: 658 AVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHT 717

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T   + +P   F  +   +T   ++ D+K 
Sbjct: 718 VRVWDLKKATTEPSAEPDEPFIGYLGDVT-ASINQDIKE 755

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           S S + D   L++G+      +W M   T       +  ++ H   +  V  S    + A
Sbjct: 530 STSFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVSFSPLGHYFA 583

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           T S D TAR+WS D  + L      H   V   +F  +  Y+ T  SD   R+WD+ST +
Sbjct: 584 TASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 642

Query: 284 IVRQYGGHHKGAICVAL 300
            VR + GH    I +A+
Sbjct: 643 SVRLFLGHTAPVISIAV 659

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 206 HAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYL 265
           H+  +     S D K+L + S D T R+WS+D +  L  +   H   VWD +FS    Y 
Sbjct: 524 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL-VSYKGHNHPVWDVSFSPLGHYF 582

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            TA  D   RLW       +R + GH     CV+ 
Sbjct: 583 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 617

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%)

Query: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSID----------------DNFQLETTL 246
           F++  K ++ +  S D +  A    D   ++WS+D                D      TL
Sbjct: 462 FQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTL 521

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
             H   V+  +FS D+ YL++   D  VRLW + T   +  Y GH+
Sbjct: 522 VGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 567

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 102/235 (43%), Gaps = 17/235 (7%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+ +  +    + H+  +  +   P   +L+S   
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 431

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 432 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 490

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI------DDNFQLETT 245
            D+ N         H   +  V+ + D + + + S D + ++W +        +   E T
Sbjct: 491 LDSENELST----GHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVT 546

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              H+ +V   A + D  Y+++   D  V  WD ++   +    GH    I VA+
Sbjct: 547 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 601

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D  V  + +S       AAG L+  VR++D  T
Sbjct: 426 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRTVRVWDSET 484

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK- 114
                   + N +++  GH+ +V S+ F ++ + +VS S D ++K+WD+R  + Q+++  
Sbjct: 485 GFLVERLDSENELST--GHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHAT 542

Query: 115 -------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                  H+  V  V    +   ++S  +D  V  WD
Sbjct: 543 CEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWD 579

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 84/210 (40%), Gaps = 23/210 (10%)

Query: 96  DGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLA 155
           +G  +  D  + ++Q        +  V   P+   L +  +D  +RIWDL   + +  L 
Sbjct: 349 NGATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ 408

Query: 156 PEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL 215
             +   + SL     G  LV+G+      +W +            +   S    +T V +
Sbjct: 409 GHEQD-IYSLDYFPAGDKLVSGSGDRTVRIWDL-------RTGQCSLTLSIEDGVTTVAV 460

Query: 216 S-SDVKHLATCSADHTARVWSIDDNFQLETTLDN-------HQRWVWDCAFSADSAYLVT 267
           S  D K++A  S D T RVW  +  F +E  LD+       H+  V+   F+ D   +V+
Sbjct: 461 SPGDGKYIAAGSLDRTVRVWDSETGFLVE-RLDSENELSTGHKDSVYSVVFTRDGRSVVS 519

Query: 268 ACSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
              D  V+LWDL      R   G    A C
Sbjct: 520 GSLDRSVKLWDL------RGLNGQKSHATC 543

>TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.231
           YIL046W
          Length = 687

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 128/298 (42%), Gaps = 33/298 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R    S   V  L     K  +  +    +++++  T 
Sbjct: 352 LLFTGSYDSTVAAWDLYTGKLIRRFVGSFDGVKTLHFDGQK-LVTGSLDKTIKVWNYLT- 409

Query: 64  NPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
               ++++ GH  +V S+ +F+   K +VS S D T+KVW V + S      H   VN V
Sbjct: 410 -GECISTYRGHTDSVMSVDSFK---KIIVSGSADKTVKVWHVESRSCYTLRGHTEWVNSV 465

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSVASDGS 172
            +HP    L SC  D  +R+WD+  N C          V ++ P     +++L V  D  
Sbjct: 466 KLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVV--DPK 523

Query: 173 MLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTAR 232
           ++V  + + N    +     +           S   Y T         HL +CS D+T +
Sbjct: 524 IIV--DEENNNENNENNENNENREGNESITLDSSLSYPT---------HLLSCSLDNTIK 572

Query: 233 VWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
           +W +     + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 573 LWDVQTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQG 627

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 79/177 (44%), Gaps = 15/177 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV-VIHP 126
           V  F+GH  +V ++ F    + + + S D T+  WD+    + R +    + + V  +H 
Sbjct: 333 VQEFKGHMDSVLTLQFTH--RLLFTGSYDSTVAAWDLYTGKLIRRF--VGSFDGVKTLHF 388

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +L++   D  +++W+    +C+       D+    +SV S   ++V+G+      VW
Sbjct: 389 DGQKLVTGSLDKTIKVWNYLTGECISTYRGHTDSV---MSVDSFKKIIVSGSADKTVKVW 445

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +  ++           R H +++  V L      L +CS D T R+W I  N  L+
Sbjct: 446 HVESRS-------CYTLRGHTEWVNSVKLHPKSFCLFSCSDDTTIRMWDIRTNVCLK 495

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 13/161 (8%)

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L +   D  V  WDL   + + +     D  +++L    DG  LV G+      VW    
Sbjct: 353 LFTGSYDSTVAAWDLYTGKLIRRFVGSFD-GVKTLHF--DGQKLVTGSLDKTIKVW---- 405

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             +    + ++ +R H   +  V   S  K + + SAD T +VW ++   +   TL  H 
Sbjct: 406 --NYLTGECISTYRGHTDSVMSV--DSFKKIIVSGSADKTVKVWHVES--RSCYTLRGHT 459

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
            WV        S  L +   D  +R+WD+ T   ++ + GH
Sbjct: 460 EWVNSVKLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGH 500

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 14/182 (7%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNR---LEISSDKRFLAAAGHLNVRLY 58
           S  L S   D TIR W+  T VC +  +    QV +   L I   +  +     +     
Sbjct: 471 SFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVVDPKIIVDEEN 530

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQA 117
           +      N          ++T  +       ++S S D TIK+WDV+    ++  + H  
Sbjct: 531 NNENNENNENNENREGNESITLDSSLSYPTHLLSCSLDNTIKLWDVQTGKCIRTQFGHVE 590

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            V ++    +   +IS   DG+++IWDL   +C+H          Q +S+ +     VA 
Sbjct: 591 GVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMH--------TFQGMSLYTGAGANVAN 640

Query: 178 NN 179
           NN
Sbjct: 641 NN 642

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 135/334 (40%), Gaps = 54/334 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T++   + V  +  S D   +A     N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
                 +  GH   +TS++++            + SSS+DGTIK+WD  +   Q      
Sbjct: 219 E-CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGH 277

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQL--------------------- 154
                 V    QG L S   D  VR+WD+  + +C++ L                     
Sbjct: 278 TNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRVG 337

Query: 155 ----------APED--DTPLQSLSV-----ASDGSMLVAGNNKGNCYVWQMPHQTDAANP 197
                      PED     L++         +   M+V  ++    ++W     T     
Sbjct: 338 AFDHTGKRPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKST----- 392

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           KPV +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+  A
Sbjct: 393 KPVARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQVA 451

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+   D  +++WD+ TR++     GH
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 122/284 (42%), Gaps = 32/284 (11%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           LAS+  D TI+ W+ ++ VC  T+    + V+ ++        + +    VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINS-- 308

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWM--VSSSEDGTIKVWDV----RAPSVQRNYKHQAA 118
                     +G   +I  +    W+  +S S D  ++V       + PS   + + +A 
Sbjct: 309 ----------QGRCINI-LKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKKAL 357

Query: 119 VNEVVIHPNQGE----LISCDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            N   I    G     +++   D  + +W+ L   + V ++       +  ++ + DG  
Sbjct: 358 ENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL-VNHVAFSPDGRY 416

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           +V+ +   +  +W      D  + K ++ FR H   + +V  SSD + L +CS D T +V
Sbjct: 417 IVSASFDNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 470

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           W +    +L   L  H+  V+   +S D   + +   D  VRLW
Sbjct: 471 WDVRTR-KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILASAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           ++ +A  D T+  W  L  T   +R   H    VN +  S D R++ +A   N ++L+D 
Sbjct: 373 MMVTASDDFTMFLWNPLKSTKPVARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAV 119
           R  +   +++F GH  +V  +A+  + + +VS S+D T+KVWDVR   +  +   H+  V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDQDGNVRIW 143
             V    +   + S  +D  VR+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+   + H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLVTACSDHYVRLWDLSTREI 284
           R+W       L   L  H +W+   ++             L ++  D  +++WD  +R  
Sbjct: 211 RLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE------TTLDNHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    F+++      + +  H   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT   D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 121/270 (44%), Gaps = 20/270 (7%)

Query: 23  VCSRTIQHSDSQVNRLEISSDKRFLAAA---GHLNVRLYD---------IRTTNPNPVTS 70
           VC  T  +++  +  L+ S D R +AA     H+ +   D          ++   +  T+
Sbjct: 463 VCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTT 522

Query: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQG 129
             GH G V S++F  +N+++VS+SED T+++W +   +   +YK H   V +V   P   
Sbjct: 523 LIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGH 582

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMP 189
              +   D   R+W       +   A   +  +  ++   +G+ ++ G++   C +W + 
Sbjct: 583 YFATVSHDQTARLWSCDHIYPLRIFAGHLND-VDCVAFHPNGTYVLTGSSDKTCRMWDI- 640

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNH 249
            QT  +    V  F  H   +  V +S D + L T S D    VW I    +++    + 
Sbjct: 641 -QTGDS----VRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHG 695

Query: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +  V   +F+ +   LV+  +D  VR+WDL
Sbjct: 696 KSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 96/205 (46%), Gaps = 4/205 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T  C  + +  +  V  ++ S    + A   H    RL+     
Sbjct: 542 LVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHI 601

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  +AF     ++++ S D T ++WD++   SV+    H A+V  V
Sbjct: 602 YP--LRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 659

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+     + + SLS   +G++LV+G    +
Sbjct: 660 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQS 719

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHA 207
             VW +   T+    +P   +  ++
Sbjct: 720 VRVWDLKKFTNEPALEPEQPYSGYS 744

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 108/257 (42%), Gaps = 23/257 (8%)

Query: 55  VRLYDIRTTNPNP-VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-------RA 106
           ++L +++T+ P+  + +F     ++TS+ F ++++ + +  +D  IK+W +       + 
Sbjct: 451 IKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKL 510

Query: 107 PSVQRNYK-------HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDD 159
           PS  +          H   V  V   P+   L+S  +D  VR+W L    C+      + 
Sbjct: 511 PSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNH 570

Query: 160 TPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV 219
            P+  +  +  G      ++     +W   H        P+  F  H   +  V    + 
Sbjct: 571 -PVWDVKFSPLGHYFATVSHDQTARLWSCDHIY------PLRIFAGHLNDVDCVAFHPNG 623

Query: 220 KHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            ++ T S+D T R+W I     +   L  H   V   A S D  +L T   D  + +WD+
Sbjct: 624 TYVLTGSSDKTCRMWDIQTGDSVRLFL-GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI 682

Query: 280 STREIVRQYGGHHKGAI 296
            T + ++Q  GH K A+
Sbjct: 683 GTGKRIKQMRGHGKSAV 699

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 14/149 (9%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVW---------QMPHQT-DAANPKPVTKFRSHAKYIT 211
           + SL  + D  ++ AG    +  +W         ++P ++ +A+N    T    H+  + 
Sbjct: 475 MTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASN---TTTLIGHSGPVY 531

Query: 212 RVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSD 271
            V  S D ++L + S D T R+WS+D  F    +   H   VWD  FS    Y  T   D
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLD-TFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHD 590

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              RLW       +R + GH     CVA 
Sbjct: 591 QTARLWSCDHIYPLRIFAGHLNDVDCVAF 619

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 134/329 (40%), Gaps = 44/329 (13%)

Query: 11  DHTIRFWEALTGVCSRTIQHS---DSQVNRLEISSDKRFLAAA------------GHLNV 55
           D+ + F  AL       + HS    S V  ++ S+D +FLA              G L  
Sbjct: 304 DYYVVFNPALPLELDVELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIA 363

Query: 56  RLYDIRTTNPNPVTSFEGHRGN----VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQR 111
           +L D   T+P+  ++  G   +    + S+ F  + +++ + +ED  I++WD++   +  
Sbjct: 364 KLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVM 423

Query: 112 NYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             K H+  V  +   PN  +L+S   D  VRIWDL   QC   L+ E      ++S  +D
Sbjct: 424 VLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVS-PND 482

Query: 171 GSMLVAGNNKGNCYVWQ-----MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATC 225
           G  + AG+      VW      +  + D+ N         H   +  V+ + D   + + 
Sbjct: 483 GKFIAAGSLDRAVRVWDSTTGFLVERLDSEN----ELGTGHRDSVYSVVFTRDGNEVVSG 538

Query: 226 SADHTARVWSI--------------DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSD 271
           S D T ++W++                +   E T   H+ +V     S D  Y+++   D
Sbjct: 539 SLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKD 598

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             +  WD  +   +    GH    I VA+
Sbjct: 599 RGILFWDKESGNPLLMLQGHRNSVISVAV 627

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 12/110 (10%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI-- 60
           L S   D T+R W+  TG CS T+   +  V  + +S +     AAG L+  VR++D   
Sbjct: 444 LVSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTT 502

Query: 61  -----RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
                R  + N + +  GHR +V S+ F ++   +VS S D T+K+W++R
Sbjct: 503 GFLVERLDSENELGT--GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMR 550

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 138/342 (40%), Gaps = 56/342 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +  S D   +A     N +RL++    
Sbjct: 158 MVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVAWSPDAEVIATGSMDNTIRLWN--GI 215

Query: 64  NPNPVT-SFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKH 115
           N  P+  S  GH   +TS+A++        +   + S+S+DGTIKVWD            
Sbjct: 216 NGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASKDGTIKVWDTTGRVCLYTLSG 275

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN-QCVH--------------------QL 154
             +    V    Q  L +   D  +R+WD+  N +C++                    ++
Sbjct: 276 HTSSVSCVRWGGQNMLYTGSHDKTIRVWDMNSNGRCINILKSHAHWVNHLSLSTDYALRI 335

Query: 155 APED-------------DTPLQSLS--VASDG---SMLVAGNNKGNCYVWQMPHQTDAAN 196
            P D             D  L++    V  +G    ++V  ++    ++W     T    
Sbjct: 336 GPFDHSGAKPAIAEEARDKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKST---- 391

Query: 197 PKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+ +   H K +  V  S D +H+ + S D++ ++W   D  +  +T   H   V+  
Sbjct: 392 -KPLARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQV 449

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           A+S+D   LV+   D  +++WD+ T+++     GH      V
Sbjct: 450 AWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHQDEVFTV 491

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 134/325 (41%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWEALTG--VCSRTIQHSD-------SQVNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W  + G  +      HS          ++ +++    R  +A+    
Sbjct: 199 VIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASKDGT 258

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------- 106
           ++++D  TT    + +  GH  +V+ + +  +N  + + S D TI+VWD+ +        
Sbjct: 259 IKVWD--TTGRVCLYTLSGHTSSVSCVRWGGQNM-LYTGSHDKTIRVWDMNSNGRCINIL 315

Query: 107 -----------------------------PSVQRNYKHQAAVN-EVVIHPN---QGELIS 133
                                        P++    + +A  N E ++  N   +  +++
Sbjct: 316 KSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKKNGHTEELMVT 375

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L   + + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 376 ASDDFTMFLWNPLKSTKPLARMTGHQKL-VNHVAFSPDGRHIVSASFDNSIKLW------ 428

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D  + K ++ FR H   + +V  SSD + L +CS D T +VW +    +L   L  HQ  
Sbjct: 429 DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK-KLSVDLPGHQDE 487

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  VRLW
Sbjct: 488 VFTVDWSVDGKRVCSGGKDKMVRLW 512

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 61/152 (40%), Gaps = 13/152 (8%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S    +  S +V G       +W    QT      P+     H+ ++  V
Sbjct: 138 IAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCDTQT------PMATLSGHSNWVLCV 191

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLV 266
             S D + +AT S D+T R+W+  +   +  +L  H +W+   A+             L 
Sbjct: 192 AWSPDAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLA 251

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           +A  D  +++WD + R  +    GH     CV
Sbjct: 252 SASKDGTIKVWDTTGRVCLYTLSGHTSSVSCV 283

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 257 AFSADSA-YLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           AF+ +S+  +VT   D+  RLWD  T+  +    GH    +CVA
Sbjct: 149 AFAPNSSSRMVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVA 192

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 142/336 (42%), Gaps = 56/336 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +  S D   +A     N +RL++    
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVSWSPDGEIIATGSMDNTIRLWESDRG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWD-VRAPSVQRNYKH 115
            P       GH   +TS++++        E   + S+S+DGTIK+WD VR   V     H
Sbjct: 219 KPLG-EPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVRRVCVYTLSGH 277

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLG-ENQCVHQL-------------------- 154
             +V+  V    QG L S   D  VR+WD+    +C++ L                    
Sbjct: 278 TNSVS-CVKWGGQGVLYSGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLSTDYALRR 336

Query: 155 APEDDTPLQSLS---------------VASDGS---MLVAGNNKGNCYVWQMPHQTDAAN 196
            P D T  +  S               V  +G+   ++V  ++    ++W  P +++   
Sbjct: 337 GPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLWN-PLKSN--- 392

Query: 197 PKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+  
Sbjct: 393 -KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFLSTFRGHVSSVYQV 450

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+   D  +++WD+ TR++     GH 
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/325 (20%), Positives = 134/325 (41%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWEA---------LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN 54
           I+A+   D+TIR WE+         L G        S   ++ ++     R  +A+    
Sbjct: 200 IIATGSMDNTIRLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGT 259

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV----RAPSVQ 110
           ++++D  T     V +  GH  +V+ + +  +   + S S D T++VWD+    +  ++ 
Sbjct: 260 IKIWD--TVRRVCVYTLSGHTNSVSCVKWGGQGV-LYSGSHDKTVRVWDMNLGGKCINIL 316

Query: 111 RNYKH---------------------------------QAAVN-EVVIHPN---QGELIS 133
           +N+ H                                 +A  N E V+  N   +  +++
Sbjct: 317 KNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTEELMVT 376

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L  N+ + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 377 ASDDFTMFLWNPLKSNKPLARMTGHQKL-VNHVAFSPDGRYIVSASFDNSIKLW------ 429

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D  + K ++ FR H   + +V  SSD + L +CS D T +VW +    +L   L  HQ  
Sbjct: 430 DGRDGKFLSTFRGHVSSVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR-KLSVDLPGHQDE 488

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  +RLW
Sbjct: 489 VYTVDWSVDGKRVCSGGKDKMIRLW 513

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 54/134 (40%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+T    H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMTTLTGHQNWVLCVSWSPDGEIIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAF-------SADSAYLVTACSDHYVRLWDLSTREI 284
           R+W  D    L   L  H +W+   ++       + +   L +A  D  +++WD   R  
Sbjct: 211 RLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           V    GH     CV
Sbjct: 271 VYTLSGHTNSVSCV 284

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD  T+  +    GH    +CV+
Sbjct: 156 SSRMVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVS 193

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 135/334 (40%), Gaps = 54/334 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T++   + V  +  S D   +A     N +RL+D ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
                 +  GH   +TS++++            + SSS+DGTIK+WD  +   Q      
Sbjct: 219 Q-CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGH 277

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQL--------------------- 154
                 V    QG L S   D  VR+WD+  + +C++ L                     
Sbjct: 278 TNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIG 337

Query: 155 -----APEDDTPLQSLSVASDG------------SMLVAGNNKGNCYVWQMPHQTDAANP 197
                  +  TP ++   A +              M+V  ++    ++W     T     
Sbjct: 338 AFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKST----- 392

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+  A
Sbjct: 393 KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQVA 451

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+   D  +++WD+ TR++     GH
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 118/280 (42%), Gaps = 24/280 (8%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           LAS+  D TI+ W+ ++ VC  T+    + V+ ++        + +    VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINS-- 308

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD--VRAPSVQRNYKHQAAVNEV 122
                  +G   N+        N   +S+     I  +D   + PS     + +A  N  
Sbjct: 309 -------QGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYE 361

Query: 123 VIHPNQGE----LISCDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            I    G     +++   D  + +W+ L   + + ++       +  ++ + DG  +V+ 
Sbjct: 362 KICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSA 420

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +   +  +W      D  + K ++ FR H   + +V  SSD + L +CS D T +VW + 
Sbjct: 421 SFDNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 474

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              +L   L  H+  V+   +S D   + +   D  VRLW
Sbjct: 475 TR-KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 4   ILASAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           ++ +A  D+T+  W  L  T   +R   H    VN +  S D R++ +A   N ++L+D 
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAV 119
           R  +   +++F GH  +V  +A+  + + +VS S+D T+KVWDVR   +  +   H+  V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDQDGNVRIW 143
             V    +   + S  +D  VR+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+   + H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLVTACSDHYVRLWDLSTREI 284
           R+W       L   L  H +W+   ++             L ++  D  +++WD  +R  
Sbjct: 211 RLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE------TTLDNHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    F+++      + +  H   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT   D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 123/295 (41%), Gaps = 50/295 (16%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRL------------------- 57
           AL  VC  T  +++  +  L+ S D R LAA G  +  ++L                   
Sbjct: 506 ALPSVCLYTFHNTNRDMTSLDFSEDSR-LAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPS 564

Query: 58  --------YDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSV 109
                   Y    TN    T+  GH G V S +F  +NK+++S SED T+++W +   + 
Sbjct: 565 PSATTADKYSKDFTN----TTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTT 620

Query: 110 QRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH----QLAPEDDTPLQS 164
             +YK H   V +V   P      +   D   R+W      C H    ++     + +  
Sbjct: 621 LVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDC 675

Query: 165 LSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLAT 224
           +S   +G  +  G++   C +W      D +    V  F  H   +    +S D + L+T
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVISTAVSPDGRWLST 729

Query: 225 CSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            S D    VW I    +L+    + +  ++  ++S +   LV++ +DH VR+WDL
Sbjct: 730 GSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 95/219 (43%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  ++ S    + A A H    RL+     
Sbjct: 601 LISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHI 660

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WDV    SV+    H A V   
Sbjct: 661 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIST 718

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + +  +       + SLS + +G++LV+     +
Sbjct: 719 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHS 778

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T   + +P   F  +   +T   ++ D+K 
Sbjct: 779 VRVWDLKKATAEPSAEPEEPFVGYLGDVT-ASINQDIKE 816

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 201 TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA 260
           T    H+  +     S D K+L + S D T R+WS+D N  L  +   H   VWD  FS 
Sbjct: 580 TTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTL-VSYKGHNHPVWDVKFSP 638

Query: 261 DSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              Y  TA  D   RLW       +R + GH     CV+ 
Sbjct: 639 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSF 678

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 104/248 (41%), Gaps = 27/248 (10%)

Query: 55  VRLYDIRTTNPNP-VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY 113
           +RL +++   P+  + +F     ++TS+ F ++++      +D  IK+W +   S++   
Sbjct: 498 IRLNNLQAALPSVCLYTFHNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLK--- 554

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM 173
           K+    +         +  S D      I   G +  V+           S S + D   
Sbjct: 555 KYGDVSSSPSPSATTADKYSKDFTNTTLI---GHSGAVY-----------STSFSPDNKY 600

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           L++G+      +W +   T       +  ++ H   +  V  S    + AT S D TAR+
Sbjct: 601 LISGSEDKTVRLWSLDTNTT------LVSYKGHNHPVWDVKFSPLGHYFATASHDQTARL 654

Query: 234 WSIDDNFQLETTLDNHQRWVWDC-AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           WS D  + L      H   V DC +F  +  Y+ T  SD   R+WD+ST + VR + GH 
Sbjct: 655 WSCDHIYPLRI-FAGHLSDV-DCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHT 712

Query: 293 KGAICVAL 300
              I  A+
Sbjct: 713 APVISTAV 720

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 101/235 (42%), Gaps = 17/235 (7%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P   +L+S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 473

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI------DDNFQLETT 245
            D+ N         H   +  V+ + D + + + S D + ++W +        +   E T
Sbjct: 474 LDSEN----ELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVT 529

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              H+ +V   A + D  Y+++   D  V  WD ++   +    GH    I VA+
Sbjct: 530 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 584

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 107/253 (42%), Gaps = 33/253 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRTT 63
           LA+   D  IR W+  T     T+Q  +  +  L+   +  + ++ +G   VR++D+RT 
Sbjct: 367 LATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTG 426

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSV--------QRNYK 114
             +   S E     VT++A    + K++ + S D T++VWD     +        + +  
Sbjct: 427 QCSLTLSIE---DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTG 483

Query: 115 HQAAVNEVVIHPNQGELISCDQDGNVRIWDL-GEN------QCVHQLAPEDDTPLQSLSV 167
           H+ +V  VV   +   +IS   D +V++WDL G N       C        D  L S++ 
Sbjct: 484 HKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVL-SVAT 542

Query: 168 ASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVL------LSSDVKH 221
             D   +++G+       W      D A+  P+   + H   +  V       L  DV  
Sbjct: 543 TQDDEYILSGSKDRGVLFW------DTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGV 596

Query: 222 LATCSADHTARVW 234
            AT S D  AR+W
Sbjct: 597 FATGSGDCKARIW 609

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 86/219 (39%), Gaps = 23/219 (10%)

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG 146
           N+     + +GT       + ++Q        +  V   P+   L +  +D  +RIWDL 
Sbjct: 323 NEASTGPANNGTADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLT 382

Query: 147 ENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSH 206
             + +  L   +   + SL     G  LV+G+      +W +            +   S 
Sbjct: 383 TKKILMTLQGHEQD-IYSLDYFPAGDKLVSGSGDRTVRIWDL-------RTGQCSLTLSI 434

Query: 207 AKYITRVLLS-SDVKHLATCSADHTARVWSIDDNFQLETTLDN-------HQRWVWDCAF 258
              +T V +S  D K++A  S D T RVW  +  F +E  LD+       H+  V+   F
Sbjct: 435 EDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVE-RLDSENELSTGHKDSVYSVVF 493

Query: 259 SADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
           + D   +++   D  V+LWDL      R   G    A C
Sbjct: 494 TRDGQGVISGSLDRSVKLWDL------RGLNGQKSHATC 526

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 103/241 (42%), Gaps = 22/241 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    K H+  +  +   P+  +L+S   
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSDTGFLVER 676

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD-----------NF 240
            D+ N         H   +  V+ + D   + + S D + ++W++ +           + 
Sbjct: 677 LDSEN----ELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSG 732

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + D  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 733 TCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAV 792

Query: 301 N 301
           N
Sbjct: 793 N 793

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI-- 60
           L S   D T+R W+  TG C+ T+   D          D +F+ AAG L+  VR++D   
Sbjct: 612 LVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFI-AAGSLDRAVRVWDSDT 670

Query: 61  -----RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
                R  + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R
Sbjct: 671 GFLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 237 DDNFQLETTLD-NHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           +DN + ET+       ++    FS D  +L T   D  +R+WD+  ++IV    GH +
Sbjct: 541 NDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQ 598

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 142/335 (42%), Gaps = 56/335 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +    +   +A     N +RL++ ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEGKSG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRNYKH 115
            P    +  GH   +TS+A++        E   + S+S+DGTIK+WD  R   +     H
Sbjct: 219 KPVG-DALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLSGH 277

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQL-------------------- 154
             +V+  +    QG L S   D  VR WD+  E +C++ L                    
Sbjct: 278 TNSVS-CIKWGGQGILYSGSHDKTVRAWDMNSEGRCINVLKSHAHWVNHLSLSTDYALRV 336

Query: 155 -----------APED--DTPLQSLS--VASDG---SMLVAGNNKGNCYVWQMPHQTDAAN 196
                      +PED  D  L++    V  +G    ++V  ++    ++W     T    
Sbjct: 337 GPFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKST---- 392

Query: 197 PKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+  
Sbjct: 393 -KPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           A+SAD   LV+   D  +++WD+ TR++     GH
Sbjct: 451 AWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 121/284 (42%), Gaps = 32/284 (11%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           LASA  D TI+ W+    VC  T+    + V+ ++        + +    VR +D+ +  
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGGQGILYSGSHDKTVRAWDMNS-- 308

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWM--VSSSEDGTIKVWDVR----APSVQRNYKHQAA 118
                  EG   NV     +    W+  +S S D  ++V         P+   + + +A 
Sbjct: 309 -------EGRCINV----LKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKAL 357

Query: 119 VN-EVVIHPN---QGELISCDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            N E V+  N   +  +++   D  + +W+ L   + + ++       +  ++ + DG  
Sbjct: 358 KNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKL-VNHVAFSPDGRY 416

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           +V+ +   +  +W      D  + K ++ FR H   + +V  S+D + L +CS D T +V
Sbjct: 417 IVSASFDNSIKLW------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKV 470

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           W +    +L   L  H+  V+   +S D   + +   D  VR+W
Sbjct: 471 WDVRTR-KLSVDLPGHKDEVFTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILASAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           ++ +A  D T+  W  L  T    R   H    VN +  S D R++ +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSTKPLGRMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAV 119
           R  +   +++F GH  +V  +A+  + + +VS S+D T+KVWDVR   +  +   H+  V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDQDGNVRIW 143
             V    +   + S  +D  VRIW
Sbjct: 490 FTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 57/152 (37%), Gaps = 13/152 (8%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S    +  S +V G       +W    QT      P      H  ++  V
Sbjct: 139 IAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQT------PKATLTGHTNWVLCV 192

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAF-------SADSAYLV 266
               + + +AT S D+T R+W       +   L  H +W+   A+       + +   L 
Sbjct: 193 SWCPNGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLA 252

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           +A  D  +++WD S R  +    GH     C+
Sbjct: 253 SASKDGTIKIWDTSRRVCLYTLSGHTNSVSCI 284

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 108/257 (42%), Gaps = 33/257 (12%)

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK---- 114
           D R   P  V  +EGH   + ++   ++ KW+ + S+D T+ +W  R  S    +K    
Sbjct: 387 DSRDCFPLEVELYEGHTDLLNALDSSEDGKWLATCSKDHTVILW--RYSSELEKFKAYAK 444

Query: 115 ---HQAAVNEVVIHPNQGE------LISCDQDGNVRIWDLG----ENQCVHQLAPED--- 158
              H   V  V + PN         +I+   D  ++ W +     E    H +   D   
Sbjct: 445 FTGHAGPVTAVGL-PNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTR 503

Query: 159 ---DTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL 215
              D  + +LS++ + S     +    C VW      D  + +      +H + +  V  
Sbjct: 504 RAHDKDINALSISPNDSTFATASYDKTCKVW------DVDSGELQGTLANHKRGLWDVSF 557

Query: 216 SSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVR 275
               K LATCS D T +VWS+D    +  TL+ H   V  C+F   +  LV+  +D  ++
Sbjct: 558 CQYDKLLATCSGDKTVKVWSLD-TLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIK 616

Query: 276 LWDLSTREIVRQYGGHH 292
           LWDLST E VR    H 
Sbjct: 617 LWDLSTGECVRTLDAHE 633

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 104/284 (36%), Gaps = 29/284 (10%)

Query: 30  HSDSQVNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAFQQE 86
           H+D  +N L+ S D ++LA     +  +   Y            F GH G VT++     
Sbjct: 402 HTD-LLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGLPNV 460

Query: 87  NK-----WMVSSSEDGTIKVWDVRAP------------SVQRNYKHQAAVNEVVIHPNQG 129
            +     +++++S D TIK W V  P            S      H   +N + I PN  
Sbjct: 461 MRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDS 520

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMP 189
              +   D   ++WD+   +    LA      L  +S      +L   +      VW + 
Sbjct: 521 TFATASYDKTCKVWDVDSGELQGTLA-NHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLD 579

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNH 249
             +       V     H   + R    +  K L +  AD   ++W +    +   TLD H
Sbjct: 580 TLS------VVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTG-ECVRTLDAH 632

Query: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           +  +W  +   D    VTA +D   + W   + E  ++   +HK
Sbjct: 633 ENRIWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHK 676

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAA-AGHLNVRLYDIRTT 63
            A+A YD T + W+  +G    T+ +    +  +      + LA  +G   V+++ + T 
Sbjct: 522 FATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTL 581

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEV 122
             + V + EGH   V   +F  +NK +VS+  DG IK+WD+      R    H+  +  +
Sbjct: 582 --SVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWAL 639

Query: 123 VIHPNQGELISCDQDGNVRIW-DLGENQ 149
            +  +  E ++ D DG  + W D  E Q
Sbjct: 640 SVLHDGDEFVTADADGVFQFWKDCSEEQ 667

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 108/295 (36%), Gaps = 72/295 (24%)

Query: 4   ILASAGYDHTIRFWEA-----------LTGVCSRTIQHSDSQVNRLEIS-SDKRFLAAAG 51
            + +A  D TI+ W             +  V   T +  D  +N L IS +D  F  A+ 
Sbjct: 468 FIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATASY 527

Query: 52  HLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQR 111
               +++D+ +       +   H+  +  ++F Q +K + + S D T+KVW +   SV +
Sbjct: 528 DKTCKVWDVDSGELQ--GTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVK 585

Query: 112 NYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             + H  AV          +L+S   DG +++WDL   +CV  L   ++  + +LSV  D
Sbjct: 586 TLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENR-IWALSVLHD 644

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G   V                                                T  AD  
Sbjct: 645 GDEFV------------------------------------------------TADADGV 656

Query: 231 ARVWSIDDNFQLETTLDNHQRWV--------WDCAFSADSAYLVTACSDHYVRLW 277
            + W      Q +  L+NH+R V        +       +A+L+    DH +RL+
Sbjct: 657 FQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAFLLAMTLDHPMRLY 711

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 132/298 (44%), Gaps = 24/298 (8%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +  S D   +A     N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
            P    +  GH+  +TS++++        E   + +SS+DGTIKVWD         Y   
Sbjct: 219 KPFG-EAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCL--YTLS 275

Query: 117 AAVNEV--VIHPNQGELISCDQDGNVRIWDLG-ENQCVHQLAPEDDTPLQSLSVASDGSM 173
             VN V  V    +  L S   D  VR+WD+    +C++ L       +  LS+++D ++
Sbjct: 276 GHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGGKCINILKSHAHW-VNHLSLSTDYAL 334

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
            V   +    +   MP   + A  K +  +   AK        SD + + T S D T  +
Sbjct: 335 RVGPFD----HTGIMPATPEEARAKALKNYEKVAKRN-----GSDEELMVTASDDFTMFL 385

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           W+   + +  + +  HQ+ V   AFS D  Y+V+A  D+ ++LWD    + +  + GH
Sbjct: 386 WNPSKSTKPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGH 443

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 108/282 (38%), Gaps = 67/282 (23%)

Query: 4   ILASAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L S  +D T+R W+  L G C   ++     VN L +S+D           +R+     
Sbjct: 291 LLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTD---------YALRVGPFDH 341

Query: 63  TNPNPVTSFEGHRG---NVTSIAFQQ--ENKWMVSSSEDGTIKVWDVRAPS--VQRNYKH 115
           T   P T  E       N   +A +   + + MV++S+D T+ +W+    +  + R   H
Sbjct: 342 TGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGH 401

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLV 175
           Q  VN V   P                                           DG  +V
Sbjct: 402 QKLVNHVAFSP-------------------------------------------DGRYIV 418

Query: 176 AGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
           + +   +  +W      D+ + K +T FR H   + +V  SSD + LA+CS D + +VW 
Sbjct: 419 SASFDNSIKLW------DSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKVWD 472

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           I    +L   L  H   V+   +S D   + +   D  VRLW
Sbjct: 473 IRTK-KLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 53/134 (39%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+     H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMVTLSGHTNWVLCVAWSPDGELIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAF-------SADSAYLVTACSDHYVRLWDLSTREI 284
           R+W   +       +  HQ+W+   ++       + +   L T+  D  +++WD   R  
Sbjct: 211 RLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 LYTLSGHVNSVSCV 284

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD  T+  +    GH    +CVA
Sbjct: 156 SSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVA 193

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 123/270 (45%), Gaps = 20/270 (7%)

Query: 23  VCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI-----------RTTNPNPVTS 70
           VC  T  +++ ++  L  S D R +AA    + ++L+ +           +  + +   +
Sbjct: 478 VCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVT 537

Query: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQG 129
             GH G V S++F  +N+++VS+SED T+++W +   +   +YK H   V +V   P   
Sbjct: 538 LIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGH 597

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMP 189
              +   D   R+W       +   A   +  +  ++   +G+ ++ G++   C +W + 
Sbjct: 598 YFATGSHDQTARLWSCDHIYPLRIFAGHLND-VDCVTFHPNGTYVLTGSSDKTCRMWDI- 655

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNH 249
            QT  +    V  F  H   +  V +S D + L T S D    VW I    +++    + 
Sbjct: 656 -QTGDS----VRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHG 710

Query: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +  V+  +F+ +   LV+  +D  VR+WDL
Sbjct: 711 KSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 95/204 (46%), Gaps = 4/204 (1%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T  C  + +  +  V  ++ S    + A   H    RL+     
Sbjct: 557 LVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHI 616

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  + F     ++++ S D T ++WD++   SV+    H A+V  V
Sbjct: 617 YP--LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 674

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+     + + SLS   +G++LV+G    +
Sbjct: 675 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQS 734

Query: 183 CYVWQMPHQTDAANPKPVTKFRSH 206
             VW +   T+  + +P   +  +
Sbjct: 735 VRVWDLKKFTNEPSLEPEQPYSGY 758

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 108/258 (41%), Gaps = 25/258 (9%)

Query: 55  VRLYDIRTTNPNPVTSFEGHRGN--VTSIAFQQENKWMVSSSEDGTIKVWDV-------R 105
           +++ +++T+ P+ V  +  H  N  +T + F  +++ + +  +D  IK+W +       +
Sbjct: 466 IKMDNLQTSAPS-VCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQ 524

Query: 106 APSVQRNYK-------HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPED 158
            PS  ++         H   V  V   P+   L+S  +D  VR+W L    C+      +
Sbjct: 525 LPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHN 584

Query: 159 DTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSD 218
             P+  +  +  G     G++     +W   H        P+  F  H   +  V    +
Sbjct: 585 H-PVWDVKFSPLGHYFATGSHDQTARLWSCDHIY------PLRIFAGHLNDVDCVTFHPN 637

Query: 219 VKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278
             ++ T S+D T R+W I     +   L  H   V   A S D  +L T   D  + +WD
Sbjct: 638 GTYVLTGSSDKTCRMWDIQTGDSVRLFL-GHTASVVSVAVSPDGRWLTTGSEDGVIIVWD 696

Query: 279 LSTREIVRQYGGHHKGAI 296
           + T + ++Q  GH K A+
Sbjct: 697 IGTGKRIKQMRGHGKSAV 714

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 112/249 (44%), Gaps = 17/249 (6%)

Query: 65  PNPVTSFE--GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
           PN + + E  GHR +V SI    +NK + ++S +GT+K+W+++  +  R ++   A+   
Sbjct: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P    ++  ++ G+++++DL  +  +          + SL + SDG  LV G+    
Sbjct: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKY-----------ITRVLLSSDVKHLATCSADHTA 231
              W      +   P  V KF    K            I  V +SSD K LA    D+T 
Sbjct: 491 VKFWDFKVDQELI-PGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +V+ ++ + +   +L  H+  V     S DS  L+T+ +D  +++W L   +  +    H
Sbjct: 550 KVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH 608

Query: 292 HKGAICVAL 300
               + V  
Sbjct: 609 QDSIMSVKF 617

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/315 (20%), Positives = 123/315 (39%), Gaps = 68/315 (21%)

Query: 28  IQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQEN 87
           +Q   + V  ++IS D + LA A +  +++++I+T     + +FE   G   +  F    
Sbjct: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436

Query: 88  KWMVSSSEDGTIKVWDVRAPSVQRNYK--HQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
             +V  +  G ++++D+ + ++  N +  H AA+  + +  +   L++   D  V+ WD 
Sbjct: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496

Query: 146 GENQ-----CVHQLAPE----DDTPLQ------SLSVASDGSMLVAGNNKGNCYVWQMPH 190
             +Q      V +  P+     DT L+      ++ ++SD   L          V+ +  
Sbjct: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNS 556

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID------------- 237
                  K       H   +  + +S D K L T SAD   ++W +D             
Sbjct: 557 M------KFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQD 610

Query: 238 ----------------------------DNFQLETTLDNHQRWVWDCAFSADSAYLVTAC 269
                                       D F+    L  HQ  VW  A S D+ ++V+  
Sbjct: 611 SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTS 670

Query: 270 SDHYVRLWDLSTREI 284
            DH +R+W+ +  E+
Sbjct: 671 HDHSIRVWEETEDEV 685

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 47  LAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD- 103
           L A G+ +  ++++D+   +   + +F GH+  +T + F      ++S S+D  I +WD 
Sbjct: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146

Query: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH 152
           V    + +   H+ ++  +    N+  LIS  +DG ++IWDL   QCV 
Sbjct: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVE 194

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 5   LASAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEIS-SDKRFLAAAGHLNVRLYDIRT 62
           L + GY D  I+ W+ ++           S +  L    +  R ++ +   ++ ++D+  
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNE 121
                +     H+ ++T I  + E+ W++S+S+DG IK+WD++    V+ +  H +    
Sbjct: 147 VGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205

Query: 122 VVIHPNQGELISCDQDGNVRIWDL 145
           + IH +   +I+   +  ++IW+L
Sbjct: 206 LAIHNDL--VITTSTESQIKIWNL 227

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 120/300 (40%), Gaps = 41/300 (13%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  +G   R +      +  L    +K  +  +    +R++D +  
Sbjct: 252 LLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLYFDENK-LITGSLDKTIRVWDYK-- 308

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               +++++GH  ++ S+   +  K +VS S D ++KVW +   +      H   VN V 
Sbjct: 309 GGRCISTYKGHSDSILSVDCYK--KLIVSGSADCSVKVWHIERRTCYTLKGHTEWVNCVK 366

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQC----------VHQLAPEDDTPLQSLSVASDGSM 173
           +HP      S   D  +R+WDL  N+C          V ++ P     ++ L V  +   
Sbjct: 367 LHPTSFSCFSASDDCTIRMWDLRSNKCLKVFKGHVGQVQKVIPLSIKDIEGLVVDDEVQS 426

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
             +  +  +          D + P P                     HL +CS D+T ++
Sbjct: 427 SASAQSTAD---EPCDDPLDTSIPYPT--------------------HLLSCSLDNTIKL 463

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           W +     + T    H   VWD A  AD+  +V+   D  V++WDL +      + G  +
Sbjct: 464 WDVYTGKCVRTQF-GHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQSGRCTNSFQGTQR 520

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 108/264 (40%), Gaps = 50/264 (18%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V ++ F    + + + S D TI +WD+ +   ++R   H   +    ++ 
Sbjct: 233 IREFKGHMDGVLTLQFNY--RLLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIK--TLYF 288

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           ++ +LI+   D  +R+WD    +C+       D+    LSV     ++V+G+   +  VW
Sbjct: 289 DENKLITGSLDKTIRVWDYKGGRCISTYKGHSDSI---LSVDCYKKLIVSGSADCSVKVW 345

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET-- 244
            +  +T           + H +++  V L        + S D T R+W +  N  L+   
Sbjct: 346 HIERRT-------CYTLKGHTEWVNCVKLHPTSFSCFSASDDCTIRMWDLRSNKCLKVFK 398

Query: 245 ------------TLDNHQRWVWD----------------CAFSADSA-----YLVTACSD 271
                       ++ + +  V D                C    D++     +L++   D
Sbjct: 399 GHVGQVQKVIPLSIKDIEGLVVDDEVQSSASAQSTADEPCDDPLDTSIPYPTHLLSCSLD 458

Query: 272 HYVRLWDLSTREIVRQYGGHHKGA 295
           + ++LWD+ T + VR   GH +G 
Sbjct: 459 NTIKLWDVYTGKCVRTQFGHVEGV 482

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 42/117 (35%), Gaps = 45/117 (38%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           L S   D+TI+ W+  TG C RT                 +F                  
Sbjct: 452 LLSCSLDNTIKLWDVYTGKCVRT-----------------QF------------------ 476

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNE 121
                   GH   V  IA   +N  +VS S DG +KVWD+++     +++    V E
Sbjct: 477 --------GHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQSGRCTNSFQGTQRVEE 523

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 119/288 (41%), Gaps = 46/288 (15%)

Query: 5   LASAGY-DHTIRFWEALTGVCSRT-IQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           LAS G+ D  I+ W +L G    T    ++   NR+ I+ D+        L+  L     
Sbjct: 469 LASTGFQDSYIKIW-SLDGTSLNTKFTQANKDRNRITIT-DRSLTHMDNELSATLI---- 522

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNE 121
                     GH G V S +F  +N++++S SED T+++W +   +   +YK H   + +
Sbjct: 523 ----------GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWD 572

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQ----------SLSVASDG 171
           V   P      +   D   R+W      C H        PL+           +S   +G
Sbjct: 573 VQFSPLGHYFATASHDQTARLW-----SCDHIF------PLRIFAGHLNDVDCVSFHPNG 621

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
             +  G++   C +W      D +    V  F  H   +    +S D + L T S D T 
Sbjct: 622 YYVFTGSSDKTCRMW------DISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTI 675

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            VW I    +L++   + +  V+   +S +   LV++ +D  VR+WDL
Sbjct: 676 NVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 102/244 (41%), Gaps = 28/244 (11%)

Query: 63  TNPNPVTS-----FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA 117
           TNPN + S     F     ++TS+ F  + +   +  +D  IK+W +   S+   +  QA
Sbjct: 438 TNPNSLPSVCMYTFHNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFT-QA 496

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
             +   I      L   D + +  +  +G +  V+           S S + D   L++G
Sbjct: 497 NKDRNRITITDRSLTHMDNELSATL--IGHSGTVY-----------STSFSPDNRYLISG 543

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +      +W +   T       +  ++ H   I  V  S    + AT S D TAR+WS D
Sbjct: 544 SEDKTVRLWSLDTHT------ALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCD 597

Query: 238 DNFQLETTLDNHQRWVWDC-AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
             F L      H   V DC +F  +  Y+ T  SD   R+WD+ST + VR + GH    +
Sbjct: 598 HIFPLRI-FAGHLNDV-DCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVV 655

Query: 297 CVAL 300
             A+
Sbjct: 656 STAV 659

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 4/197 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  +  ++ S    + A A H    RL+     
Sbjct: 540 LISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSC--D 597

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
           +  P+  F GH  +V  ++F     ++ + S D T ++WD+    SV+    H +AV   
Sbjct: 598 HIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVST 657

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +   DG + +WD+G  + +  L       + SL+ + +G++LV+     +
Sbjct: 658 AVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQS 717

Query: 183 CYVWQMPHQTDAANPKP 199
             VW +   +  AN  P
Sbjct: 718 VRVWDLFKPSANANNNP 734

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 106/251 (42%), Gaps = 17/251 (6%)

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVN 120
           T N N   S       + S+ F  + K++ + +ED  I++WD+    +    K H+  + 
Sbjct: 393 TGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIY 452

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
            +   P+  +L+S   D  VRIWDL    C   L+ ED     ++S   +G  + AG+  
Sbjct: 453 SLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLD 511

Query: 181 GNCYVWQ-----MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
               VW      +  + D+ N         H   +  V+ + D K + + S D + ++W+
Sbjct: 512 RTVRVWDSDTGFLVERLDSENELGT----GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWN 567

Query: 236 ID------DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYG 289
           ++       + + E T   H+ +V   A + +  Y+++   D  V  WD  +   +    
Sbjct: 568 LNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQ 627

Query: 290 GHHKGAICVAL 300
           GH    I V +
Sbjct: 628 GHRNSVISVTV 638

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDI-- 60
           L S   D T+R W+  TG CS T+   D  V  + +S  +    AAG L+  VR++D   
Sbjct: 463 LVSGSGDRTVRIWDLTTGTCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTVRVWDSDT 521

Query: 61  -----RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK- 114
                R  + N + +  GHR +V S+ F ++ K +VS S D ++K+W++   S Q+++  
Sbjct: 522 GFLVERLDSENELGT--GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAE 579

Query: 115 -------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                  H+  V  V    N   ++S  +D  V  WD
Sbjct: 580 CEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 616

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 126/280 (45%), Gaps = 19/280 (6%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQ--VNRLEISSDKRFLAAAGHLN----VRLY 58
           +AS   D T+R W+       + I  + S+  +N +    D   L  +G  +    V L 
Sbjct: 26  VASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVCYDKDHELLFYSGQESLINGVSLL 85

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAA 118
           DI + + +P+ +  GH  NV +++++  +  ++S S D T KVW +          HQA+
Sbjct: 86  DIESIDKDPLYTLIGHHSNVCALSYKHMSA-IISGSWDTTAKVW-INGALQWSLEGHQAS 143

Query: 119 V-NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
           V +  +I   +   I+   D  V++W   EN+ +   +      ++++ V S G  +   
Sbjct: 144 VWDAKIISVEENTFITASADRTVKLW--KENKLLKTFSGIHSDVIRNIEVLSSGKEIATC 201

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +N G   +  +       N K V     H  ++  V LS     L +C  D + R+W I+
Sbjct: 202 SNDGTIKISDLD-----GNIKQV--LSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDIN 254

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           +NF ++  +      +W C  +  +  +V  CSD+ VR++
Sbjct: 255 NNFNIKQVIKLPAVSIW-CVDTLPNGDIVVGCSDNTVRIF 293

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 10/157 (6%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS--DKRFLAAAGHLNVRLY 58
           MS I+ S  +D T + W  + G    +++   + V   +I S  +  F+ A+    V+L+
Sbjct: 113 MSAII-SGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLW 169

Query: 59  DIRTTNPNPVTSFEG-HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA 117
                    + +F G H   + +I      K + + S DGTIK+ D+     Q    H++
Sbjct: 170 ----KENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGNIKQVLSGHES 225

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQL 154
            V  V +     +L+SC +D ++RIWD+  N  + Q+
Sbjct: 226 FVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIKQV 262

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 143/338 (42%), Gaps = 57/338 (16%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           S ++  AG D+T R W+  T     T++   + V  +  S D   +A     N +RL++ 
Sbjct: 157 SRMITGAG-DNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEG 215

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRN 112
               P    +  GH   +TS++++        +   + S+S+DGTIK+WD  R   +   
Sbjct: 216 NKGQPVG-DALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITL 274

Query: 113 YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG-ENQCVHQL----------------- 154
             H ++V+  +    QG L S   D  +R WD+    +C++ L                 
Sbjct: 275 SGHTSSVS-CIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYA 333

Query: 155 ---------APEDDTPLQSLSVASDG------------SMLVAGNNKGNCYVWQMPHQTD 193
                    + +  TP ++   A                ++V  ++    Y+W     T 
Sbjct: 334 LRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKST- 392

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
               KP+T+   H K +  V  S D +H+ + S D++ ++W+  D  +  +T   H   V
Sbjct: 393 ----KPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDG-KFISTFRGHVASV 447

Query: 254 WDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +  A+S+D   LV+   D  +++WD+ T+++     GH
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGH 485

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 111/282 (39%), Gaps = 67/282 (23%)

Query: 4   ILASAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L S  +D TIR W+  L G C   ++     VN L +S+D           +R+     
Sbjct: 291 VLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTD---------YALRIGAFDH 341

Query: 63  TNPNPVTSFEGHR---GNVTSIAFQ--QENKWMVSSSEDGTIKVWDVRAPS--VQRNYKH 115
           T+  P T  E  +    N   IA +  +  + MV++S+D T+ +W+    +  + R   H
Sbjct: 342 TSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGH 401

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLV 175
           Q  VN V   P+   ++S   D ++++W+                         DG    
Sbjct: 402 QKLVNHVAFSPDGRHIVSASFDNSIKLWN-----------------------GRDG---- 434

Query: 176 AGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
                                 K ++ FR H   + +V  SSD + L +CS D T +VW 
Sbjct: 435 ----------------------KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           +    +L   L  H+  V+   +S D   + +   D  VRLW
Sbjct: 473 VKTK-KLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 54/134 (40%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S ++ G       +W    QT      P++  + H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMITGAGDNTARIWDCNTQT------PMSTLKGHFNWVLCVSWSPDGELIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLVTACSDHYVRLWDLSTREI 284
           R+W  +    +   L  H +W+   ++             L +A  D  +++WD + R  
Sbjct: 211 RLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     C+
Sbjct: 271 LITLSGHTSSVSCI 284

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 136/338 (40%), Gaps = 60/338 (17%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T++   + V  +  S D   +A     N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
                 +  GH   +TS++++            + SSS+DGTIK+WD  +   Q      
Sbjct: 219 E-CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGH 277

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQL--------------------- 154
                 V    QG L S   D  VR+WD+  + +C++ L                     
Sbjct: 278 TNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVG 337

Query: 155 ----------APEDDTPLQSLSVAS----------DGSMLVAGNNKGNCYVWQMPHQTDA 194
                     +PED    Q  ++A+             M+V  ++    ++W     T  
Sbjct: 338 AFDHTGQKPTSPED---AQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKST-- 392

Query: 195 ANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVW 254
              KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+
Sbjct: 393 ---KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVY 448

Query: 255 DCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
             A+S+D   LV+   D  +++WD+ T ++     GH 
Sbjct: 449 QVAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLPGHQ 486

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 64/325 (19%), Positives = 130/325 (40%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQ---------VNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W+  TG C        S+         ++ ++  S  R  +++    
Sbjct: 200 VIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGT 259

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV---------- 104
           ++++D  T +     +  GH  +V+ + +  +   + S S D T++VWD+          
Sbjct: 260 IKIWD--TVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDMNSQGRCINIL 316

Query: 105 ---------------------------RAPSVQRNYKHQAAVNEVVIHPNQGE----LIS 133
                                      + P+   + + +A  N   I    G     +++
Sbjct: 317 KSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKNGNSEEMMVT 376

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L   + + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 377 ASDDFTIFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASFDNSIKLW------ 429

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D  + K ++ FR H   + +V  SSD + L +CS D T +VW +    +L   L  HQ  
Sbjct: 430 DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTG-KLSVDLPGHQDE 488

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  VRLW
Sbjct: 489 VYTVDWSVDGKRVCSGGRDKMVRLW 513

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+   + H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLVTACSDHYVRLWDLSTREI 284
           R+W       L   L  H +W+   ++             L ++  D  +++WD  +R  
Sbjct: 211 RLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE------TTLDNHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    F+++      + +  H   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGHNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT   D+  R+WD  T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVA 193

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 124/283 (43%), Gaps = 30/283 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLY------------------ 58
           AL  VC  T Q+++  ++ L+ S D R +AAAG  +  ++++                  
Sbjct: 451 ALPSVCMYTFQNTNKDMSCLDFSDDCR-IAAAGFQDSYIKIWSLDGSSLNNPNIMPNINN 509

Query: 59  -DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQ 116
            D +  +     +  GH G V + +F  +NK+++S SED T+++W +   +   +YK H 
Sbjct: 510 SDHKDADDPTCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVA 176
             V +V   P      +   D   R+W       +   A   +  +  +S   +G  +  
Sbjct: 570 HPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYVFT 628

Query: 177 GNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
           G++   C +W      D +    V  F  H   +  + +S D + L+T S D    +W I
Sbjct: 629 GSSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDI 682

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
               +L+    + +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 683 GTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 97/219 (44%), Gaps = 5/219 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  +  S    + A A H    RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WDV    SV+    H A V  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 659

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + IWD+G  + + Q+       + SLS + +G++L++G    +
Sbjct: 660 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
             VW +   T   + +P   F  +   +T   ++ D+K 
Sbjct: 720 VRVWDLKKATTEPSAEPEEPFIGYLGDVT-ASINQDIKE 757

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 61/135 (45%), Gaps = 7/135 (5%)

Query: 166 SVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATC 225
           S + D   L++G+      +W M   T       +  ++ H   +  V  S    + AT 
Sbjct: 534 SFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 226 SADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV 285
           S D TAR+WS D  + L      H   V   +F  +  Y+ T  SD   R+WD+ST + V
Sbjct: 588 SHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSV 646

Query: 286 RQYGGHHKGAICVAL 300
           R + GH    IC+A+
Sbjct: 647 RLFLGHTAPVICIAV 661

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 145/335 (43%), Gaps = 56/335 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +    +   +A     N +RL+D +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRNYKH 115
            P    +  GH   +TS+A++        E+  + S+S+DGTI++WD+ R   +     H
Sbjct: 219 KPLG-DALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGH 277

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVH---------------------- 152
             +V+  +    QG + S   D  VR+WD+  + +C++                      
Sbjct: 278 TNSVS-CIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRV 336

Query: 153 --------QLAPEDDTPLQSLS-----VASDGSM---LVAGNNKGNCYVWQMPHQTDAAN 196
                   Q A   D   ++L+     V  +G +   +V  ++    ++W  P +++   
Sbjct: 337 GAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWN-PLKSN--- 392

Query: 197 PKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V+  
Sbjct: 393 -KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           A+SAD   LV+   D  +++WD+ TR++     GH
Sbjct: 451 AWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 132/325 (40%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWE---------ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W+         AL G        +   ++ ++     R  +A+    
Sbjct: 200 VIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGT 259

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------- 106
           +R++DI  T    + +  GH  +V+ I +  +   + S S D T++VWD+ A        
Sbjct: 260 IRIWDI--TRRVCLYTMSGHTNSVSCIKWSGQGI-IYSGSHDKTVRVWDMNADGKCINIL 316

Query: 107 -----------------------------PSVQRNYKHQAAVNEVVIHPNQGEL----IS 133
                                        P+  ++ + +A  N   +    G+L    ++
Sbjct: 317 KSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVT 376

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L  N+ + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 377 ASDDFTMFLWNPLKSNKPIARMTGHQKL-VNHVAFSPDGRYIVSASFDNSIKLW------ 429

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D  + K ++ FR H   + +V  S+D + L +CS D T +VW +    +L   L  H+  
Sbjct: 430 DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR-KLSVDLPGHKDE 488

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  VR+W
Sbjct: 489 VYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 59/152 (38%), Gaps = 13/152 (8%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S    +  S +V G       +W    QT      P      H  ++  V
Sbjct: 139 IAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQT------PKATLTGHFNWVLCV 192

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLV 266
               + + +AT S D+T R+W   D   L   L  H +W+   A+         +S  L 
Sbjct: 193 SYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLA 252

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           +A  D  +R+WD++ R  +    GH     C+
Sbjct: 253 SASKDGTIRIWDITRRVCLYTMSGHTNSVSCI 284

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 135/298 (45%), Gaps = 32/298 (10%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +  +  V    +++D  + L+A+    +R
Sbjct: 31  LLVSASRDKTLISWK-LTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+++ T        F GH+ +V S+A  ++   ++S S D TIKVW ++   +     H 
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDCLATLLGHN 147

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+ +      LIS   D  V+ W++ + Q        ++  + S++ + D
Sbjct: 148 DWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNY-INSITASPD 206

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           GS++ +    G+  +W +  +T      P+    +  +     L  S  ++  T +    
Sbjct: 207 GSLVASAGKDGDIMLWNLKQKT------PLYTLSAQDEVF--ALAFSPNRYWLTAATATG 258

Query: 231 ARVWSIDDNF---QLETTLDNHQRWVWDCA----FSADSAYLVTACSDHYVRLWDLST 281
            +V+S++D     +L+     + +     A    +SAD   L    +D  +R+W + T
Sbjct: 259 IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRVWQVMT 316

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 98/226 (43%), Gaps = 22/226 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   +VS+S D T+  W +     Q     R++K H   V + 
Sbjct: 11  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDC 70

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+W++   +   +      + + S+++    SM+++G+    
Sbjct: 71  ALTADGAYALSASWDKTLRLWNVATGETYQRFTGHK-SDVMSVAIDRKASMIISGSRDKT 129

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +           +     H  ++++V ++ + K       L +  +D   + W+I
Sbjct: 130 IKVWSIKGDC-------LATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNI 182

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           +  FQ+E     H  ++     S D + + +A  D  + LW+L  +
Sbjct: 183 N-QFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQK 227

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHL-ATCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  + +   +   H   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCA 71

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 116/261 (44%), Gaps = 35/261 (13%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYKHQAAV 119
           P  V  +EGH+  + ++   ++  W+ ++S+D T  +W  ++ S +     +   H +AV
Sbjct: 369 PIDVELYEGHKDLLNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAV 428

Query: 120 NEV----VIHPNQGELI-SCDQDGNVRIWDLG---------ENQCVH-----QLAPEDDT 160
             V    ++H    E I +   D  V+ W +          E Q V      + A E D 
Sbjct: 429 TAVGLPNIMHKGWPEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKD- 487

Query: 161 PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVK 220
            + +LSVA + S     +    C VW      D  + +      +H + +  V      +
Sbjct: 488 -INALSVAPNDSTFATASYDKTCKVW------DLESGEVKATLANHRRGLWDVAFCQYER 540

Query: 221 HLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280
            +ATCS D T ++WS+D  F +  T + H   V  C+F      LV++ +D  V++WD S
Sbjct: 541 LIATCSGDKTIKIWSLD-TFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCS 599

Query: 281 TREIVRQYGGHHKG--AICVA 299
           T E V+   GH     A+CVA
Sbjct: 600 TGECVKTLDGHTNRIWALCVA 620

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 106/276 (38%), Gaps = 30/276 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRLYDIRTTNPN---PVTSFEGHRGNVTSIAF-----QQE 86
           +N ++ + D  +LA A   +  +     +N N   P   FEGH   VT++       +  
Sbjct: 382 LNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGW 441

Query: 87  NKWMVSSSEDGTIKVWDVRAP--------------SVQRNYKHQAAVNEVVIHPNQGELI 132
            ++++++S D T+K W V  P              S      H+  +N + + PN     
Sbjct: 442 PEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFA 501

Query: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
           +   D   ++WDL   +    LA      L  ++      ++   +      +W +   T
Sbjct: 502 TASYDKTCKVWDLESGEVKATLA-NHRRGLWDVAFCQYERLIATCSGDKTIKIWSL--DT 558

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
            A     V  F  H   + R    +    L + SAD   ++W      +   TLD H   
Sbjct: 559 FAV----VKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG-ECVKTLDGHTNR 613

Query: 253 VWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
           +W    + D   +V+A +D   + W  ST +  +Q+
Sbjct: 614 IWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 4/141 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAA-AGHLNVRLYDIRTT 63
            A+A YD T + W+  +G    T+ +    +  +     +R +A  +G   ++++ + T 
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
               V +FEGH   V   +F  +   +VSSS DG +K+WD       +    H   +  +
Sbjct: 560 --AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWAL 617

Query: 123 VIHPNQGELISCDQDGNVRIW 143
            +  +   ++S D DG  + W
Sbjct: 618 CVAEDGDLIVSADADGVFQFW 638

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 10/133 (7%)

Query: 27  TIQHSDSQ-VNRLEISSDKRFLAAAGHLNV-RLYDIRTTNPNPVTSFEGHRGNVTSIAFQ 84
           TI++ D Q +  L++++D R+L  A    + +++D+R                V S    
Sbjct: 54  TIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDS---D 110

Query: 85  QENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQ-GE---LISCDQDGN 139
             +  +     DG+I V DV    V  + K H   ++ V  +  Q GE   L S D +G 
Sbjct: 111 STSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGM 170

Query: 140 VRIWDLGENQCVH 152
           V+IWDL + +C+H
Sbjct: 171 VKIWDLVKRKCIH 183

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
           ++A+   D TI+ W   T    +T +   + V R   I+   + ++++    V+++D  T
Sbjct: 541 LIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCST 600

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW 102
                V + +GH   + ++   ++   +VS+  DG  + W
Sbjct: 601 --GECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFW 638

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 132/336 (39%), Gaps = 80/336 (23%)

Query: 6   ASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNP 65
           A AG+  TI        +CS+   H+ S           R +  AG    R++D  T  P
Sbjct: 138 AIAGHGATI--------LCSQFAPHTSS-----------RMVTGAGDNTARVWDCDTQTP 178

Query: 66  NPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA--PSVQRNYKHQAAVNEVV 123
             + +  GH+  V  +A+  + + + + S D T+++WD +A  P       HQ  +  +V
Sbjct: 179 --MATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLV 236

Query: 124 IHP-------NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDG--SML 174
             P       ++  L S  +DG ++IWD     C++ L+   +    S+S    G   +L
Sbjct: 237 WEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTN----SVSCVKWGGQGLL 292

Query: 175 VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV--------------- 219
            +G++     VW M         K +   +SHA ++  + LS++                
Sbjct: 293 YSGSHDKTVRVWDM-----NVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFT 347

Query: 220 ------------------------KHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255
                                   + + T S D T  +W    + +    L  HQ+ V  
Sbjct: 348 SAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNH 407

Query: 256 CAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
            AFS D  ++V+A  D+ ++LWD      +  + GH
Sbjct: 408 VAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFRGH 443

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 137/335 (40%), Gaps = 56/335 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           + +   D+T R W+  T     T+    + V  +  S D   +A       VRL+D +  
Sbjct: 159 MVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRNYKH 115
            P    + +GH+  +TS+ ++        +   + S+S+DGTIK+WD  R   +     H
Sbjct: 219 QPLG-DALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGH 277

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLG-ENQCVH--------------------QL 154
             +V+  V    QG L S   D  VR+WD+    +C++                    ++
Sbjct: 278 TNSVS-CVKWGGQGLLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRV 336

Query: 155 APEDDTPLQSLSV------------------ASDGSMLVAGNNKGNCYVWQMPHQTDAAN 196
            P D T  +  S                        ++V  ++    ++W  P ++    
Sbjct: 337 GPFDHTATKFTSAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWD-PTKSG--- 392

Query: 197 PKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+ +   H K +  V  S D + + + S D++ ++W    N    +T   H   V+  
Sbjct: 393 -KPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWD-GRNGTFISTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           A+S+D   LV+   D  +++WD+ TR++     GH
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/277 (20%), Positives = 109/277 (39%), Gaps = 18/277 (6%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTN 64
           LASA  D TI+ W+    VC  T+    + V+ ++        + +    VR++D+    
Sbjct: 251 LASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGLLYSGSHDKTVRVWDMNVGG 310

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124
              +   + H   V  ++   E    V   +    K       +     + +A  N   I
Sbjct: 311 -KCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKF------TSAEEARKKALENYEKI 363

Query: 125 HPNQGE----LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
               G+    +++   D  + +WD  ++             +  ++ + DG  +V+ +  
Sbjct: 364 AKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFD 423

Query: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
            +  +W      D  N   ++ FR H   + +V  SSD + L +CS D T +VW +    
Sbjct: 424 NSIKLW------DGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR- 476

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           +L   L  H+  V+   +S D   + +   D  VRLW
Sbjct: 477 KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 72/143 (50%), Gaps = 5/143 (3%)

Query: 4   ILASAGYDHTIRFWEAL-TGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIR 61
           ++ +A  D T+  W+   +G     +      VN +  S D RF+ +A   N ++L+D R
Sbjct: 373 LIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDGR 432

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVN 120
             N   +++F GH  +V  +A+  + + +VS S+D T+KVWDVR   +  +   H+  V 
Sbjct: 433 --NGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVY 490

Query: 121 EVVIHPNQGELISCDQDGNVRIW 143
            V    +   + S  +D  VR+W
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 94/225 (41%), Gaps = 44/225 (19%)

Query: 4   ILASAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEISSD------------------- 43
           +L S  +D T+R W+  + G C   ++     VN L +S++                   
Sbjct: 291 LLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAE 350

Query: 44  --------------KR-------FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIA 82
                         KR        + A+    + L+D  T +  P+    GH+  V  +A
Sbjct: 351 EARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWD-PTKSGKPLARLTGHQKLVNHVA 409

Query: 83  FQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVR 141
           F  + +++VS+S D +IK+WD R  +    ++ H A+V +V    +   L+SC +D  ++
Sbjct: 410 FSPDGRFIVSASFDNSIKLWDGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLK 469

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +WD+   +    L    D  + ++  + DG  + +G       +W
Sbjct: 470 VWDVRTRKLSVDLPGHKDE-VYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 52/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       VW    QT      P+     H  ++  V  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARVWDCDTQT------PMATLSGHQNWVLCVAWSPDGETIATGSMDCTV 210

Query: 232 RVWSIDDNFQLETTLDNHQRW----VWD---CAFSADSAYLVTACSDHYVRLWDLSTREI 284
           R+W       L   L  HQ+W    VW+        D   L +A  D  +++WD S R  
Sbjct: 211 RLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 IYTLSGHTNSVSCV 284

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD  T+  +    GH    +CVA
Sbjct: 156 SSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVA 193

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 113/244 (46%), Gaps = 33/244 (13%)

Query: 67  PVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIH 125
           PV SF+GH   V       + K+ +S+S D T+++WD+++   ++R   H++ V  V I 
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSID 132

Query: 126 PNQGELISCDQDGNVRIWD---------LGENQCVH--QLAPEDDTPLQSLSVASDGSML 174
           P   +++S  +D  V++W+         LG N  V   ++AP +         + D   +
Sbjct: 133 PRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEK--------SDDAVTV 184

Query: 175 VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
           ++        VW +   T  A+      F  H  Y+T V  S D    A+   D    +W
Sbjct: 185 ISAGMDKVVKVWDLQSFTIEAD------FIGHNNYVTTVTPSPDGSIFASAGKDGQIILW 238

Query: 235 SIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV----RQYGG 290
           ++++   L  TLD     V+  AFS +  Y +TA +   ++++DL  R IV     ++ G
Sbjct: 239 NLNEKTALY-TLDAKDE-VFAVAFSPNR-YWLTAATASGIKIFDLEERTIVDDLKPEFAG 295

Query: 291 HHKG 294
           ++K 
Sbjct: 296 YNKA 299

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 128/307 (41%), Gaps = 51/307 (16%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L S   D T+  W+ LTG      V  R+ +     V    ++ D ++ L+A+    +R
Sbjct: 48  MLLSGSRDKTLITWK-LTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLR 106

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+++     +  F GH+ +V S++       +VS+S D T+KVW+     V     H 
Sbjct: 107 LWDLQS--GKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHN 164

Query: 117 AAVNEVVIHPNQGE-----LISCDQDGNVRIWDL----------GENQCVHQLAPEDDTP 161
             V+ V I P++       +IS   D  V++WDL          G N  V  + P     
Sbjct: 165 DWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTP----- 219

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQT-----DAANPKPVTKFRSHAKYITRVLLS 216
                 + DGS+  +    G   +W +  +T     DA +      F  +  ++T    +
Sbjct: 220 ------SPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAFSPNRYWLTAA-TA 272

Query: 217 SDVKHLATCSADHTARVWSIDDNFQLETTLDNHQR--WVWDCAFSADSAYLVTACSDHYV 274
           S +K       D   R  +I D+ + E    N  +       A+SAD   L    +D+ +
Sbjct: 273 SGIKIF-----DLEER--TIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNII 325

Query: 275 RLWDLST 281
           R+W + T
Sbjct: 326 RVWQVMT 332

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 69/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIR 61
           +V + SAG D  ++ W+                +    I +D                  
Sbjct: 181 AVTVISAGMDKVVKVWD----------------LQSFTIEAD------------------ 206

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNE 121
                    F GH   VT++    +     S+ +DG I +W++   +       +  V  
Sbjct: 207 ---------FIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFA 257

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPE-------DDTPLQSLSVASDGSML 174
           V   PN+  L +    G ++I+DL E   V  L PE        D    SL+ ++DG  L
Sbjct: 258 VAFSPNRYWLTAATASG-IKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTL 316

Query: 175 VAGNNKGNCYVWQM 188
            AG       VWQ+
Sbjct: 317 FAGYTDNIIRVWQV 330

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 222 LATCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           L + S D T   W +   D  + +   +   H   V DC  + D  Y ++A  D  +RLW
Sbjct: 49  LLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLW 108

Query: 278 DLSTREIVRQYGGHHKGAICVALN 301
           DL + + ++++ GH    + V+++
Sbjct: 109 DLQSGKCIKRFVGHKSDVMSVSID 132

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 125/295 (42%), Gaps = 57/295 (19%)

Query: 45  RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104
           R +  +G  N R++D  T  P  + + +GH   V  +A+  + + + + S D TI++WD 
Sbjct: 185 RMVTGSGDNNARIWDCDTQTP--IYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDA 242

Query: 105 -----RAPSVQRNYKHQAAVNEVVIH----PNQGELISCDQDGNVRIWDLGENQCVHQLA 155
                +  +++ + K   +++   IH     N+  + S  +DG +++WD    QC+  L+
Sbjct: 243 QTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLS 302

Query: 156 PEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL 215
               + +  +     G ++  G++      W M      A  K +   +SHA ++  + L
Sbjct: 303 GHTSS-VSCIKWGGQG-VIYTGSHDRTIRCWDM-----NAGGKCINILKSHAHWVNHLSL 355

Query: 216 SSDV---------------------------------------KHLATCSADHTARVWSI 236
           S+D                                        + +AT S D T  +W+ 
Sbjct: 356 STDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNP 415

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
               +  T +  HQ+ V   AFS D  Y+V+A  D+ ++LW+ S+ + +  + GH
Sbjct: 416 LKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGH 470

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/336 (22%), Positives = 144/336 (42%), Gaps = 56/336 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+  R W+  T     T++   + V  +  S+D   +A     N +RL+D +T 
Sbjct: 186 MVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTG 245

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWD-VRAPSVQRNYKH 115
           +     +  GH   +TS++++            + S+S+DGTIKVWD VR   +     H
Sbjct: 246 DSKG-DALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGH 304

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQLAPEDDTPLQSLSVASDGSML 174
            ++V+  +    QG + +   D  +R WD+    +C++ L       +  LS+++D ++ 
Sbjct: 305 TSSVS-CIKWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHW-VNHLSLSTDYALK 362

Query: 175 VAGNNKGNCYVWQMPHQTDAA----------------------------------NP--- 197
           V   +    + +  P   + A                                  NP   
Sbjct: 363 VGAFD----HTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKG 418

Query: 198 -KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDC 256
            KP+T+   H K +  V  S D +++ + S D++ ++W    + +  +T   H   V+  
Sbjct: 419 TKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWE-GSSGKFISTFRGHVASVYQV 477

Query: 257 AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+   D  +++WD+ TR++     GH+
Sbjct: 478 AWSSDCRLLVSCSKDTTLKVWDVRTRKLAVDLPGHN 513

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/325 (20%), Positives = 129/325 (39%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQ---------VNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W+A TG          S+         ++ +   +  R  +A+    
Sbjct: 227 VIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGT 286

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------- 106
           ++++D  T     + +  GH  +V+ I +  +   + + S D TI+ WD+ A        
Sbjct: 287 IKVWD--TVRRQCILTLSGHTSSVSCIKWGGQGV-IYTGSHDRTIRCWDMNAGGKCINIL 343

Query: 107 -----------------------------PSVQRNYKHQAAVNEVVIHPNQG---ELI-S 133
                                        P+     + +A  N   +    G   ELI +
Sbjct: 344 KSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIAT 403

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L   + + ++       +  ++ + DG  +V+ +   +  +W+     
Sbjct: 404 ASDDFTMYLWNPLKGTKPLTRMTGHQKL-VNHVAFSPDGRYIVSASFDNSIKLWE----- 457

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
             ++ K ++ FR H   + +V  SSD + L +CS D T +VW +    +L   L  H   
Sbjct: 458 -GSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR-KLAVDLPGHNDE 515

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +SAD   + +   D  VRLW
Sbjct: 516 VYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 62/154 (40%), Gaps = 17/154 (11%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S       S +V G+   N  +W    QT      P+   + H  ++  V
Sbjct: 166 IAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQT------PIYTLKGHTNWVLCV 219

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVT------ 267
             S+D + +AT S D+T R+W           L  H +W+   + S +  +LVT      
Sbjct: 220 AWSADGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWI--TSMSWEPIHLVTPGNKPR 277

Query: 268 ---ACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
              A  D  +++WD   R+ +    GH     C+
Sbjct: 278 IASASKDGTIKVWDTVRRQCILTLSGHTSSVSCI 311

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD  T+  +    GH    +CVA
Sbjct: 183 SSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVA 220

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 111/266 (41%), Gaps = 46/266 (17%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAFQQEN---- 87
           +N L+ + D  +LA A   N  +   YD +T        F GH G VT++          
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNVMNRPW 482

Query: 88  -KWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG 146
            ++++S+S D TIK W V  P   ++  H    +E                         
Sbjct: 483 PEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYT----------------------- 519

Query: 147 ENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSH 206
                 + A E D  + +L+V+ + S+    +    C +W +      A         +H
Sbjct: 520 ------RRAHEKD--INALAVSPNDSVFATASYDKTCKIWSLDTGELEAT------LANH 565

Query: 207 AKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLV 266
            + +  V      K LATCS D T ++WS+D  + +  TL+ H   V  C+F + +  LV
Sbjct: 566 KRGLWDVNFCQYDKLLATCSGDKTVKIWSLD-TYSVMKTLEGHTNAVQRCSFISKNKQLV 624

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHH 292
           ++ +D  V+LWD ST E V+    H+
Sbjct: 625 SSGADGLVKLWDCSTGECVKTLDAHN 650

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAA-AGHLNVRLYDIRT 62
           + A+A YD T + W   TG    T+ +    +  +      + LA  +G   V+++ + T
Sbjct: 538 VFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDT 597

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNE 121
              + + + EGH   V   +F  +NK +VSS  DG +K+WD       +    H   +  
Sbjct: 598 Y--SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWA 655

Query: 122 VVIHPNQGELISCDQDGNVRIW 143
           + +  +   +++ D DG  + W
Sbjct: 656 LSVLKDGDIIVTADADGVFQFW 677

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 59/148 (39%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV-- 219
           L SL    DG  L   +      +W+   QT+    K   KF  HA  +T V L + +  
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTELF--KQYAKFVGHAGPVTAVGLPNVMNR 480

Query: 220 ---KHLATCSADHTARVWSI------DDNFQL----ETTLDNHQRWVWDCAFSADSAYLV 266
              + L + S D T + W++       D   +    E T   H++ +   A S + +   
Sbjct: 481 PWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKG 294
           TA  D   ++W L T E+      H +G
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRG 568

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 24/139 (17%)

Query: 28  IQHSDSQ-VNRLEISSDKRFLAAAGHLNV-RLYDIRTTN-------PNPVTSFEGHRGNV 78
           I++ D Q +  L I+ D +FL       + R+Y + +          +PV   E    +V
Sbjct: 75  IENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSSPVYVMEC---DV 131

Query: 79  TSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIH----PNQGELIS 133
           TS         +     DG++ + D+    V  ++K H   ++ V  H     N   L S
Sbjct: 132 TS-------TLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLAS 184

Query: 134 CDQDGNVRIWDLGENQCVH 152
            D  G V+IWDL + +C+H
Sbjct: 185 GDTTGVVKIWDLVKRKCLH 203

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 10/107 (9%)

Query: 47  LAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE---NKWMVSSSE-DGTIKVW 102
           L A G  +  +  I   N     SF+GH G ++S+ F  E   N W ++S +  G +K+W
Sbjct: 135 LLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIW 194

Query: 103 D-VRAPSVQRNYKHQAAVNEVVIH-----PNQGELISCDQDGNVRIW 143
           D V+   +    +H  AV  +         +Q +LIS  +D  + ++
Sbjct: 195 DLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLY 241

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 120/285 (42%), Gaps = 35/285 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT-------------- 63
           AL  VC  T  +++  +  L+ S D R +AA    + ++L+ +  +              
Sbjct: 474 ALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSIN 533

Query: 64  ----NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAA 118
               N N  T+  GH G V S +F  +N++++S SED T+++W     +   +YK H   
Sbjct: 534 TGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHP 593

Query: 119 VNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH----QLAPEDDTPLQSLSVASDGSML 174
           V +V   P      +   D   R+W      C H    ++     + +  +S   +G  +
Sbjct: 594 VWDVQFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDCVSFHPNGCYV 648

Query: 175 VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
             G++   C +W      D +    V  F  H   +    +S D + LAT S D    +W
Sbjct: 649 FTGSSDKTCRMW------DISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 235 SIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            I    +L+    + +  +   ++  +   LV+  +DH VR+WDL
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 99/232 (42%), Gaps = 31/232 (13%)

Query: 70  SFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA-AVNEVVIHPNQ 128
           +F    G +TS+ F ++++ + +  +D  IK+W +   S+++  +  A ++N        
Sbjct: 482 TFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSIN-------- 533

Query: 129 GELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188
               + D + N     +G +  V+           S S + D   L++G+      +W  
Sbjct: 534 ----TGDMNDNTSTTLIGHSGAVY-----------STSFSPDNRYLLSGSEDKTVRLWST 578

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
              T       +  ++ H   +  V  S    + AT S D TAR+WS D  + L      
Sbjct: 579 DTYTS------LVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRI-FAG 631

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           H   V   +F  +  Y+ T  SD   R+WD+ST + VR + GH    +C A+
Sbjct: 632 HLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 96/221 (43%), Gaps = 5/221 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L S   D T+R W   T     + +  +  V  ++ S    + A A H    RL+     
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHI 623

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V  ++F     ++ + S D T ++WD+    SV+    H A V   
Sbjct: 624 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCT 681

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + +  +       + SLS   +G++LV+G    +
Sbjct: 682 AVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHS 741

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
             VW +   T    P+P  +F  +   +T   ++ D+K   
Sbjct: 742 VRVWDLKKSTAEPGPEPEEQFVGYIGNLT-ASINQDIKDFG 781

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 104/239 (43%), Gaps = 21/239 (8%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 430 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSG 489

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 490 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PEDGKYIAAGSLDRAVRVWDSETGFLVER 548

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD--NFQL------- 242
            D+ N         H   +  V+ + D  ++ + S D + ++W+++D  N  L       
Sbjct: 549 LDSEN----ELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGT 604

Query: 243 -ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            E T   H+ +V   A +    Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 605 CEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 663

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D  V  + +S +     AAG L+  VR++D  T
Sbjct: 484 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPEDGKYIAAGSLDRAVRVWDSET 542

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++
Sbjct: 543 GFLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 589

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD++ ++I+    GH +
Sbjct: 429 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQ 470

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 139/332 (41%), Gaps = 48/332 (14%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + + G D+T R W+  T     T+    + V  +  S+D   +A     N +RL+D  + 
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESG 220

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRNYKH 115
            P    +  GH   +TS+ ++            + S+S+DGTI++WD  R   +     H
Sbjct: 221 KPLG-DALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGH 279

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN-QCVHQLAPEDDTPLQSLSVASDGSML 174
             +V+  V    +G L S   D  VR WD+ +N +C++ L       +  LS+++D ++ 
Sbjct: 280 TNSVS-CVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHW-VNHLSLSTDYALR 337

Query: 175 VAGNNKGNCYVWQMPHQTDAA------------------------------NP----KPV 200
           V   +             D A                              NP    KP+
Sbjct: 338 VGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPI 397

Query: 201 TKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA 260
           ++   H K +  V  S D K++ + S D++ ++W   +   L +T   H   V+  A+S+
Sbjct: 398 SRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFL-STFRGHVASVYQVAWSS 456

Query: 261 DSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           D   LV+   D  +++WD+ TR++     GH 
Sbjct: 457 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 488

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 109/280 (38%), Gaps = 63/280 (22%)

Query: 4   ILASAGYDHTIRFWEAL-TGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           IL S  +D T+R W+    G C   ++     VN L +S+D         L V  +D   
Sbjct: 293 ILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYA-------LRVGAFDYTG 345

Query: 63  TNP-NPVTSFEGHRGNVTSIAFQ--QENKWMVSSSEDGTIKVWDVRAPS--VQRNYKHQA 117
             P N   + +    N   +A +  +  + MV++S+D T+ +W+    +  + R   HQ 
Sbjct: 346 VKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQK 405

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            VN V   P+   ++S   D ++++WD                         +G+ L   
Sbjct: 406 LVNHVAFSPDGKYIVSASFDNSIKLWD-----------------------GKEGTFL--- 439

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
                                  + FR H   + +V  SSD + L +CS D T +VW + 
Sbjct: 440 -----------------------STFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 476

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              +L   L  HQ  V+   +S D   + +   D  +RLW
Sbjct: 477 TR-KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 53/134 (39%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P      H  ++  V  S+D + +AT S D+T 
Sbjct: 159 SRVVTGGGDNTARIWDCDTQT------PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTI 212

Query: 232 RVWSIDDNFQLETTLDNHQRWV----WD---CAFSADSAYLVTACSDHYVRLWDLSTREI 284
           R+W  +    L   L  H +W+    W+            L +A  D  +R+WD S R  
Sbjct: 213 RLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVC 272

Query: 285 VRQYGGHHKGAICV 298
           +   GGH     CV
Sbjct: 273 LMTLGGHTNSVSCV 286

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 126/286 (44%), Gaps = 38/286 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLY------------------ 58
           AL  VC  T  +++  +  LE S D R LAAAG  +  ++L+                  
Sbjct: 469 ALPTVCMYTFHNTNRDMTSLEFSDDSR-LAAAGFQDSYIKLWSLDGSSLISNKIPSYKRK 527

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQA 117
           ++ TT+P   ++  GH G+V S +F  ++++++S SED T+++W +   +   +YK H  
Sbjct: 528 EMETTDPA-TSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNH 586

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH----QLAPEDDTPLQSLSVASDGSM 173
            V +V   P      +   D   R+W      C H    ++     + + ++S   +G  
Sbjct: 587 PVWDVKFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDTVSFHPNGCY 641

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           +  G++   C +W      D +    V  F  H   I   +++ D + L T S D    +
Sbjct: 642 VFTGSSDKTCRMW------DISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINL 695

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           W I    +++    + +  V     + +   L++  +DH VR+WDL
Sbjct: 696 WDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 101/224 (45%), Gaps = 5/224 (2%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDI 60
           S  L S   D T+R W   T     + +  +  V  ++ S    + A A H    RL+  
Sbjct: 555 SRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSC 614

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAV 119
              +  P+  F GH  +V +++F     ++ + S D T ++WD+    SV+  + H A +
Sbjct: 615 --DHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPI 672

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN 179
              V+ P+   L +   DG + +WD+G  + + Q+       + SL++  +G++L++G  
Sbjct: 673 LSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGA 732

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
             +  VW +   T+    +P   F  H   +T   ++ DVK   
Sbjct: 733 DHSVRVWDLKKATNEPGLEPEQPFIGHIGDVT-ASINQDVKDFG 775

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 18/108 (16%)

Query: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF------------QLETT----- 245
           F +  + +T +  S D +  A    D   ++WS+D +             ++ETT     
Sbjct: 478 FHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATS 537

Query: 246 -LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
            L  H   V+  +FS DS +L++   D  VRLW L T   +  Y GH+
Sbjct: 538 TLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHN 585

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 137/301 (45%), Gaps = 38/301 (12%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V  + ++ D  + L+A+    +R
Sbjct: 32  LLVSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+G+V S+A  ++   ++S S D +IKVW ++   +     H 
Sbjct: 91  LWDVATGET--YQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + P + E      +IS   D  V+ W+L + Q         +  + +++ + D
Sbjct: 149 DWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQIEADFVGH-NANVNTITASPD 207

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ + +  G   +W + ++T      P+    +  + +  V  S +   LA  +A   
Sbjct: 208 GTLIASADKSGEIMLWNLHNKT------PMYTLNAQDE-VFAVAFSPNRYWLAAATASGI 260

Query: 231 ARVWSID-----DNFQLE-----TTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280
            +++S+D     D+ + E        D H       A+SAD   L    +D+ +R+W + 
Sbjct: 261 -KIFSLDPEALIDDLRPEFVGYNKAADPHAI---SLAWSADGQTLFAGYTDNVIRVWQVM 316

Query: 281 T 281
           T
Sbjct: 317 T 317

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 95/223 (42%), Gaps = 22/223 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   +VS+S D T+  W +     +     R++K H   V +V
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDV 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+    +S   D  +R+WD+   +   +        + S+++    SM+++G+   +
Sbjct: 72  TLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGD-VMSVAIDRKASMIISGSRDKS 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS------DVKHLATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V ++       D   + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +  FQ+E     H   V     S D   + +A     + LW+L
Sbjct: 184 N-QFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNL 225

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHL-ATCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  F +   +   H   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            + D AY ++A  D  +RLWD++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAID 116

>NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa]
           {ON} Anc_7.231
          Length = 608

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 126/299 (42%), Gaps = 30/299 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD T+  W+  +    R +      V  L    + + +  +    +R+++ +T 
Sbjct: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD-EAKLVTGSLDKTIRVWNYKTG 323

Query: 64  NPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
               ++++ GH  +V S+ AF+   K +VS S D T+K+W V + +      H   VN V
Sbjct: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAG 177
            +HP      S   D  +R+WD+  N C+     H    +   PL  +   +     ++G
Sbjct: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438

Query: 178 NNKGN------CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           +N+G+                 A N +          Y T         HL +CS D+T 
Sbjct: 439 SNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPT---------HLLSCSLDNTI 489

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
           ++W +     + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 490 KLWDVQTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 15/183 (8%)

Query: 109 VQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA 168
           VQ    H   V  + +  N   L +   D  V IWDL  N+ + +L+   D  +++L   
Sbjct: 246 VQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG-VKTLYF- 301

Query: 169 SDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
            D + LV G+      VW      +    + ++ +R H   +  V   +  K + + SAD
Sbjct: 302 -DEAKLVTGSLDKTIRVW------NYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSAD 352

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
            T ++W ++   +   TL  H  WV        S    +   D  +R+WD+ T   ++ +
Sbjct: 353 KTVKIWHVES--RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410

Query: 289 GGH 291
            GH
Sbjct: 411 RGH 413

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259
           V +F+ H   +  + L  + + L T S D T  +W +  N +L   L  H   V    F 
Sbjct: 246 VQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSN-KLIRRLSGHTDGVKTLYF- 301

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D A LVT   D  +R+W+  T E +  Y GH    + V
Sbjct: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 113/254 (44%), Gaps = 29/254 (11%)

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-----RNY 113
           DI+   P  V  +EGH   + S+   +  +W+ + S+D T+ +W + A S +     R  
Sbjct: 384 DIQNCLPLEVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFT 443

Query: 114 KHQAAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQC----VHQLAPEDDT--- 160
            H   V  V + PN         +I+   D  ++ W + +       +H +   D T   
Sbjct: 444 GHAGPVTAVGL-PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRA 502

Query: 161 ---PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS 217
               + +LS++ + S+    +    C +W +    D+   +      +H + +  V    
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIWNV----DSGELEGT--LANHKRGLWDVTFCQ 556

Query: 218 DVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             K LATCS D T +VWS++ +  +  TL+ H   V  C+F   +  +V+  +D  +++W
Sbjct: 557 YDKLLATCSGDKTIKVWSLE-SMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVW 615

Query: 278 DLSTREIVRQYGGH 291
           DLST E +R    H
Sbjct: 616 DLSTGECIRTLDAH 629

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 85/228 (37%), Gaps = 25/228 (10%)

Query: 67  PVTSFEGHRGNVTSIAFQ--QENKW---MVSSSEDGTIKVWDVRAPSV----QRNYK--- 114
           P   F GH G VT++       N W   ++++S D TIK W V  P+       N K   
Sbjct: 438 PYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSD 497

Query: 115 -----HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVAS 169
                H+  +N + I PN     +   D   +IW++   +    LA      L  ++   
Sbjct: 498 YTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLA-NHKRGLWDVTFCQ 556

Query: 170 DGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADH 229
              +L   +      VW +   +       V     H   + R    +  K + +  AD 
Sbjct: 557 YDKLLATCSGDKTIKVWSLESMS------VVKTLEGHTNAVQRCSFINRNKQIVSTGADG 610

Query: 230 TARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             +VW +    +   TLD H   +W  +  +D    VTA +D   + W
Sbjct: 611 LIKVWDLSTG-ECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 10/175 (5%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           + A+A YD T + W   +G    T+  H     +      DK     +G   ++++ + +
Sbjct: 518 VFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLES 577

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNE 121
            +   V + EGH   V   +F   NK +VS+  DG IKVWD+      R    H   +  
Sbjct: 578 MSV--VKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWA 635

Query: 122 VVIHPNQGELISCDQDGNVRIW------DLGENQCVHQLAPEDDTPLQSLSVASD 170
           + +  +  E ++ D DG  + W      +  EN    +L  E +  LQ+     D
Sbjct: 636 LSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGD 690

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 19/94 (20%)

Query: 96  DGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQG----ELISCDQDGNVRIWDLGENQC 150
           DG++ V D+    V  ++K H A ++ V  H  Q      L S D  G V++WDL    C
Sbjct: 122 DGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNC 181

Query: 151 VH--------------QLAPEDDTPLQSLSVASD 170
           +H              +L+P DD  L+ L+   D
Sbjct: 182 IHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRD 215

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/224 (18%), Positives = 89/224 (39%), Gaps = 16/224 (7%)

Query: 73  GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGEL 131
            H  ++ +++    +    ++S D T K+W+V +  ++     H+  + +V        L
Sbjct: 502 AHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLL 561

Query: 132 ISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            +C  D  +++W L     V  L    +  +Q  S  +    +V+    G   VW     
Sbjct: 562 ATCSGDKTIKVWSLESMSVVKTLEGHTNA-VQRCSFINRNKQIVSTGADGLIKVW----- 615

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS------IDDNFQLETT 245
            D +  + +    +H+  I  + + SD K   T  AD   + W         +N + +  
Sbjct: 616 -DLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKL 674

Query: 246 LDNHQRWVWDCAFSAD--SAYLVTACSDHYVRLWDLSTREIVRQ 287
           +   ++ + +     D  +A+L+    +H +RL+ +  R    Q
Sbjct: 675 MVEQEQSLQNYMAQGDWTNAFLLAMTLNHPMRLYRVLERSSASQ 718

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 62/148 (41%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           L SL  + +G  L   +      +W++    D+   KP  +F  HA  +T V L + +++
Sbjct: 403 LNSLDSSENGEWLATCSKDHTVILWKL--NADSEKFKPYARFTGHAGPVTAVGLPNVMRN 460

Query: 222 -----LATCSADHTARVWSIDDNFQLETTLDN----------HQRWVWDCAFSADSAYLV 266
                + T S D T + WS+      +  + N          H++ +   + S + +   
Sbjct: 461 TWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKG 294
           TA  D   ++W++ + E+      H +G
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRG 548

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 70  SFEGHRGNVTSIAFQQENK---WMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAAV 119
           SF+GH   ++S+ F  E     W ++S +  G +KVWD VR   +    +H AAV
Sbjct: 138 SFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAV 192

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 104/239 (43%), Gaps = 21/239 (8%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 525 DRTVRIWDLRNGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 583

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI-DDNFQ--------- 241
            D+ N         H   +  V+ + D  ++ + S D + ++W++  DN Q         
Sbjct: 584 LDSEN----ELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGT 639

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 640 CEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 698

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 24/161 (14%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+   G CS T+   D  V  + +S       AAG L+  VR++D  T
Sbjct: 519 LVSGSGDRTVRIWDLRNGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSET 577

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------PS 108
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R        P+
Sbjct: 578 GFLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPN 635

Query: 109 VQRNYK-----HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
           V    +     H+  V  V    N   ++S  +D  V  WD
Sbjct: 636 VPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 676

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD++ ++IV    GH +
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 505

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 142/339 (41%), Gaps = 57/339 (16%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDI 60
           S ++  AG D+T R W+  T     T++   + V  +  S+D   +A       +RL+D 
Sbjct: 155 SRMVTGAG-DNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDS 213

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRN 112
                +   +  GH   +TS++++        E   + S+S+DGTIK+WD  R   +   
Sbjct: 214 EKGQ-SLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTL 272

Query: 113 YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN-QCVH------------------- 152
             H ++V+  +    +  L S   D  VR WD+    +C++                   
Sbjct: 273 SGHTSSVS-CIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYA 331

Query: 153 -QLAPEDDTPLQSLS---------------VASDGSM---LVAGNNKGNCYVWQMPHQTD 193
            ++ P D T  +  S                  +G+M   +V G++    Y+W       
Sbjct: 332 LRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWN-----P 386

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
               KP+ +   H K +  V  S D +++ + S D++ ++W   D  +   T   H   V
Sbjct: 387 LKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFIATFRGHVASV 445

Query: 254 WDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           +  A+S+D   LV+   D  +++WD+ TR++     GH+
Sbjct: 446 YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHN 484

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 106/280 (37%), Gaps = 63/280 (22%)

Query: 4   ILASAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L SA +D T+R W+ A  G C   ++     VN L +S+D         L +  +D   
Sbjct: 289 VLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYA-------LRMGPFDHTG 341

Query: 63  TNP-NPVTSFEGHRGNVTSIAFQQEN--KWMVSSSEDGTIKVWDVRAPS--VQRNYKHQA 117
           T P +P  +      N   +A +     + MV+ S+D T+ +W+    S  + R   HQ 
Sbjct: 342 TKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQK 401

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            VN V   P                                           DG  +V+ 
Sbjct: 402 LVNHVAFSP-------------------------------------------DGRYIVSA 418

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +   +  +W      D  + K +  FR H   + +V  SSD + L +CS D T +VW + 
Sbjct: 419 SFDNSIKLW------DGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 472

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              +L   L  H   V+   +S D   + +   D  VRLW
Sbjct: 473 TR-KLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQ---VNRLEISSDKRFLAAAGHLN-VR 56
           M  ++ +   D T+  W  L G  S+ I         VN +  S D R++ +A   N ++
Sbjct: 368 MEELMVTGSDDFTMYLWNPLKG--SKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 425

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-H 115
           L+D R  +   + +F GH  +V  +A+  + + +VS S+D T+KVWDV+   +  +   H
Sbjct: 426 LWDGR--DGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGH 483

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIW 143
              V  V    +   + S  +D  VR+W
Sbjct: 484 NDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 55/134 (41%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+   + H+ ++  V  S+D + +AT S D T 
Sbjct: 155 SRMVTGAGDNTARIWDCDTQT------PLCTLKGHSNWVLCVAWSADGEVIATGSMDATI 208

Query: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLVTACSDHYVRLWDLSTREI 284
           R+W  +    L   L  H +W+   ++         +   L +A  D  +++WD + R  
Sbjct: 209 RLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVC 268

Query: 285 VRQYGGHHKGAICV 298
           +    GH     C+
Sbjct: 269 IYTLSGHTSSVSCI 282

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 116/280 (41%), Gaps = 40/280 (14%)

Query: 23  VCSRTIQHSDSQVNRLEISSDKRFLAAA------------GHLNVRLYDIRTTNPNPVTS 70
           VC  T  +++  +  +E S D R  AA             G     +   +  + +   +
Sbjct: 489 VCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSAT 548

Query: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQG 129
             GH G V S+AF  +N++++S+SED T+++W +   +    YK H   V  V   P   
Sbjct: 549 LVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGH 608

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS----------VASDGSMLVAGNN 179
             I+   D   R+W      C H        PL+  S             +G  +  G++
Sbjct: 609 YFITASHDQTARLW-----SCDHIY------PLRIFSGHLNDVDCSTFHPNGCYVFTGSS 657

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
              C +W +  QT  +    V  F  H   +T + +S D + L T S D T  VW I   
Sbjct: 658 DKTCRMWDI--QTGDS----VRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTG 711

Query: 240 FQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            +++    + +  ++   F+ +   LVT  +D  VR+WD+
Sbjct: 712 KRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 99/221 (44%), Gaps = 5/221 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           L SA  D T+R W   T  C    +  +  V  ++ S    +   A H    RL+     
Sbjct: 568 LLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHI 627

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEV 122
            P  +  F GH  +V    F     ++ + S D T ++WD++   SV+    H + V  +
Sbjct: 628 YP--LRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTAL 685

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+   L +  +DG + +WD+G  + + Q+      P+ S++   +G+ LV G    +
Sbjct: 686 EVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQS 745

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
             VW +   T+    +P  +F +++  +  + +++D+K   
Sbjct: 746 VRVWDIKRFTNEPGMEPEQQFNTYSGDM-ELSVNNDIKEFG 785

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 105/258 (40%), Gaps = 23/258 (8%)

Query: 54  NVRLYDIRTTNPNP-VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA------ 106
           +++L +++T+ P+  + +F    GN+T + F  + +   +  +D TIKVW +        
Sbjct: 476 SIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSI 535

Query: 107 -PSVQRNYK-------HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPED 158
            PS  ++         H   V  V   P+   L+S  +D  VR+W L    C+      +
Sbjct: 536 LPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHN 595

Query: 159 DTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSD 218
             P+  +  +  G   +  ++     +W   H        P+  F  H   +       +
Sbjct: 596 H-PVWYVKFSPLGHYFITASHDQTARLWSCDHIY------PLRIFSGHLNDVDCSTFHPN 648

Query: 219 VKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278
             ++ T S+D T R+W I     +   L  H   V     S D  +L T   D  + +WD
Sbjct: 649 GCYVFTGSSDKTCRMWDIQTGDSVRLFL-GHTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

Query: 279 LSTREIVRQYGGHHKGAI 296
           + T + ++Q  GH K  I
Sbjct: 708 IGTGKRIKQMKGHGKNPI 725

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 1/92 (1%)

Query: 206 HAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYL 265
           H+  +  V  S D ++L + S D T R+WS+D  F        H   VW   FS    Y 
Sbjct: 552 HSGPVYSVAFSPDNRYLLSASEDKTVRLWSLD-TFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
           +TA  D   RLW       +R + GH     C
Sbjct: 611 ITASHDQTARLWSCDHIYPLRIFSGHLNDVDC 642

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 108/249 (43%), Gaps = 30/249 (12%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW----DVRAPSVQRNY-KHQAAV 119
           P  V  +EGH   + S+   ++  W+ ++S+D +  VW    + R   V   Y  H +AV
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAV 437

Query: 120 NEV---VIHPNQGE--LISCDQDGNVRIWDLGENQCVHQL-----------APEDDTPLQ 163
             V    I P      L++   D  ++ W + +      +           A E D  + 
Sbjct: 438 TAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKD--IN 495

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           +LS++ + S+    +    C +W +       N +      +H + +  V      K LA
Sbjct: 496 ALSISPNDSIFATASYDKTCKIWNL------ENGELEATLSNHKRGLWDVTFCQYDKLLA 549

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           TCS D T ++WS+D  F +  TL+ H   V  C+F      LV+  +D  +++WD S+ E
Sbjct: 550 TCSGDKTVKIWSLD-TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGE 608

Query: 284 IVRQYGGHH 292
            ++   GH+
Sbjct: 609 CLKTLDGHN 617

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 100/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAFQQ-----E 86
           +N L+ + D  ++A A   N  +   Y+  T      + + GH   VT++   +      
Sbjct: 391 LNSLDATEDGLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAVTAVGLPKIMPKGY 450

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-----------HQAAVNEVVIHPNQGELISCD 135
            ++++++S D TIK W +  P+   + +           H+  +N + I PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATAS 510

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
            D   +IW+L EN  +          L  ++      +L   +      +W +   +   
Sbjct: 511 YDKTCKIWNL-ENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFS--- 566

Query: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255
               +     H   + R    +  K L +C AD   ++W       L+ TLD H   +W 
Sbjct: 567 ---VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLK-TLDGHNNRLWA 622

Query: 256 CAFSADSAYLVTACSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 623 LNTMNDGDIIVSADADGVFQFW 644

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 62/146 (42%), Gaps = 12/146 (8%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           I A+A YD T + W    G    T+  H     +      DK     +G   V+++ + T
Sbjct: 505 IFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDT 564

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA----A 118
              + + + EGH   V   +F  + K +VS   DG IK+WD  +    +          A
Sbjct: 565 F--SVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWA 622

Query: 119 VNEVVIHPNQGELI-SCDQDGNVRIW 143
           +N +    N G++I S D DG  + W
Sbjct: 623 LNTM----NDGDIIVSADADGVFQFW 644

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 15/144 (10%)

Query: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG-HLNVRLYDIRTTNPNPVTSFE 72
           ++ +   TG   R+++ S S    L+  S    LA  G   ++ + DI   N     SF+
Sbjct: 85  LKIFHLKTGKVVRSMKIS-SPSYILDADSTSTLLAVGGTDGSIIVVDIE--NGYITHSFK 141

Query: 73  GHRGNVTSIAF--QQENK-WMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPN 127
           GH G ++S+ F  Q ++K W+++S + +G +KVWD V+   +    +H +AV  + I   
Sbjct: 142 GHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEV 201

Query: 128 QG------ELISCDQDGNVRIWDL 145
           Q       +L+S  +D  + IWD 
Sbjct: 202 QNSDEPFLKLLSGGRDDIINIWDF 225

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 57/153 (37%), Gaps = 28/153 (18%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYI----------- 210
           L SL    DG  +   +   +  VW+    T         KF  ++KYI           
Sbjct: 391 LNSLDATEDGLWIATASKDNSAIVWKYNENT--------RKFEVYSKYIGHSSAVTAVGL 442

Query: 211 TRVLLSSDVKHLATCSADHTARVWSIDDN---FQLET------TLDNHQRWVWDCAFSAD 261
            +++     + L T S D T + W I      F ++T      T   H++ +   + S +
Sbjct: 443 PKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPN 502

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKG 294
            +   TA  D   ++W+L   E+      H +G
Sbjct: 503 DSIFATASYDKTCKIWNLENGELEATLSNHKRG 535

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 96  DGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE----LISCDQDGNVRIWDLGENQC 150
           DG+I V D+    +  ++K H   ++ +  +         L S D +G V++WDL + +C
Sbjct: 123 DGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRKC 182

Query: 151 VHQL 154
           +H L
Sbjct: 183 LHTL 186

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 113/252 (44%), Gaps = 17/252 (6%)

Query: 63  TNPNP----VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAA 118
           T P+P         GHR +V +I    +NK + ++S +GT+K+W+++  S  R ++   A
Sbjct: 369 TMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATAS-NGTLKIWNIKTNSCIRTFECGYA 427

Query: 119 VNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN 178
           +      P    ++   + G++ ++DL  +  ++ +       + SL + +DG  LV G+
Sbjct: 428 L-ACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGS 486

Query: 179 NKGNCYVWQ-------MPHQTDAANPKPVTKFRSHAKY---ITRVLLSSDVKHLATCSAD 228
                  W        +P  TD  NPK      +  +    +  V +S D + LA    D
Sbjct: 487 ADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLD 546

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
           +T +V+ +D + +   +L  H+  V     S DS  L+T+ +D  +++W L   +  R  
Sbjct: 547 NTVKVFFMD-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSL 605

Query: 289 GGHHKGAICVAL 300
             H+   + V  
Sbjct: 606 FAHNDSIMKVVF 617

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 123/296 (41%), Gaps = 38/296 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +LA+A  + T++ W   T  C RT +   +   +  +      +      ++ LYD+ ++
Sbjct: 399 LLATAS-NGTLKIWNIKTNSCIRTFECGYALACKF-LPGGALVVLGTKTGDLHLYDLASS 456

Query: 64  NPNPVTSFEG-HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------------PSV 109
               + + EG H G + S+    + K +V+ S D T+  WD +              P +
Sbjct: 457 TL--LNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKL 514

Query: 110 QRNYKHQAAVNE----VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSL 165
           +  +     +N+    V I P+   L     D  V+++ +   +    L      P+ S+
Sbjct: 515 KMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHK-LPVLSI 573

Query: 166 SVASDGSMLVAGNNKGNCYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
            ++ D  +L+  +   N  +W +     H++            +H   I +V+   +  +
Sbjct: 574 DISFDSKLLITSSADKNIKIWGLDFGDCHRS----------LFAHNDSIMKVVFVPESHN 623

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             +CS D   + W   D F+    L  HQ+ VW  A S+D  ++V+A  D  +R+W
Sbjct: 624 FFSCSKDALVKYWD-GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 95/253 (37%), Gaps = 69/253 (27%)

Query: 5   LASAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEISSDKRFLA 48
           L +   D T+ FW      E + G   +          T    +  V  ++IS D R LA
Sbjct: 482 LVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLA 541

Query: 49  AAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAP 107
            +   N V+++ + +       S  GH+  V SI    ++K +++SS D  IK+W +   
Sbjct: 542 VSLLDNTVKVFFMDSMKF--FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599

Query: 108 SVQRN-YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166
              R+ + H  ++ +VV  P      SC +D  V+ WD  + +C+               
Sbjct: 600 DCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQ-------------- 645

Query: 167 VASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCS 226
                                              K  +H K +  + +SSD + + + S
Sbjct: 646 -----------------------------------KLAAHQKEVWTLAISSDGRFVVSAS 670

Query: 227 ADHTARVWSIDDN 239
            D + RVWS  D+
Sbjct: 671 HDQSIRVWSETDD 683

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 7/123 (5%)

Query: 33  SQVNRLEISSDKRFLAAAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMV 91
           ++ + L+   + R LA   +   ++++D+   + + + SF GH+  +T + F Q    ++
Sbjct: 76  AETSYLQYHPETRLLAVGYNDGAIKIWDL--LSKSVLISFNGHKSAITILTFDQTGTRLI 133

Query: 92  SSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGE--LISCDQDGNVRIWDLGENQ 149
           S S D  I VWD+        YK ++  + +     +GE  LIS  +DG +++WDL   Q
Sbjct: 134 SGSRDSDIIVWDLVGEVGL--YKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQ 191

Query: 150 CVH 152
           CV 
Sbjct: 192 CVE 194

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 96/225 (42%), Gaps = 21/225 (9%)

Query: 76  GNVTSIAFQQENKWMVSSSE-DGTIKVWDVRAP-SVQRNYKHQAAVNEVVIHPNQGELIS 133
           G V + A +  N W + S E  GT+   D   P +V       A  + +  HP    L  
Sbjct: 35  GQVLTGALENVNCWSMKSGELIGTLT--DGLPPGAVDAKSTKPAETSYLQYHPETRLLAV 92

Query: 134 CDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTD 193
              DG ++IWDL     +        + +  L+    G+ L++G+   +  VW      D
Sbjct: 93  GYNDGAIKIWDLLSKSVLISFNGHK-SAITILTFDQTGTRLISGSRDSDIIVW------D 145

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
                 + K RSH   IT +    + + L + S D   +VW    + +++  ++ H   V
Sbjct: 146 LVGEVGLYKLRSHKDSITGLWCEGE-EWLISTSKDGLIKVW----DLKVQQCVETHVAHV 200

Query: 254 WDC-AFSADSAYLVTACSDHYVRLWDLSTRE----IVRQYGGHHK 293
            +C +       ++TA +D+ ++LW+L+  E    ++ + G H K
Sbjct: 201 GECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIEKGTHEK 245

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 136/339 (40%), Gaps = 62/339 (18%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T     T++   + V  +  S D   +A     N +RL++ +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTIRLWNPKT- 217

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQR--NYK 114
                 +  GH   +T ++++            + SSS+DGTIK+WD    SV R   Y 
Sbjct: 218 GECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWD----SVNRVCQYT 273

Query: 115 HQAAVNEV--VIHPNQGELISCDQDGNVRIWDL-GENQCVHQLA---------------- 155
                N V  V    QG L S   D  VR+WD+  + +C++ L                 
Sbjct: 274 LSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYA 333

Query: 156 ------------PEDDTPLQSLSV----------ASDGSMLVAGNNKGNCYVWQMPHQTD 193
                       P      Q  ++           S   M+V  ++    ++W     T 
Sbjct: 334 LRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKST- 392

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
               KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   H   V
Sbjct: 393 ----KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASV 447

Query: 254 WDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           +  A+S+D   LV+   D  +++WD+ TR++     GH 
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/325 (19%), Positives = 128/325 (39%), Gaps = 62/325 (19%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQ---------VNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W   TG C        S+         ++ ++  S  R  +++    
Sbjct: 200 VIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGT 259

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV---------- 104
           ++++D  + N     +  GH  +V+ + +  +   + S S D T++VWD+          
Sbjct: 260 IKIWD--SVNRVCQYTLSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDMNSQGRCINIL 316

Query: 105 ---------------------------RAPSVQRNYKHQAAVNEVVIHPNQGE----LIS 133
                                      + P+     + +A  N   I    G     +++
Sbjct: 317 KSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMVT 376

Query: 134 CDQDGNVRIWD-LGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
              D  + +W+ L   + + ++       +  ++ + DG  +V+ +   +  +W      
Sbjct: 377 ASDDFTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASFDNSIKLW------ 429

Query: 193 DAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRW 252
           D  + K ++ FR H   + +V  SSD + L +CS D T +VW +    +L   L  HQ  
Sbjct: 430 DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR-KLSVDLPGHQDE 488

Query: 253 VWDCAFSADSAYLVTACSDHYVRLW 277
           V+   +S D   + +   D  VRLW
Sbjct: 489 VYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W    QT      P+   + H  ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWV----WD---CAFSADSAYLVTACSDHYVRLWDLSTREI 284
           R+W+      L   L  H +W+    W+            L ++  D  +++WD   R  
Sbjct: 211 RLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWDSVNRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTLSGHTNSVSCV 284

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 210 ITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE------TTLDNHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    F+++      + +  H   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGFNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT   D+  R+WD  T+  +    GH    +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVS 193

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 117/282 (41%), Gaps = 29/282 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--------------------VRLY 58
           +L  VC  T  +++  ++ LE S D R LAA G  +                     +  
Sbjct: 466 SLPSVCMYTFHNTNKDMSCLEFSDDCR-LAATGFQDSFIKIWSLDGSSLVTNKLPSYKKE 524

Query: 59  DIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQA 117
           +I TT     +   GH G V S +F  +NK+++S SED T+++W +   +   +YK H  
Sbjct: 525 EILTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNH 584

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            V +V   P      +   D   R+W       +   A   +  ++++S   +G  +  G
Sbjct: 585 PVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VETVSFHPNGCYVFTG 643

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +    C +W      D +    V  F  H   +    ++ D + L T   D    VW I 
Sbjct: 644 SADKTCRMW------DISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIG 697

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
              +L+    + +  +   +F+ +   L++  +DH VR+WDL
Sbjct: 698 TGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 96/222 (43%), Gaps = 5/222 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRT 62
            L S   D T+R W   T     + +  +  V  ++ S    + A A H    RL+    
Sbjct: 555 FLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDH 614

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNE 121
             P  +  F GH  +V +++F     ++ + S D T ++WD+    SV+    H A V  
Sbjct: 615 IYP--LRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLT 672

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
             + P+   L +  +DG + +WD+G  + + Q+       + S S   +G++L++G    
Sbjct: 673 TAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADH 732

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           +  VW +   T   + +P   F  +   +T   ++ D+K   
Sbjct: 733 SVRVWDLKKATPEPSAEPEQPFAGYVGDVT-ASVNQDIKEFG 773

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 105/264 (39%), Gaps = 30/264 (11%)

Query: 55  VRLYDIRTTNPNP-VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN- 112
           +RL +I+T+ P+  + +F     +++ + F  + +   +  +D  IK+W +   S+  N 
Sbjct: 458 IRLDNIQTSLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNK 517

Query: 113 ---YK-----------------HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH 152
              YK                 H  AV      P+   L+S  +D  VR+W +  +  + 
Sbjct: 518 LPSYKKEEILTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV 577

Query: 153 QLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITR 212
                +  P+  +  +  G      ++     +W   H        P+  F  H   +  
Sbjct: 578 SYKGHNH-PVWDVKFSPMGHYFATASHDQTARLWSCDHIY------PLRIFAGHLNDVET 630

Query: 213 VLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDH 272
           V    +  ++ T SAD T R+W I     +   L  H   V   A + D  +L T   D 
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFL-GHTAPVLTTAVTPDGRWLCTGGEDG 689

Query: 273 YVRLWDLSTREIVRQYGGHHKGAI 296
            + +WD+ T + ++Q  GH K AI
Sbjct: 690 VINVWDIGTGKRLKQMRGHGKNAI 713

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 73.6 bits (179), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 106/243 (43%), Gaps = 6/243 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L SA  D   + W+       R      S V+ ++I      +A AG  +V +L+DIR+ 
Sbjct: 169 LFSASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDIHPTLDLIATAGRDSVVKLWDIRSR 228

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
            P  V +  GH+  +  +     N  ++SSS D TI++WD+ A    +    H+ ++ ++
Sbjct: 229 VP--VVTLIGHKSPINKVHCLPVNPQVISSSVDATIRLWDIVAGKASKVLTHHKRSIRDI 286

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG- 181
             HP++  + +   D ++R W L E   +          +  LS+  D  +   G+N   
Sbjct: 287 AFHPSEFSMATACTD-DIRSWKLPEGSLLTNFEASKVGIINCLSINQDNVLFAGGDNGAL 345

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQ 241
           + Y ++  H+  +   + + +     + I           L TC +D T ++W  D N  
Sbjct: 346 SFYDYKSGHKYQSLETQALPESPDAERSILASTFDQTGLRLITCESDKTIKMWKQDTNST 405

Query: 242 LET 244
           +ET
Sbjct: 406 VET 408

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 12/234 (5%)

Query: 71  FEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQ 128
            +GH G V  +     +N+W  + S D TIK+WD+ +  ++     H   V ++ I    
Sbjct: 107 IKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKITLSGHAMTVRDIAISNRH 166

Query: 129 GELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188
             L S  +D   + WDL +N  +        + + ++ +     ++          +W  
Sbjct: 167 PYLFSASEDKLAKCWDLEKNTAIRDYHGH-LSGVHTVDIHPTLDLIATAGRDSVVKLW-- 223

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
               D  +  PV     H   I +V        + + S D T R+W I    +    L +
Sbjct: 224 ----DIRSRVPVVTLIGHKSPINKVHCLPVNPQVISSSVDATIRLWDIVAG-KASKVLTH 278

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
           H+R + D AF      + TAC+D  +R W L    ++  +     G I C+++N
Sbjct: 279 HKRSIRDIAFHPSEFSMATACTDD-IRSWKLPEGSLLTNFEASKVGIINCLSIN 331

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 73.6 bits (179), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 96/212 (45%), Gaps = 10/212 (4%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +T+ +GH G V ++ F    +++ S+S D T ++WD+ + + +Q    H   V  +    
Sbjct: 268 LTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQN 327

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +   L S   D    +WD+   + +  L      P+ S+  + DG  +  G   G   +W
Sbjct: 328 DGALLCSGGLDNAAIVWDVRTGKSIMNLQGH-AKPIYSVDWSPDGYHIATGGGDGVINIW 386

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH-LATCSADHTARVWSIDDNFQLETT 245
            +   T+       T+  +H   +T V       H L +C  D   R++S D+  Q++ T
Sbjct: 387 DIRKTTET------TRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK-T 439

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           L+ H   + D   S D+  +V++  D  ++LW
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 103/245 (42%), Gaps = 17/245 (6%)

Query: 54  NVRLYDIRTTNPNPVTSFE-GHRGNVTSIAFQQENKWMVSSSEDGTIKV--WDVRAPSVQ 110
           ++++ D +T +   ++  E GH G +  +A+   N  +VS ++D  +K+  +D     ++
Sbjct: 209 DIKILDTKTLDV--ISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIK 266

Query: 111 RNYKHQAAVNEVV---IHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSV 167
                Q     VV    HP+   + S   D   R+WD+ E++   Q        + SLS 
Sbjct: 267 ELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDI-ESETELQFQEGHGKEVYSLSF 325

Query: 168 ASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSA 227
            +DG++L +G       VW      D    K +   + HAK I  V  S D  H+AT   
Sbjct: 326 QNDGALLCSGGLDNAAIVW------DVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGG 379

Query: 228 DHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACS-DHYVRLWDLSTREIVR 286
           D    +W I    +  T L  H   V    F   + + + +C  D  +R++       V+
Sbjct: 380 DGVINIWDIRKTTE-TTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 287 QYGGH 291
              GH
Sbjct: 439 TLEGH 443

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 3/156 (1%)

Query: 138 GNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANP 197
           G+++I D      +  +    D  +  L+  S  + LV+G +  +C V       D    
Sbjct: 208 GDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGAD--DCLVKIHSFDPDVKII 265

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           K +T  + H   +  V      + +A+ S D T R+W I+   +L+   + H + V+  +
Sbjct: 266 KELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ-EGHGKEVYSLS 324

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           F  D A L +   D+   +WD+ T + +    GH K
Sbjct: 325 FQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAK 360

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 5/143 (3%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRT 62
           +L S G D+    W+  TG     +Q     +  ++ S D   +A  G   V  ++DIR 
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRK 390

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENK-WMVSSSEDGTIKVWDVRA-PSVQRNYKHQAAVN 120
           T     T    H   VT + FQ+     +VS   D  I+++       V+    H   + 
Sbjct: 391 T--TETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKIL 448

Query: 121 EVVIHPNQGELISCDQDGNVRIW 143
           +V I  +   ++S   D ++++W
Sbjct: 449 DVDISEDAQLIVSSGWDRSLKLW 471

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 119/295 (40%), Gaps = 57/295 (19%)

Query: 45  RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104
           R +  AG    R++D  T  P  ++  +GH   V  +A+  + + + + S D TI++W+ 
Sbjct: 158 RMVTGAGDNTARIWDCATQTP--LSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWES 215

Query: 105 RA--PSVQRNYKHQAAVNEVVIHP-------NQGELISCDQDGNVRIWDLGENQCVHQLA 155
           +A  P       H   +  +   P       ++  L S  +DG ++IWD     C++ L+
Sbjct: 216 KAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLS 275

Query: 156 PEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL 215
              ++ +  +     G +L  G++     VW +      A  K +   +SHA ++  + L
Sbjct: 276 GHTNS-VSCVKWGGQG-LLYTGSHDKTIRVWDI-----KAGGKCINILKSHAHWVNHLSL 328

Query: 216 SSDV---------------------------------------KHLATCSADHTARVWSI 236
           S+D                                        + + T S D T  +W+ 
Sbjct: 329 STDYAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNP 388

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
             + +    +  HQ+ V   AFS D  Y+V+A  D+ ++LWD    + +  + GH
Sbjct: 389 LKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGH 443

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/335 (20%), Positives = 131/335 (39%), Gaps = 54/335 (16%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
           + +   D+T R W+  T      ++   + V  +  S D   +A     N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG 218

Query: 64  NPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
            P    + +GH   +TS+ ++        +   + S+S+DGTIK+WD    +        
Sbjct: 219 KPW-GDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGH 277

Query: 117 AAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQC----------VHQLAPEDDTPLQSL 165
                 V    QG L +   D  +R+WD+    +C          V+ L+   D  ++  
Sbjct: 278 TNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVG 337

Query: 166 SVASDGS----------------------------MLVAGNNKGNCYVWQMPHQTDAANP 197
               DG                             ++V  ++    ++W         + 
Sbjct: 338 PFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWN-----PLKSA 392

Query: 198 KPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA 257
           KP+ +   H K +  V  S D +++ + S D++ ++W   D  +   T   H   V+  A
Sbjct: 393 KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFIATFRGHVASVYQVA 451

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           +S+D   LV+   D  +++WD+ TR++     GH 
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 486

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 106/279 (37%), Gaps = 61/279 (21%)

Query: 4   ILASAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L +  +D TIR W+    G C   ++     VN L +S+D          + +      
Sbjct: 291 LLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGK------ 344

Query: 63  TNPNPVTSFEGHRGNVTSIAFQ--QENKWMVSSSEDGTIKVWDV--RAPSVQRNYKHQAA 118
            +P+P  + +  + N   +  +  Q  + MV++S+D T+ +W+    A  + R   HQ  
Sbjct: 345 ASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKL 404

Query: 119 VNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN 178
           VN V   P                                           DG  +V+ +
Sbjct: 405 VNHVAFSP-------------------------------------------DGRYIVSAS 421

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
              +  +W      D  + K +  FR H   + +V  SSD + L +CS D T +VW +  
Sbjct: 422 FDNSIKLW------DGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             +L   L  HQ  V+   +S D   + +   D  VRLW
Sbjct: 476 R-KLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 55/134 (41%), Gaps = 13/134 (9%)

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S +V G       +W      D A   P++  + H+ ++  V  S D + +AT S D+T 
Sbjct: 157 SRMVTGAGDNTARIW------DCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTI 210

Query: 232 RVWSIDDNFQLETTLDNHQRWV----WD---CAFSADSAYLVTACSDHYVRLWDLSTREI 284
           R+W           +  H +W+    W+      + D   L +A  D  +++WD S R  
Sbjct: 211 RLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 LYTLSGHTNSVSCV 284

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 257 AFSAD-SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           AF+ D S+ +VT   D+  R+WD +T+  +    GH    +CVA
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVA 193

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 104/243 (42%), Gaps = 27/243 (11%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAAN 196
           D  VRIWDL   QC   L+ ED     ++S+  DG  + AG+      VW      DA  
Sbjct: 499 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLG-DGKYIAAGSLDRAVRVW------DAET 551

Query: 197 PKPVTKFRS-------HAKYITRVLLSSDVKHLATCSADHTARVWSID---DNFQLET-- 244
              V +  S       H   +  V+ + D   + + S D + ++W++    +N   ET  
Sbjct: 552 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKP 611

Query: 245 -------TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
                  T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I 
Sbjct: 612 APGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVIS 671

Query: 298 VAL 300
           VA+
Sbjct: 672 VAV 674

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 65/155 (41%), Gaps = 17/155 (10%)

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           N GE ++   +   +++ + +   V +L+  DD   Q     S G+     NN  N +  
Sbjct: 372 NDGEYLATGCNKTTQVFRVSDGALVARLS--DDNATQGPQGPSGGTSDDDYNNDANSF-- 427

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
                   AN    T+  S   YI  V  S D K LAT + D   R+W I    ++   L
Sbjct: 428 --------AN----TRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQK-KIVMVL 474

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
             H++ ++   +      LV+   D  VR+WDL T
Sbjct: 475 QGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 509

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 28/164 (17%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIS-SDKRFLAAAGHLN--VRLYDIR 61
           L S   D T+R W+  TG CS T+   D  V  + +S  D +++ AAG L+  VR++D  
Sbjct: 493 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSLGDGKYI-AAGSLDRAVRVWDAE 550

Query: 62  TT-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK 114
           T        + N + +  GH+ +V S+ F ++   +VS S D ++K+W++ +     N +
Sbjct: 551 TGFLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAE 608

Query: 115 --------------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                         H+  V  V    N   ++S  +D  V  WD
Sbjct: 609 TKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWD 652

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD++ ++IV    GH +
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 479

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 112/265 (42%), Gaps = 44/265 (16%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N L+ S D  ++A A   +  L   Y  +  +      F GH G+VT++A      Q  
Sbjct: 384 LNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALPNIMDQHF 443

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG 146
             +++SSS D T+K W V  P+                +P + E+         R     
Sbjct: 444 PNFLLSSSTDMTVKKWKVPKPTQ---------------NPTEDEIPVVKTSEYTR----- 483

Query: 147 ENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSH 206
                   A E D  + +LS++ + S+    +    C +W      D    + V    +H
Sbjct: 484 -------RAHEKD--INALSISPNDSIFATASYDKTCKIW------DLVTGELVATLANH 528

Query: 207 AKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLV 266
            + +  V      K +ATCS D T ++WS++ N+ ++ TL+ H   V   +F   +  LV
Sbjct: 529 KRGLWDVSFCQHDKLIATCSGDKTIKIWSLE-NYNIKATLEGHTNAVQRISFINKNKQLV 587

Query: 267 TACSDHYVRLWDLSTREIVRQYGGH 291
           +  +D  V++WD ST E +R    H
Sbjct: 588 SCGADGLVKIWDCSTGECLRTLDAH 612

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 75/158 (47%), Gaps = 5/158 (3%)

Query: 32  DSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWM 90
           +  +N L IS +    A A +    +++D+ T     V +   H+  +  ++F Q +K +
Sbjct: 487 EKDINALSISPNDSIFATASYDKTCKIWDLVT--GELVATLANHKRGLWDVSFCQHDKLI 544

Query: 91  VSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQ 149
            + S D TIK+W +   +++   + H  AV  +       +L+SC  DG V+IWD    +
Sbjct: 545 ATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGE 604

Query: 150 CVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187
           C+  L   D+  + +L VA DG   V  +  G    W+
Sbjct: 605 CLRTLDAHDNR-IWALEVADDGDRFVTADADGLFQFWK 641

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           I A+A YD T + W+ +TG    T+  H     +      DK     +G   ++++ +  
Sbjct: 501 IFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE- 559

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNE 121
            N N   + EGH   V  I+F  +NK +VS   DG +K+WD       R    H   +  
Sbjct: 560 -NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWA 618

Query: 122 VVIHPNQGELISCDQDGNVRIW 143
           + +  +    ++ D DG  + W
Sbjct: 619 LEVADDGDRFVTADADGLFQFW 640

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 60/150 (40%), Gaps = 19/150 (12%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           L +L  + DG  +   +      +W+   Q    + K   KF  HA  +T V L + +  
Sbjct: 384 LNALDASEDGLWIATASKDHTVLLWRYSEQL--GDFKQYAKFIGHAGSVTAVALPNIMDQ 441

Query: 222 -----LATCSADHTARVWSI--------DDNFQL----ETTLDNHQRWVWDCAFSADSAY 264
                L + S D T + W +        +D   +    E T   H++ +   + S + + 
Sbjct: 442 HFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSI 501

Query: 265 LVTACSDHYVRLWDLSTREIVRQYGGHHKG 294
             TA  D   ++WDL T E+V     H +G
Sbjct: 502 FATASYDKTCKIWDLVTGELVATLANHKRG 531

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 7/71 (9%)

Query: 54  NVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE---NKWMVSSSE-DGTIKVWD-VRAPS 108
           +V ++DI   N     SF+GH G ++S+ F  E     W+++S + +G +K+WD V+   
Sbjct: 124 SVSIFDIE--NGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRRC 181

Query: 109 VQRNYKHQAAV 119
           +    +H AAV
Sbjct: 182 MHTIQEHTAAV 192

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 90  MVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGEL-------ISCDQDGNVR 141
           +V    DG++ ++D+    V  ++K H   ++ V  +   GEL        S D +G V+
Sbjct: 116 LVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFY---GELDGANWLLASGDTNGVVK 172

Query: 142 IWDLGENQCVHQL 154
           IWDL + +C+H +
Sbjct: 173 IWDLVKRRCMHTI 185

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 93/257 (36%), Gaps = 35/257 (13%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE--ISSDKRFLAAAGH---LNVRLY 58
           +LAS   +  ++ W+ +   C  TIQ   + V  L+  +   +  L + G    +N+  +
Sbjct: 161 LLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINLHHF 220

Query: 59  DIRTT----NPNPVT-------------SFEGHRGN--VTSIAFQQENKWMVSSSEDGTI 99
           D + T       PV              S   H G+  V  I   Q  K  + SS+    
Sbjct: 221 DYKKTCKLLKTLPVKQQIEACGFIANHESLIYHAGDNAVYQIVCLQSGK-QIKSSQKPQE 279

Query: 100 KVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDD 159
           +++ +   S++   KH   +++  +     E    ++D  + I          ++A    
Sbjct: 280 ELFIIGVLSIENGSKHYLVLSDQTLFLLDIEQALMEEDTTIPIKS--------KIAGNHG 331

Query: 160 TPLQSLSVASDGSMLVAGNNKGNCYVWQMPH--QTDAANPKPVTKFRSHAKYITRVLLSS 217
           T      V  +  ML    N     + + P   + D   P     +  H   +  +  S 
Sbjct: 332 TIADMKFVGPNLDMLALATNSPTLRIIKAPQASEEDGQFPVETNMYGGHVDLLNALDASE 391

Query: 218 DVKHLATCSADHTARVW 234
           D   +AT S DHT  +W
Sbjct: 392 DGLWIATASKDHTVLLW 408

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 109/252 (43%), Gaps = 36/252 (14%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA------PSVQRNYKHQAA 118
           P  V  +EGH   + S+    +  WM ++S+D T  VW   +      P V +   H A 
Sbjct: 376 PINVEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYV-KFIGHSAT 434

Query: 119 VNEVVIHPN---QGE---LISCDQDGNVRIWDLG------ENQC-------VHQLAPEDD 159
           V  V + PN   +G    L++   D  ++ W +       E  C         + A E D
Sbjct: 435 VTAVGL-PNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKD 493

Query: 160 TPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV 219
             + +L+++ + S+    +    C +W      D  N +      +H + +  V      
Sbjct: 494 --INALAISPNDSIFATASYDKTCKIW------DLENGELTATLSNHKRGLWDVAFCQYD 545

Query: 220 KHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           K +ATCS D T ++WS+D  F +  TL+ H   V  C F      LV++ +D  +++WD 
Sbjct: 546 KLIATCSGDKTIKIWSLD-TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDC 604

Query: 280 STREIVRQYGGH 291
           ST + ++   GH
Sbjct: 605 STGDCLKTLDGH 616

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 109/250 (43%), Gaps = 20/250 (8%)

Query: 4   ILASAGYDHTIRFWEA------------LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG 51
            L +A  D TI+ W+             +  V   T +  +  +N L IS +    A A 
Sbjct: 451 FLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATAS 510

Query: 52  H-LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ 110
           +    +++D+   N     +   H+  +  +AF Q +K + + S D TIK+W +   SV 
Sbjct: 511 YDKTCKIWDLE--NGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVM 568

Query: 111 RNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVAS 169
           +  + H  AV   +    Q +L+S   DG ++IWD     C+  L   D+  + +L+  +
Sbjct: 569 KTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNR-IWALTEIN 627

Query: 170 DGSMLVAGNNKGNCYVWQMPHQTDAA-NPKPVTKFRSHAKYITRVLLSSD--VKHLATCS 226
           DG M+V+ +  G    W+   + +   N +   +     + +   LL+ D     L   +
Sbjct: 628 DGDMIVSADADGVFQFWKDCTELEKEQNLELEKEKVEKEQTLKNYLLNEDWTNAFLLALT 687

Query: 227 ADHTARVWSI 236
            DH  RV+++
Sbjct: 688 LDHPMRVFNV 697

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/264 (19%), Positives = 100/264 (37%), Gaps = 29/264 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N L+ + D  ++A A   +  +   Y+       P   F GH   VT++       +  
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGY 448

Query: 87  NKWMVSSSEDGTIKVWDVRAPS--VQRNYK-----------HQAAVNEVVIHPNQGELIS 133
            ++++++S D TIK W +  PS  V+ + +           H+  +N + I PN     +
Sbjct: 449 PEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFAT 508

Query: 134 CDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTD 193
              D   +IWDL   +    L+      L  ++      ++   +      +W +   + 
Sbjct: 509 ASYDKTCKIWDLENGELTATLSNHK-RGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFS- 566

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
                 +     H   + R +  +    L +  AD   ++W       L+T LD H   +
Sbjct: 567 -----VMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKT-LDGHDNRI 620

Query: 254 WDCAFSADSAYLVTACSDHYVRLW 277
           W      D   +V+A +D   + W
Sbjct: 621 WALTEINDGDMIVSADADGVFQFW 644

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 18/149 (12%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYIT-----RVLLS 216
           L SL    DG  +   +      VW+  + +     +P  KF  H+  +T      V+L 
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWK--YNSIINKFQPYVKFIGHSATVTAVGLPNVMLR 446

Query: 217 SDVKHLATCSADHTARVWSI-------DDNFQL----ETTLDNHQRWVWDCAFSADSAYL 265
              + L T S D T + W I       +++ Q+    E T   H++ +   A S + +  
Sbjct: 447 GYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF 506

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKG 294
            TA  D   ++WDL   E+      H +G
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKRG 535

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 8/100 (8%)

Query: 96  DGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGE-----LISCDQDGNVRIWDLGENQC 150
           DG+I V D+    +  + K   A    +    Q       L S D +G V++WDL + +C
Sbjct: 127 DGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKC 186

Query: 151 VHQLAPEDDTPLQSLSVASDGS--MLVAGNNKGNCYVWQM 188
           +H +  E    ++ L V   G    L++G     C +W  
Sbjct: 187 LHTMQ-EHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNF 225

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 57/306 (18%), Positives = 114/306 (37%), Gaps = 35/306 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIS--SDKRFLAAAGHLNV-RLYDI 60
           +L S   +  ++ W+ +   C  T+Q   + V  L++    D+  L + G  NV  L++ 
Sbjct: 166 LLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNF 225

Query: 61  RTTNPNPVTSFEGHRGNVTSIAF--QQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQA 117
                  +         V S  F   + +  + ++  D  ++   + +A  +++  KH  
Sbjct: 226 NLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIE 285

Query: 118 AVNEVVIHP----NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            +  + + P    ++  L+  DQ   + + D+  N         D   ++S    ++G++
Sbjct: 286 ELFIIGVLPILENDKMYLVMSDQ--TLELVDIKSNLLNES---SDIIEIESCIAGNNGTI 340

Query: 174 ------------LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
                       L    N     +  +P       P  V  +  H   +  +  + D   
Sbjct: 341 ADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNSLDTTDDGLW 400

Query: 222 LATCSADHTARVW---SIDDNFQLETTLDNHQRWVW-----DCAFSADSAYLVTACSDHY 273
           +AT S DHTA VW   SI + FQ       H   V      +        +L+TA +D  
Sbjct: 401 MATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASNDLT 460

Query: 274 VRLWDL 279
           ++ W +
Sbjct: 461 IKKWKI 466

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 72.4 bits (176), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 134/301 (44%), Gaps = 38/301 (12%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 31  LLLSASRDKTLISWK-LTGNDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+++ T        F GH+ +V S+A  ++   ++S S D TIKVW ++   +     H 
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGDCLATMLGHN 147

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+ E      LIS   D  V+ W++ + Q        ++  + +++ + D
Sbjct: 148 DWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNY-INTITASPD 206

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ +    G+  +W +  ++      P+    +  +     L  S  ++  T +    
Sbjct: 207 GTLIASAGKDGDIMLWNLKEKS------PLYTLNAQDEVF--ALAFSPNRYWLTAATSSG 258

Query: 231 ARVWSID-----DNFQLETT-----LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280
            +V+ ++     D  + E T      D H       A+SAD   L    +D+ +R+W + 
Sbjct: 259 IKVFDLEEKKLIDELKPEFTGFNKAADPHAV---SLAWSADGQTLFAGYTDNVIRVWQVM 315

Query: 281 T 281
           T
Sbjct: 316 T 316

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/226 (19%), Positives = 95/226 (42%), Gaps = 22/226 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     Q     R++K H   V + 
Sbjct: 11  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDC 70

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+W++   +   +      + + S+++    SM+++G+    
Sbjct: 71  ALTADGAYALSASWDKTLRLWNVATGETYQRFTGHK-SDVMSVAIDRKASMIISGSRDKT 129

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLS------SDVKHLATCSADHTARVWSI 236
             VW +           +     H  ++++V ++       +   L +   D   + W++
Sbjct: 130 IKVWTIKGDC-------LATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNV 182

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           +  FQ+E     H  ++     S D   + +A  D  + LW+L  +
Sbjct: 183 N-QFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKEK 227

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSIDDNFQLET----TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +  N Q       +   H   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCA 71

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 104/240 (43%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD-----------NF 240
            D+ N         H   +  V+ + D + + + S D + ++W++ +           + 
Sbjct: 565 LDSENESGT----GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  Y+++   D  V  WD ++   +    GH    I VA+
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAV 680

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 21/160 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D          D +++ AAG L+  VR++D  T
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI-AAGSLDRAVRVWDSET 558

Query: 63  TN-----PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK--- 114
                   +   S  GH+ +V S+ F ++ + +VS S D ++K+W+++  + + + K   
Sbjct: 559 GFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPN 618

Query: 115 ----------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                     H+  V  V    N   ++S  +D  V  WD
Sbjct: 619 SGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 53/148 (35%), Gaps = 13/148 (8%)

Query: 155 APEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVL 214
           +P  D  ++S+  + DG  L  G       +W      D  N K V   + H + I  + 
Sbjct: 439 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIENRKIVMILQGHEQDIYSLD 492

Query: 215 LSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYV 274
                  L + S D T R+W +    Q   TL              D  Y+     D  V
Sbjct: 493 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 551

Query: 275 RLWDLSTREIVRQY------GGHHKGAI 296
           R+WD  T  +V +       G  HK ++
Sbjct: 552 RVWDSETGFLVERLDSENESGTGHKDSV 579

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 102/235 (43%), Gaps = 43/235 (18%)

Query: 71  FEGHRGNVTSIAF-----QQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIH 125
           F GH  +VT++       +   ++++++S D TIK W +  PS        A   EV  H
Sbjct: 399 FSGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPS--------AGDEEVEFH 450

Query: 126 PNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYV 185
                        +V+I +          A E D  + +LS++ + S+    +    C +
Sbjct: 451 -------------DVKISEYTRR------AHEKD--INALSISPNDSIFATASYDKTCKI 489

Query: 186 WQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETT 245
           W      D    + V    +H + +  V      K +ATCS D T ++WS+D  F +  T
Sbjct: 490 W------DLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLD-TFSVIKT 542

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKG--AICV 298
           L+ H   V  C+F      LV+  +D  +++WD+S  E +    GH+    A+CV
Sbjct: 543 LEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCV 597

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           I A+A YD T + W+  TG                                         
Sbjct: 477 IFATASYDKTCKIWDLETG----------------------------------------- 495

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
               V +   H+  +  ++F Q +K + + S D TIK+W +   SV +  + H  AV + 
Sbjct: 496 --ESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKC 553

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                Q +L+S   DG ++IWD+   +C+  L   ++  + +L V +DG ++V+ +  G 
Sbjct: 554 SFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNR-IWALCVQNDGDLIVSADADGV 612

Query: 183 CYVWQ 187
              W+
Sbjct: 613 FQFWR 617

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 96  DGTIKVWDVRAPSVQRNYK-HQAAVNEVV----IHPNQGELISCDQDGNVRIWDLGENQC 150
           DG++ V D+    +  + K H   ++ +     ++ N   L S D +G V+IWDL + +C
Sbjct: 91  DGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKC 150

Query: 151 VHQLAPEDDTPLQSLSVA-----SDGSMLVAGNNKGNCYVWQM 188
           +H +  E  +P++ + +      +D   LV G        W+ 
Sbjct: 151 IHTVQ-EHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEF 192

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L SA  D  ++ W+       R      S V+ ++I      +A+AG   V +L+DIR+ 
Sbjct: 173 LFSASEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDIHPTLDLIASAGRDGVVKLWDIRSR 232

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK----HQAAV 119
               V +  GH+  +T +     N  +VSSS D T+++WDV A    ++YK    H+ +V
Sbjct: 233 TA--VMTLIGHKSPITKVHCLPVNPQVVSSSTDATVRLWDVTA---GKSYKILTHHKRSV 287

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN 179
            +  +HP++  ++S   D ++R W L E   +   A E    + +LSV  D  +L AG +
Sbjct: 288 RDFSLHPSEFSMVSACTD-DIRSWKLPEGALLTNFASESTGIINTLSVNQD-DVLFAGGD 345

Query: 180 KG--NCYVWQMPH--QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
            G  + Y ++  H  QT A    P +   S    +T     + ++ L T  AD + +VW
Sbjct: 346 DGMLSFYDYKSGHKYQTMATQEVPGS-LESERAILTSAFDRTGLR-LITGEADKSIKVW 402

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 94/226 (41%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V  +     +N+W  + S D T+K+WD+ +  ++     H   V +V I      
Sbjct: 113 GHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLAGHVMTVRDVAISQRHPY 172

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L S  +D  V+ WDL +NQ +        + + ++ +     ++ +    G   +W +  
Sbjct: 173 LFSASEDKMVKCWDLEKNQIIRDYHGH-LSGVHTVDIHPTLDLIASAGRDGVVKLWDIRS 231

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
           +T       V     H   IT+V        + + S D T R+W +      +  L +H+
Sbjct: 232 RT------AVMTLIGHKSPITKVHCLPVNPQVVSSSTDATVRLWDVTAGKSYK-ILTHHK 284

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V D +       +V+AC+D  +R W L    ++  +     G I
Sbjct: 285 RSVRDFSLHPSEFSMVSACTDD-IRSWKLPEGALLTNFASESTGII 329

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            AT S D T ++W +    +L+ TL  H   V D A S    YL +A  D  V+ WDL  
Sbjct: 131 FATGSNDTTVKIWDLASG-KLKLTLAGHVMTVRDVAISQRHPYLFSASEDKMVKCWDLEK 189

Query: 282 REIVRQYGGHHKGAICVALN 301
            +I+R Y GH  G   V ++
Sbjct: 190 NQIIRDYHGHLSGVHTVDIH 209

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 112/258 (43%), Gaps = 27/258 (10%)

Query: 41  SSDKRF-LAAAGHLNVRLYDIRTTNPNPV-TSFEGHRGNVTSIAFQQENKWMVSSSEDGT 98
           S D RF +  +  L  R++ I + + +   T+F GHR  V    F  + + + + S+DG 
Sbjct: 155 SQDSRFVITTSKDLTARIWSIDSEDKDLASTTFAGHRDYVLGAFFSADQEQIYTVSKDGA 214

Query: 99  IKVWDVRAPS--------------VQRNYKH--QAAVNEVVIHPNQGELISCDQDGNVRI 142
           +  W+                    Q+++ H  Q  V  V  HPN   L+    +G  R+
Sbjct: 215 LFKWEFTPRDEEDEEDLSKYSWRITQKHFFHNEQNKVKCVTFHPNSRILVVGFNNGEFRL 274

Query: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQMPHQTDAANPKPVT 201
           ++L +   + QL+   + P+ ++S+ S G  L  G++K G   V++   ++       + 
Sbjct: 275 YELPDFTLIQQLSMGQN-PVNTVSINSSGEWLAFGSSKLGQLLVYEWQSES------YIL 327

Query: 202 KFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSAD 261
           K + H   +  +  S D   + T + D   +VW +   F L  TL+ H   V    F+  
Sbjct: 328 KQQGHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCL-VTLEGHTSSVTAVQFAKR 386

Query: 262 SAYLVTACSDHYVRLWDL 279
              L +A  D  VR WDL
Sbjct: 387 GQVLFSASLDGTVRAWDL 404

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 100/237 (42%), Gaps = 8/237 (3%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIR 61
           S IL     +   R +E       + +    + VN + I+S   +LA       +L    
Sbjct: 260 SRILVVGFNNGEFRLYELPDFTLIQQLSMGQNPVNTVSINSSGEWLAFGSSKLGQLLVYE 319

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVN 120
             + + +   +GH  ++ ++ +  +   +V+++EDG IKVWDV +       + H ++V 
Sbjct: 320 WQSESYILKQQGHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCLVTLEGHTSSVT 379

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-N 179
            V        L S   DG VR WDL   +        +      L+V   G  + AG+ +
Sbjct: 380 AVQFAKRGQVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSVD 439

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
             + +VW +  QT     + +     H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 440 SFDIHVWSV--QT----SQLLDTLSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 490

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 85/224 (37%), Gaps = 50/224 (22%)

Query: 66  NPVTSFE-GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124
           N   +FE  HR NV ++   ++   ++S  +DG   + + R  +V  ++  +   N V  
Sbjct: 45  NKSFTFEYEHRKNVATLDLNRQGSLLISVDDDGRAILVNYRTRNVLHHFNFKEHCNSVKF 104

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCY 184
            P+ G+L +      ++IW                                         
Sbjct: 105 SPD-GKLFALATGRFLQIW----------------------------------------- 122

Query: 185 VWQMPHQTDAANPKPVTKFRSHAKYITRVLL---SSDVKHLATCSADHTARVWSID--DN 239
             + P  T+     P  ++R  A +   +L    S D + + T S D TAR+WSID  D 
Sbjct: 123 --KTPEATEDRQFAPFVRYRIQAGHFQDILSFTWSQDSRFVITTSKDLTARIWSIDSEDK 180

Query: 240 FQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
               TT   H+ +V    FSAD   + T   D  +  W+ + R+
Sbjct: 181 DLASTTFAGHRDYVLGAFFSADQEQIYTVSKDGALFKWEFTPRD 224

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 95/212 (44%), Gaps = 18/212 (8%)

Query: 78  VTSIAFQQENKWM-VSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHPNQGELISCD 135
           V +++     +W+   SS+ G + V++ ++ S + +   H  ++N +   P+   +++  
Sbjct: 293 VNTVSINSSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSLNALTYSPDGSRVVTAA 352

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
           +DG +++WD+    C+  L     + + ++  A  G +L + +  G    W +    +  
Sbjct: 353 EDGKIKVWDVISGFCLVTLEGHT-SSVTAVQFAKRGQVLFSASLDGTVRAWDLIRYRN-- 409

Query: 196 NPKPVTKFR--SHAKYITRVLLSSDVKHLATCSAD---HTARVWSIDDNFQLETTLDNHQ 250
                  FR  + A+ I    L+ D      C+         VWS+  + QL  TL  H+
Sbjct: 410 -------FRVFTAAERIQFNCLAVDPSGECVCAGSVDSFDIHVWSVQTS-QLLDTLSGHE 461

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
             V   +FS +++ L +A  D  +R+W +  R
Sbjct: 462 GPVSCLSFSQENSVLASASWDKTIRIWSIFGR 493

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 90/211 (42%), Gaps = 25/211 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAG--HLNVRLYDI 60
           +L SA  D T+R W+ +     R    ++  Q N L +      + A      ++ ++ +
Sbjct: 389 VLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSVDSFDIHVWSV 448

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAV 119
           +T+    + +  GH G V+ ++F QEN  + S+S D TI++W +   S Q       + V
Sbjct: 449 QTSQL--LDTLSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIDVYSDV 506

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDT 160
             +   P+  ++      G + I+D+ + + V  +                     E   
Sbjct: 507 LALSTRPDGKQVAVSTLKGQISIFDIEDGKQVGNIDCRKDIISGRHLEDRFTAKNSERSK 566

Query: 161 PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
              S++ + DG  +VAG N  +  ++ +P++
Sbjct: 567 FFTSINYSFDGFAIVAGGNNNSICLYDIPNE 597

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 105/224 (46%), Gaps = 28/224 (12%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS +N L  S D  R + AA    ++++D+   +   + + EGH  +VT++ F +  +
Sbjct: 332 HFDS-LNALTYSPDGSRVVTAAEDGKIKVWDV--ISGFCLVTLEGHTSSVTAVQFAKRGQ 388

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELI---SCDQDGNV 140
            + S+S DGT++ WD+      RN++      +   N + + P+ GE +   S D   ++
Sbjct: 389 VLFSASLDGTVRAWDLIR---YRNFRVFTAAERIQFNCLAVDPS-GECVCAGSVDS-FDI 443

Query: 141 RIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPV 200
            +W +  +Q +  L+  +  P+  LS + + S+L + +      +W +  ++    P  V
Sbjct: 444 HVWSVQTSQLLDTLSGHEG-PVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIDV 502

Query: 201 TKFRSHAKYITRVLLSS--DVKHLATCSADHTARVWSIDDNFQL 242
                   Y   + LS+  D K +A  +      ++ I+D  Q+
Sbjct: 503 --------YSDVLALSTRPDGKQVAVSTLKGQISIFDIEDGKQV 538

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 102/242 (42%), Gaps = 24/242 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD++   +    + H   V  +   P+  +L+S   
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 446 DRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL--------- 242
            D+ N         H   +  V+ + D   + + S D + ++W++ DN            
Sbjct: 505 LDSENELGT----GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKS 560

Query: 243 ----ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
               + T   H+ +V     +A+  Y+++   D  V  WD  +   +    GH    I V
Sbjct: 561 NATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISV 620

Query: 299 AL 300
           A+
Sbjct: 621 AV 622

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D          D +F+ AAG L+  VR++D  T
Sbjct: 440 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFI-AAGSLDRAVRVWDSET 498

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R
Sbjct: 499 GFLVERLDSENELGT--GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLR 546

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 209 YITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTA 268
           YI  V  S D K LAT + D   R+W I    ++   L  H + V+   +      LV+ 
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQR-KIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 269 CSDHYVRLWDLST 281
             D  VR+WDL T
Sbjct: 444 SGDRTVRIWDLKT 456

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD+  R+IV    GH +
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQ 426

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 98/221 (44%), Gaps = 21/221 (9%)

Query: 77  NVTSIAFQQENKWMVSSSEDGT---------IKVWD-VRAPSVQRNYKHQAAVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D V   S    Y+H+  ++ V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLVHNKSFTFEYEHRKNISCVALNP 65

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
               L+S D+DG   + +      +H L  ++   ++ L  + DG +      +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHLNFKE--KVRDLKFSPDGKLFALACGR-FVQVW 122

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLL---SSDVKHLATCSADHTARVWSIDDNFQ-- 241
           + P   +     P  ++R HA + + ++    S D + L + S D TAR+WS+D   +  
Sbjct: 123 KTPEVAEDRQFAPFVRYRVHAGHFSDIISLTWSQDSRFLVSTSKDLTARIWSLDSEEKDL 182

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
              T   H+ +V    FS+D   + T   D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEYTIR 223

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 114/274 (41%), Gaps = 35/274 (12%)

Query: 33  SQVNRLEISSDKRFLAAAGH-LNVRLYDIRTTNPNPVT-SFEGHRGNVTSIAFQQENKWM 90
           S +  L  S D RFL +    L  R++ + +   +  + +F GHR  V    F  + + +
Sbjct: 147 SDIISLTWSQDSRFLVSTSKDLTARIWSLDSEEKDLASVTFAGHRDYVMGAFFSSDQERI 206

Query: 91  VSSSEDGTIKVWD--VRA--------------PSV------QRNYKH--QAAVNEVVIHP 126
            + S+DG +  W+  +R               PS+      ++NY +  QA V  V  H 
Sbjct: 207 YTVSKDGAVFQWEYTIRPGYEALGEEPETEIDPSLYSWRITKKNYFYASQARVKCVTFHA 266

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYV 185
               LI    +G  R+++L     + QL+   +  + ++SV + G  L  G++K G   V
Sbjct: 267 KSNMLIVGFNNGEFRLYELPGFTLLQQLSMGQNA-VNAVSVNNTGEWLAFGSSKLGQLLV 325

Query: 186 WQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETT 245
           ++   ++       + K + H      V  S D   + T S D   ++W +   F L  T
Sbjct: 326 YEWQSES------YILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCL-VT 378

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
              H   V   AF+     L +A  D  VR WDL
Sbjct: 379 FQEHTSAVTGLAFAKKGQVLFSASLDGTVRAWDL 412

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 78  VTSIAFQQENKWM-VSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHPNQGELISCD 135
           V +++     +W+   SS+ G + V++ ++ S + +   H  A N V   P+   +++  
Sbjct: 301 VNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTAS 360

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
           +DG ++IWD+    C+     E  + +  L+ A  G +L + +  G    W +    +  
Sbjct: 361 EDGKIKIWDVVSGFCLVTFQ-EHTSAVTGLAFAKKGQVLFSASLDGTVRAWDLVRYRN-- 417

Query: 196 NPKPVTKFRSH--AKYITRVLLSSDVKHLATC--SADHTA-RVWSIDDNFQLETTLDNHQ 250
                  FR+   A+ I    L++D      C  S D  A  VWS+    QL  TLD H+
Sbjct: 418 -------FRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSVQTG-QLVETLDGHE 469

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
             V   +FS +++ L +A  D  +R+W +  R
Sbjct: 470 GPVSCLSFSRENSVLASASWDKTIRVWSIFGR 501

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 74/167 (44%), Gaps = 8/167 (4%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           +GH     ++ +  +   +V++SEDG IK+WDV +      ++ H +AV  +        
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGLAFAKKGQV 397

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVWQMP 189
           L S   DG VR WDL   +        +      L+    G ++ AG+ +    +VW + 
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSV- 456

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
            QT     + V     H   ++ +  S +   LA+ S D T RVWSI
Sbjct: 457 -QTG----QLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSI 498

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 88/208 (42%), Gaps = 21/208 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L        + A    +  ++    
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSV 456

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                V + +GH G V+ ++F +EN  + S+S D TI+VW +   S Q    +  A V  
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSIFGRSQQVEPLEVYADVLS 516

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTP-------------------L 162
           + + P+  E+ +   DG V  +D+ E + V  +  + D                      
Sbjct: 517 IAVRPDGNEVAASTLDGQVLFFDINEGKQVGAIDGKKDIVSGRHLEDRFTAKSSARSKYF 576

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPH 190
            ++  + DG  +VAG N  +  ++ +P+
Sbjct: 577 TTIDYSFDGLSIVAGGNNNSICLYDIPN 604

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 20/144 (13%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127
           + +F+ H   VT +AF ++ + + S+S DGT++ WD+      RN++   A   +     
Sbjct: 376 LVTFQEHTSAVTGLAFAKKGQVLFSASLDGTVRAWDLVR---YRNFRTFTAAERI----- 427

Query: 128 QGELISCDQDGNV-----------RIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVA 176
           Q   ++ D  G V            +W +   Q V  L   +  P+  LS + + S+L +
Sbjct: 428 QFNCLAADPSGEVVCAGSVDSFAIHVWSVQTGQLVETLDGHEG-PVSCLSFSRENSVLAS 486

Query: 177 GNNKGNCYVWQMPHQTDAANPKPV 200
            +      VW +  ++    P  V
Sbjct: 487 ASWDKTIRVWSIFGRSQQVEPLEV 510

>NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231
          Length = 767

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 126/316 (39%), Gaps = 57/316 (18%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +L +  YD TI  W+  +    R +      V  L    D++ +  +    +R+++ +T 
Sbjct: 374 LLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVKTLHFD-DQKLVTGSLDKTIRVWNYKTG 432

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
               ++++ GH  ++ S+      K +VS S D TIKVW V + +      H   VN V 
Sbjct: 433 QC--ISTYRGHTDSIMSV--DSYKKIIVSGSADKTIKVWHVESRTCYTLRGHTEWVNCVK 488

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSV---ASDGSMLV 175
           +HP      S   D  +R+WD+  N C+     H    +   PL  + V    +D   + 
Sbjct: 489 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGHVGQVQKVIPLTIIDVENLVTDSEDIT 548

Query: 176 AGNN-------------------KGNCYVWQMPH-QT-DAANPKPVTKFRSHAKYITRVL 214
           A ++                     N     +P  QT D + P P               
Sbjct: 549 ASDDDVAMTNDTTTNEPTTNNNDNANGVDENLPQTQTLDESIPYPT-------------- 594

Query: 215 LSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYV 274
                 HL +CS D+T ++W +     + T    H   VWD A  AD+  +++   D  +
Sbjct: 595 ------HLLSCSLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSI 645

Query: 275 RLWDLSTREIVRQYGG 290
           ++WDL + + +  + G
Sbjct: 646 KIWDLQSGKCMHTFHG 661

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 77/177 (43%), Gaps = 15/177 (8%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126
           +  F+GH   V ++ F    + + + S D TI +WD+ +   ++R   H   V    +H 
Sbjct: 355 IQEFKGHLDGVLTLQFNY--RLLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVK--TLHF 410

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           +  +L++   D  +R+W+    QC+       D+    +SV S   ++V+G+      VW
Sbjct: 411 DDQKLVTGSLDKTIRVWNYKTGQCISTYRGHTDS---IMSVDSYKKIIVSGSADKTIKVW 467

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +  +T           R H +++  V L        + S D T R+W I  N  L+
Sbjct: 468 HVESRT-------CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 517

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 13/161 (8%)

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L +   D  + IWDL  N+ + +L+   D  +++L    D   LV G+      VW    
Sbjct: 375 LFTGSYDSTIAIWDLCSNKLIRRLSGHTDG-VKTLHF--DDQKLVTGSLDKTIRVW---- 427

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             +    + ++ +R H   I  V   S  K + + SAD T +VW ++   +   TL  H 
Sbjct: 428 --NYKTGQCISTYRGHTDSIMSV--DSYKKIIVSGSADKTIKVWHVES--RTCYTLRGHT 481

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
            WV        S    +   D  +R+WD+ T   ++ + GH
Sbjct: 482 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGH 522

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 438 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 496

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI--DDN---------F 240
            D+ N         H   +  V+ + D   + + S D + ++W++  D N          
Sbjct: 497 LDSEN----ELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPG 552

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 553 TCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAV 612

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D          D +F+ AAG L+  VR++D  T
Sbjct: 432 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFI-AAGSLDRAVRVWDSET 490

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA 106
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R 
Sbjct: 491 GFLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRG 539

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 17/155 (10%)

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           N GE ++   +   +++ + +   + +L+  DD   Q  + A   +     NN  N +V 
Sbjct: 311 NDGEYLATGCNKTTQVFRVSDGALIARLS--DDAASQVAAPAGSPANADEPNNDVNSFV- 367

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
                          K  S   YI  V  S D K LAT + D   R+W I    Q+   L
Sbjct: 368 -------------TAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKK-QIVMVL 413

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
             H++ ++   +      LV+   D  VR+WDL T
Sbjct: 414 QGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 448

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD++ ++IV    GH +
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQ 418

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/344 (21%), Positives = 139/344 (40%), Gaps = 64/344 (18%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           + +   D+T R W+  T     T++   + V  +  S D   +A       +RL++  +T
Sbjct: 155 MVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWE--ST 212

Query: 64  NPNPV-------TSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSV 109
              PV       ++ +GH   +TS++++            + S+S+DGTIK+WD      
Sbjct: 213 KGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRVC 272

Query: 110 QRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGE---NQCVH-------------- 152
                  +     V    +G L S   D  VR+WD+      +C+               
Sbjct: 273 LYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSATVGKCISILKNHAHWVNHLSL 332

Query: 153 ------QLAPEDDTPLQSLSVAS---------------DGS---MLVAGNNKGNCYVWQM 188
                 ++ P D T ++  + A                +GS   ++V  ++    ++W  
Sbjct: 333 STDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNP 392

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
              T     KP+ +   H K +  V  S D +++ + S D++ ++W   D  +  +T   
Sbjct: 393 KKLT-----KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFLSTFRG 446

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHH 292
           H   V+  A+S+D   LV+   D  +++WD+ TR++     GH 
Sbjct: 447 HVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 490

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 120/301 (39%), Gaps = 61/301 (20%)

Query: 45  RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD- 103
           R +  AG    R++D  T  P  + + EGH   V  +++  + + + + S D TI++W+ 
Sbjct: 154 RMVTGAGDNTARIWDCDTQTP--LATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWES 211

Query: 104 VRAPSVQRNYKHQAAVN--------------EVVIHPNQGELISCDQDGNVRIWDLGENQ 149
            +   V       +A+                +V    +  L S  +DG ++IWD     
Sbjct: 212 TKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRV 271

Query: 150 CVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKY 209
           C++ L+   ++ +  +    +G +L +G++     VW M     A   K ++  ++HA +
Sbjct: 272 CLYTLSGHSNS-VACVKWGGEG-LLYSGSHDKTVRVWDM---NSATVGKCISILKNHAHW 326

Query: 210 ITRVLLSSDV---------------------------------------KHLATCSADHT 230
           +  + LS+D                                        + + T S D T
Sbjct: 327 VNHLSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFT 386

Query: 231 ARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
             +W+     +    +  HQ+ V   AFS D  Y+V+A  D+ ++LWD    + +  + G
Sbjct: 387 MFLWNPKKLTKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRG 446

Query: 291 H 291
           H
Sbjct: 447 H 447

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 108/284 (38%), Gaps = 69/284 (24%)

Query: 4   ILASAGYDHTIRFWE---ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60
           +L S  +D T+R W+   A  G C   +++    VN L +S+D           +R+   
Sbjct: 293 LLYSGSHDKTVRVWDMNSATVGKCISILKNHAHWVNHLSLSTD---------YALRIGPF 343

Query: 61  RTTNPNPVTSFEGHR---GNVTSIAFQ--QENKWMVSSSEDGTIKVWDVR--APSVQRNY 113
             T   P T  E  R    N   +A +     + MV++S+D T+ +W+ +     + R  
Sbjct: 344 DHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMT 403

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            HQ  VN V   P                                           DG  
Sbjct: 404 GHQKLVNHVAFSP-------------------------------------------DGRY 420

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           +V+ +   +  +W      D  + K ++ FR H   + +V  SSD + L +CS D T +V
Sbjct: 421 IVSASFDNSIKLW------DGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 474

Query: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           W +    +L   L  HQ  V+   +S D   + +   D  VR+W
Sbjct: 475 WDVRTR-KLSVDLPGHQDEVFTVDWSVDGKRVCSGGKDKMVRIW 517

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 59/158 (37%), Gaps = 19/158 (12%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S       S +V G       +W    QT      P+     H+ ++  V
Sbjct: 135 IAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCDTQT------PLATLEGHSNWVLCV 188

Query: 214 LLSSDVKHLATCSADHTARVWS------IDDNFQLETTLDNHQRWVWDCAFSA-----DS 262
             S D + +AT S D T R+W       +       + L  H +W+   ++       D 
Sbjct: 189 SWSPDGEVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDG 248

Query: 263 AY--LVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           A   L +A  D  +++WD + R  +    GH     CV
Sbjct: 249 AKPRLASASKDGTIKIWDTARRVCLYTLSGHSNSVACV 286

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 257 AFSAD-SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           AF+ D S+ +VT   D+  R+WD  T+  +    GH    +CV+
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVS 189

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 103/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD-----------NF 240
            D+ N         H   +  V+ + D + + + S D + ++W++ +           + 
Sbjct: 565 LDSENESGT----GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 680

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%), Gaps = 21/160 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D  V  + +S       AAG L+  VR++D  T
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSET 558

Query: 63  TN-----PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK--- 114
                   +   S  GH+ +V S+ F ++ + +VS S D ++K+W+++  + + + K   
Sbjct: 559 GFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPN 618

Query: 115 ----------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                     H+  V  V    N   ++S  +D  V  WD
Sbjct: 619 SGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 53/148 (35%), Gaps = 13/148 (8%)

Query: 155 APEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVL 214
           +P  D  ++S+  + DG  L  G       +W      D  N K V   + H + I  + 
Sbjct: 439 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIENRKIVMILQGHEQDIYSLD 492

Query: 215 LSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYV 274
                  L + S D T R+W +    Q   TL              D  Y+     D  V
Sbjct: 493 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 551

Query: 275 RLWDLSTREIVR------QYGGHHKGAI 296
           R+WD  T  +V       + G  HK ++
Sbjct: 552 RVWDSETGFLVERLDSENESGTGHKDSV 579

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 121/294 (41%), Gaps = 35/294 (11%)

Query: 35  VNRLEISSDKRF-LAAAGHLNVRLYDIRTTNPN-PVTSFEGHRGNVTSIAFQQENKWMVS 92
           +  L  S D RF L  +  L+ +++ + +   +   T+F GHR  V    F  + + + +
Sbjct: 149 ITSLTWSQDSRFVLTTSKDLSTKIWSVNSDEKDLAATTFNGHRDYVMGAFFSHDQEKIYT 208

Query: 93  SSEDGTIKVWDV-RAPSVQRN----------------------YKHQAAVNEVVIHPNQG 129
            S+DG + VW+  R P+   N                      Y +Q+ V  V  HP   
Sbjct: 209 VSKDGAVFVWEFTRRPTDDDNEEEEEEVDISKYSWRITKKHFFYANQSKVKCVTFHPATR 268

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQM 188
            L      G  R++DL +   + QL+   + P+ ++SV S G  L  G++K G   V++ 
Sbjct: 269 LLAVGFTSGEFRLYDLPDFTLIQQLSMGQN-PVNTVSVNSTGEWLAFGSSKLGQLLVYEW 327

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
             ++       + K + H      +  S D   + T S D   +VW I   F L  T + 
Sbjct: 328 QSES------YILKQQGHFDSTNCLAYSPDGSRVVTASDDGKIKVWDITSGFCL-ATFEE 380

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
           H   V    F+     + ++  D  VR WDL      R + G  +    C+A++
Sbjct: 381 HTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 434

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 12/169 (7%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGE 130
           +GH  +   +A+  +   +V++S+DG IKVWD+ +      + +H ++V  V        
Sbjct: 337 QGHFDSTNCLAYSPDGSRVVTASDDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 396

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVW--Q 187
           + S   DG VR WDL   +        +      L+V   G ++ AG+ +  + +VW  Q
Sbjct: 397 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 456

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
                DA +         H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 457 TGQLLDALS--------GHEGPVSCLSFSQENSVLASASWDKTIRIWSI 497

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 97/244 (39%), Gaps = 52/244 (21%)

Query: 44  KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103
           K+ L+  G+  V ++D+   N +    +E HR N+ +I   ++   ++S  EDG   + +
Sbjct: 27  KQLLSPVGN-RVSVFDL-INNKSFTFEYE-HRKNIAAIDLNKQGTLLISIDEDGRAILVN 83

Query: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQ 163
            +A +V  ++  +   + V   P+ G+L +      ++IW   +     Q A        
Sbjct: 84  FKARNVLHHFNFKEKCSAVKFSPD-GKLFALAAGRFLQIWKTPDANKDRQFA-------- 134

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKY---ITRVLLSSDVK 220
                                              P  ++R HA +   IT +  S D +
Sbjct: 135 -----------------------------------PFVRYRVHAGHFQDITSLTWSQDSR 159

Query: 221 HLATCSADHTARVWSI--DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278
            + T S D + ++WS+  D+     TT + H+ +V    FS D   + T   D  V +W+
Sbjct: 160 FVLTTSKDLSTKIWSVNSDEKDLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWE 219

Query: 279 LSTR 282
            + R
Sbjct: 220 FTRR 223

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 102/221 (46%), Gaps = 22/221 (9%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS  N L  S D  R + A+    ++++DI  T+   + +FE H  +VT++ F +  +
Sbjct: 339 HFDS-TNCLAYSPDGSRVVTASDDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFAKRGQ 395

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELISCDQDGN--VR 141
            M SSS DGT++ WD+      RN++      +   N + + P+ GE++      N  + 
Sbjct: 396 VMFSSSLDGTVRAWDLIR---YRNFRTFTGTERIQFNCLAVDPS-GEVVCAGSLDNFDIH 451

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVT 201
           +W +   Q +  L+   + P+  LS + + S+L + +      +W +  ++    P  V 
Sbjct: 452 VWSVQTGQLLDALSGH-EGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVY 510

Query: 202 KFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
                   +  + +  D K +A  +      +++I+D  Q+
Sbjct: 511 ------SDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQV 545

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +      + A    N  ++    
Sbjct: 396 VMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 455

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                + +  GH G V+ ++F QEN  + S+S D TI++W +   S Q    +  + V  
Sbjct: 456 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLA 515

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDTPL 162
           + + P+  E+      G + I+++ + + V  +                     E     
Sbjct: 516 LSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNEDRFTAKNSERSKFF 575

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            ++  + DG  +VAG N  +  ++ +P++
Sbjct: 576 TTIHYSFDGMAIVAGGNNNSICLYDVPNE 604

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 103/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 510 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD-----------NF 240
            D+ N         H   +  V+ + D + + + S D + ++W++ +           + 
Sbjct: 569 LDSENESGT----GHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 624

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 625 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 684

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 21/160 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D          D +++ AAG L+  VR++D  T
Sbjct: 504 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI-AAGSLDRAVRVWDSET 562

Query: 63  TN-----PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK--- 114
                   +   S  GH+ +V S+ F ++ + +VS S D ++K+W+++  + + + K   
Sbjct: 563 GFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPN 622

Query: 115 ----------HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
                     H+  V  V    N   ++S  +D  V  WD
Sbjct: 623 SGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 662

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD+  R+IV    GH +
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 490

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 52/147 (35%), Gaps = 13/147 (8%)

Query: 156 PEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL 215
           P  D  ++S+  + DG  L  G       +W      D  N K V   + H + I  +  
Sbjct: 444 PSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIENRKIVMILQGHEQDIYSLDY 497

Query: 216 SSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVR 275
                 L + S D T R+W +    Q   TL              D  Y+     D  VR
Sbjct: 498 FPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVR 556

Query: 276 LWDLSTREIVR------QYGGHHKGAI 296
           +WD  T  +V       + G  HK ++
Sbjct: 557 VWDSETGFLVERLDSENESGTGHKDSV 583

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQ--------HSDSQVNRLEISSDKRFLAAAGHLNVR 56
           +A+   D  +R W++ TG     +         H DS  + +     +  ++ +   +V+
Sbjct: 546 IAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVK 605

Query: 57  LYDIRTTN-------PNPVT---SFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA 106
           L++++  N       PN  T   ++ GH+  V S+A  Q +++++S S+D  +  WD ++
Sbjct: 606 LWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKS 665

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 110/271 (40%), Gaps = 34/271 (12%)

Query: 35  VNRLEISSDKRFL-AAAGHLNVRLYDIRTTNPN-PVTSFEGHRGNVTSIAFQQENKWMVS 92
           +  L  S D RF+ + +  L  +++ + +   +   T+F GHR  V    F ++ + + +
Sbjct: 149 ITSLTWSQDSRFIISTSKDLTAKIWSVFSEEKDLAATTFAGHRDYVMGAFFSKDQEKIYT 208

Query: 93  SSEDGTIKVWDVRAPSVQRN-----------------------YKHQAAVNEVVIHPNQG 129
            S+DG + +W+  A   +                         Y +QA V  V  HP   
Sbjct: 209 VSKDGAVFIWEFTAKETEEEEEDSDEEIDISKYSWRISQKHFFYANQAKVKCVTFHPASS 268

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQM 188
            L+     G  R+++L     + QL+   + P+ S+S+   G  L  G++K G   V++ 
Sbjct: 269 LLVVGFTTGEFRLYELPSFTLIQQLSMGQN-PINSVSINESGEWLAFGSSKLGQLLVYEW 327

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
             ++       + K + H      +  S D   + T + D   +VW +   F L  T + 
Sbjct: 328 QSES------YILKQQGHFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCL-ATFEE 380

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           H   V    F+     L +A  D  VR WDL
Sbjct: 381 HTSSVTQVQFAKKGQVLFSASLDGTVRAWDL 411

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 99/225 (44%), Gaps = 8/225 (3%)

Query: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEG 73
            R +E  +    + +    + +N + I+    +LA       +L      + + +   +G
Sbjct: 279 FRLYELPSFTLIQQLSMGQNPINSVSINESGEWLAFGSSKLGQLLVYEWQSESYILKQQG 338

Query: 74  HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGELI 132
           H  +  S+ +  +   +V+++EDG IKVWDV +      + +H ++V +V        L 
Sbjct: 339 HFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFEEHTSSVTQVQFAKKGQVLF 398

Query: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVWQMPHQ 191
           S   DG VR WDL   +        +     SL+V   G ++ AG+ +  + +VW +  Q
Sbjct: 399 SASLDGTVRAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSVDSFDIHVWSV--Q 456

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
           T     + +     H   I+ +  S +   LA+ S D T R+WSI
Sbjct: 457 TG----QLLDTLAGHEGPISCLAFSQENSILASASWDKTIRIWSI 497

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 90/209 (43%), Gaps = 10/209 (4%)

Query: 81  IAFQQENKWMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGN 139
           I F  + K ++S   +  + V+D +   S    Y+H+  +  + ++     ++S D DG 
Sbjct: 20  IVFSNDGKQLLSPVGN-RVSVFDLINNKSFTFEYEHRKNIAAIDLNRQGTLMLSIDDDGR 78

Query: 140 VRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKP 199
             + +      +H    ++      +  + DG +      +    +W+ P  T      P
Sbjct: 79  AILVNFKSRNVMHHFNFKEKC--YQVKFSPDGKLFALATGRF-LQIWKTPDVTQDRQFAP 135

Query: 200 VTKFRSHAKY---ITRVLLSSDVKHLATCSADHTARVWSI--DDNFQLETTLDNHQRWVW 254
             ++R HA +   IT +  S D + + + S D TA++WS+  ++     TT   H+ +V 
Sbjct: 136 FVRYRVHAGHFQDITSLTWSQDSRFIISTSKDLTAKIWSVFSEEKDLAATTFAGHRDYVM 195

Query: 255 DCAFSADSAYLVTACSDHYVRLWDLSTRE 283
              FS D   + T   D  V +W+ + +E
Sbjct: 196 GAFFSKDQEKIYTVSKDGAVFIWEFTAKE 224

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/283 (19%), Positives = 122/283 (43%), Gaps = 35/283 (12%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS  N L  S D  R + AA    ++++D+   +   + +FE H  +VT + F ++ +
Sbjct: 339 HFDS-TNSLTYSPDGSRVVTAAEDGKIKVWDV--VSGFCLATFEEHTSSVTQVQFAKKGQ 395

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELI---SCDQDGNV 140
            + S+S DGT++ WD+      RN++      +   N + + P+ GE++   S D   ++
Sbjct: 396 VLFSASLDGTVRAWDLIR---YRNFRVFTAAERIQFNSLAVDPS-GEVVCAGSVDS-FDI 450

Query: 141 RIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPV 200
            +W +   Q +  LA  +  P+  L+ + + S+L + +      +W +  ++    P  V
Sbjct: 451 HVWSVQTGQLLDTLAGHEG-PISCLAFSQENSILASASWDKTIRIWSIFGRSQQVEPIEV 509

Query: 201 ------TKFRSHAKYITRVLLSSDVKHLATCSADHTARV---------WSIDDNFQLETT 245
                    R   K++    L   +      S      +           ++D F  +T+
Sbjct: 510 YSDVVALTIRPDGKHVAVSTLRGQITMFDIESGQQIGNIDCRKDIISGRHLEDRFTSKTS 569

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
                ++     +S D   +V   +++ + L+D+    ++R++
Sbjct: 570 --ERSKFFTTIHYSFDGMAIVAGGNNNSICLYDIPNEVLLRRF 610

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 88/211 (41%), Gaps = 25/211 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAG--HLNVRLYDI 60
           +L SA  D T+R W+ +     R    ++  Q N L +      + A      ++ ++ +
Sbjct: 396 VLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSVDSFDIHVWSV 455

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAV 119
           +T     + +  GH G ++ +AF QEN  + S+S D TI++W +   S Q    +  + V
Sbjct: 456 QT--GQLLDTLAGHEGPISCLAFSQENSILASASWDKTIRIWSIFGRSQQVEPIEVYSDV 513

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDT 160
             + I P+   +      G + ++D+   Q +  +                     E   
Sbjct: 514 VALTIRPDGKHVAVSTLRGQITMFDIESGQQIGNIDCRKDIISGRHLEDRFTSKTSERSK 573

Query: 161 PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
              ++  + DG  +VAG N  +  ++ +P++
Sbjct: 574 FFTTIHYSFDGMAIVAGGNNNSICLYDIPNE 604

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 127/274 (46%), Gaps = 32/274 (11%)

Query: 35  VNRLEISSDKRFLAAAGH-LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE----NKW 89
           V  L+IS  KR+L +  +  ++R+YD++      + +   H+G++T++ F +     NKW
Sbjct: 44  VKTLDIS--KRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITALKFSKNEASTNKW 99

Query: 90  MVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN 148
           ++S+SED  I +W V+        K H   +N++ IHP+    IS  +D ++R+W+L   
Sbjct: 100 LLSASEDKKIIIWRVKDWENYGTLKGHTGRINDLDIHPSSRIAISVSEDHSIRLWNL--- 156

Query: 149 QCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQ-----TDAANPKPVTKF 203
                +  +    L+    + +G  +    + G+ +   + ++     T  A       F
Sbjct: 157 -----MTVKKAAVLKLRGYSQNGQFVRWLGSSGDFFAVALLNKVLIYTTATAKVHSEIDF 211

Query: 204 RSHAKYITRVLLSSDVKHLATCSADHTARVWSID-------DNFQLETTLDNHQRWVWDC 256
           +    ++ +V+L ++ ++L    +D     +          ++F+ E +L  H   V D 
Sbjct: 212 KKTIMHMEKVVLDNEKEYLCIGLSDGNIEFYETGLLCKEGAEDFKPEFSLLGHTNRVKDF 271

Query: 257 AFSAD--SAYLVTACSDHYVRLWDLSTREIVRQY 288
            F  +    YLV+  SD  + +WD+  +E +  Y
Sbjct: 272 KFYQNEFGIYLVSIGSDGKIVVWDMKKQEQLAVY 305

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 66/172 (38%), Gaps = 19/172 (11%)

Query: 2   SVILASAGYDHTIRFWEALT----GVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRL 57
           S I  S   DH+IR W  +T     V        + Q  R  + S   F A A    V +
Sbjct: 139 SRIAISVSEDHSIRLWNLMTVKKAAVLKLRGYSQNGQFVRW-LGSSGDFFAVALLNKVLI 197

Query: 58  YDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD--VRAPSVQRNYK- 114
           Y   T   +    F+    ++  +    E +++     DG I+ ++  +       ++K 
Sbjct: 198 YTTATAKVHSEIDFKKTIMHMEKVVLDNEKEYLCIGLSDGNIEFYETGLLCKEGAEDFKP 257

Query: 115 ------HQAAVNEVVIHPNQG--ELISCDQDGNVRIWDLGENQCVHQLAPED 158
                 H   V +   + N+    L+S   DG + +WD+ + +   QLA  D
Sbjct: 258 EFSLLGHTNRVKDFKFYQNEFGIYLVSIGSDGKIVVWDMKKQE---QLAVYD 306

>SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} similar
           to uniprot|P36037 Saccharomyces cerevisiae YKL213C DOA1
           WD repeat protein required for ubiquitin- mediated
           protein degradation forms complex with Cdc48p plays a
           role in controlling cellular ubiquitin concentration
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 711

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 19/283 (6%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQH-SDSQVNRL--EISSDKRFLAAAGHLNVRLYDIR 61
           +AS   D T+R W    GV +  I H S+  +N L  + SS   F      L   +  + 
Sbjct: 26  VASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYGGQDTLVGGISPLA 85

Query: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNE 121
           TT+ +PV    GH+GNV S++   +N +++SSS D T KVW     ++     H A+V +
Sbjct: 86  TTDEDPVYMLIGHKGNVCSLS--SKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWD 142

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
               P +   ++   D  +++W    N+ +   +      ++ L ++ DG    + +N G
Sbjct: 143 AKFLPEKDFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDG 200

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQ 241
              +  M           +  F  H  ++  V    +   L +C  D + RVWS     +
Sbjct: 201 TVKINDMDGNI-------LKTFTGHESFVYSVKFLPN-GDLVSCGEDRSVRVWSKTGAVK 252

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREI 284
               L     W  D   + D   ++   SD+ VR++ +    I
Sbjct: 253 QVLRLPAVSIWDLDILPNGD---ILVGSSDNMVRIFTVEESRI 292

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 70/174 (40%), Gaps = 10/174 (5%)

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
           V+  N  ++ SC +DG VR+W   +      +A   +  + SL       +L  G   G 
Sbjct: 18  VVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYG---GQ 74

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
             +          +  PV     H   +    LSS    + + S D TA+VW    N   
Sbjct: 75  DTLVGGISPLATTDEDPVYMLIGHKGNVCS--LSSKNNFVISSSWDKTAKVWH---NGSA 129

Query: 243 ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
              L  H   VWD  F  +  + +TA +D  ++LW     ++++ + G HK  I
Sbjct: 130 IYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLW--HGNKLIKTFSGIHKDVI 181

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 501

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW      +  +
Sbjct: 502 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 560

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD-----------NF 240
            D+ N         H   +  V+ + D   + + S D + ++W++ +           + 
Sbjct: 561 LDSENESGT----GHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSG 616

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA+
Sbjct: 617 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 676

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 72/160 (45%), Gaps = 21/160 (13%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D          D +++ AAG L+  VR++D  T
Sbjct: 496 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI-AAGSLDRAVRVWDSET 554

Query: 63  TN-----PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW---------DVRAP- 107
                   +   S  GH+ +V S+ F ++   +VS S D ++K+W         D +AP 
Sbjct: 555 GFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPN 614

Query: 108 --SVQRNY-KHQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
             + +  Y  H+  V  V    N   ++S  +D  V  WD
Sbjct: 615 SGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 654

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WD+  R+IV    GH +
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQ 482

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 52/148 (35%), Gaps = 13/148 (8%)

Query: 155 APEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVL 214
           +P  D  ++S+  + DG  L  G       +W      D    K V   + H + I  + 
Sbjct: 435 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIEKRKIVMILQGHEQDIYSLD 488

Query: 215 LSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYV 274
                  L + S D T R+W +    Q   TL              D  Y+     D  V
Sbjct: 489 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 547

Query: 275 RLWDLSTREIVRQY------GGHHKGAI 296
           R+WD  T  +V +       G  HK ++
Sbjct: 548 RVWDSETGFLVERLDSENESGTGHKDSV 575

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 110/245 (44%), Gaps = 10/245 (4%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L S   D T++ W+       R      S V  + I      +A AG  +V +L+DIRT 
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIRTR 256

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
            P  V +  GH+G +  +     +  +VSSS D T+++WD+ A    +    H+ +V  +
Sbjct: 257 VP--VITLVGHKGPINQVECAPVDPQIVSSSTDATVRLWDIVAGKAMKVLTHHKRSVRAI 314

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG- 181
            +HPN+  + S   D ++R W L +   +     E    + +LS+  D  +L AG + G 
Sbjct: 315 ALHPNEFSMASACTD-DIRSWGLADGSLLTNFESEKTGIINTLSINQD-DVLFAGGDDGM 372

Query: 182 -NCYVWQMPHQTDA-ANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
            + Y ++  H+  + A  + +    S    +      + ++ L T   D + ++W  D+ 
Sbjct: 373 LSFYDYKSGHKYQSLATREMIGSLESERGVLCSTFDKTGLR-LITGETDKSIKIWKQDET 431

Query: 240 FQLET 244
              E+
Sbjct: 432 ASRES 436

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 95/226 (42%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V   A    +N+W V+ S D T+KVWD+ +  ++     H   V ++ +      
Sbjct: 137 GHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTLTGHVMTVRDIAVSDRHPY 196

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L S  +D  V+ WDL +NQ +        + ++++S+     ++          +W    
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYHGH-LSGVRTVSIHPTLDLIATAGRDSVVKLW---- 251

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             D     PV     H   I +V  +     + + S D T R+W I     ++  L +H+
Sbjct: 252 --DIRTRVPVITLVGHKGPINQVECAPVDPQIVSSSTDATVRLWDIVAGKAMK-VLTHHK 308

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V   A   +   + +AC+D  +R W L+   ++  +     G I
Sbjct: 309 RSVRAIALHPNEFSMASACTDD-IRSWGLADGSLLTNFESEKTGII 353

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 103/266 (38%), Gaps = 22/266 (8%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
           F+  +    ++++D+ +       +  GH   V  IA    + ++ S SED T+K WD+ 
Sbjct: 155 FVTGSNDTTMKVWDLASGKLK--VTLTGHVMTVRDIAVSDRHPYLFSVSEDKTVKCWDLE 212

Query: 106 APSVQRNY-KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQS 164
              + R+Y  H + V  V IHP    + +  +D  V++WD+     V  L      P+  
Sbjct: 213 KNQIIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIRTRVPVITLVGHKG-PINQ 271

Query: 165 LSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLAT 224
           +  A     +V+ +      +W      D    K +     H + +  + L  +   +A+
Sbjct: 272 VECAPVDPQIVSSSTDATVRLW------DIVAGKAMKVLTHHKRSVRAIALHPNEFSMAS 325

Query: 225 CSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD------ 278
              D   R W + D   L T  ++ +  + +         L     D  +  +D      
Sbjct: 326 ACTDDI-RSWGLADG-SLLTNFESEKTGIINTLSINQDDVLFAGGDDGMLSFYDYKSGHK 383

Query: 279 ---LSTREIVRQYGGHHKGAICVALN 301
              L+TRE++       +G +C   +
Sbjct: 384 YQSLATREMIGSLES-ERGVLCSTFD 408

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 81/193 (41%), Gaps = 12/193 (6%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS-DKRFLAAAGHLNVRLYDIRT 62
           ++A+AG D  ++ W+  T V   T+      +N++E +  D + ++++    VRL+DI  
Sbjct: 238 LIATAGRDSVVKLWDIRTRVPVITLVGHKGPINQVECAPVDPQIVSSSTDATVRLWDIVA 297

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
                V +   H+ +V +IA       M S+  D  I+ W +   S+  N++ +      
Sbjct: 298 GKAMKVLTH--HKRSVRAIALHPNEFSMASACTDD-IRSWGLADGSLLTNFESEKTGIIN 354

Query: 123 VIHPNQGE-LISCDQDGNVRIWDLGENQCVHQLAP-------EDDTPLQSLSVASDGSML 174
            +  NQ + L +   DG +  +D         LA        E +  +   +    G  L
Sbjct: 355 TLSINQDDVLFAGGDDGMLSFYDYKSGHKYQSLATREMIGSLESERGVLCSTFDKTGLRL 414

Query: 175 VAGNNKGNCYVWQ 187
           + G    +  +W+
Sbjct: 415 ITGETDKSIKIWK 427

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 102/241 (42%), Gaps = 23/241 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   +G  + AG+      VW      +  +
Sbjct: 441 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLDRTLRVWDSETGFLVER 499

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN------------ 239
            D+ N         H   +  V+ + D + + + S D + ++W++ +             
Sbjct: 500 LDSEN----ELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTA 555

Query: 240 FQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
              E T   H+ +V   A + +  Y+++   D  V  WD  +   +    GH    I VA
Sbjct: 556 ATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVA 615

Query: 300 L 300
           +
Sbjct: 616 V 616

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 106/267 (39%), Gaps = 43/267 (16%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
            LA+   D  IR W+  T     T+Q  +  +  L+   S  + ++ +G   VR++D+RT
Sbjct: 392 FLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 451

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSV--------QRNY 113
              +   S E     VT++A    E K++ + S D T++VWD     +        +   
Sbjct: 452 GQCSLTLSIE---DGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGT 508

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQS--------- 164
            H+ +V  VV   +   ++S   D +V++W+L       +    D  P  +         
Sbjct: 509 GHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSK---NDSKPTAATCEVTYTGH 565

Query: 165 ----LSVAS--DGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVL---- 214
               LSVA+  +   +++G+       W      D  +  P+   + H   +  V     
Sbjct: 566 KDFVLSVATTQNDKYILSGSKDRGVLFW------DTQSGNPLLMLQGHRNSVISVAVANG 619

Query: 215 --LSSDVKHLATCSADHTARVWSIDDN 239
             L  D    AT S D  AR+W    N
Sbjct: 620 FPLGPDYGVFATGSGDCKARIWKYSKN 646

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WDLST+ IV    GH +
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQ 421

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG ++ AG+      +W      +  +
Sbjct: 511 DRTVRIWDLRAGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 569

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID-----------DNF 240
            D+ N         H   +  V+ + D   + + S D + ++W++            +  
Sbjct: 570 LDSEN----ELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTA 625

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  ++++   D  V  WD  +   +    GH    I VA+
Sbjct: 626 ASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 685

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 85/207 (41%), Gaps = 22/207 (10%)

Query: 105 RAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQS 164
           + P+V  +      +  V   P+   L +  +D  +RIWDL   + V  L   +   + S
Sbjct: 437 QTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQD-IYS 495

Query: 165 LSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLS-SDVKHLA 223
           L     G  LV+G+      +W +            +   S    +T V +S  D K +A
Sbjct: 496 LDYFPSGDKLVSGSGDRTVRIWDL-------RAGQCSLTLSIEDGVTTVAVSPGDGKLIA 548

Query: 224 TCSADHTARVWSIDDNFQLETTLDN-------HQRWVWDCAFSADSAYLVTACSDHYVRL 276
             S D T R+W  +  F +E  LD+       H+  V+   F+ D   +V+   D  V+L
Sbjct: 549 AGSLDRTVRIWDSETGFLVE-RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 607

Query: 277 WDLSTREIVRQYGGHHKGAICVALNDV 303
           W+L +       GG  +G    A ++V
Sbjct: 608 WNLRSAN-----GGSTEGKANTAASEV 629

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 72/162 (44%), Gaps = 25/162 (15%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+   G CS T+   D  V  + +S     L AAG L+  VR++D  T
Sbjct: 505 LVSGSGDRTVRIWDLRAGQCSLTLSIEDG-VTTVAVSPGDGKLIAAGSLDRTVRIWDSET 563

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR---------- 105
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R          
Sbjct: 564 GFLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGK 621

Query: 106 ---APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
              A S      H+  V  V    N   ++S  +D  V  WD
Sbjct: 622 ANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWD 663

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 105/258 (40%), Gaps = 36/258 (13%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
            LA+   D  IR W+  T     T+Q  +  +  L+   S  + ++ +G   VR++D+R 
Sbjct: 462 FLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRA 521

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSV--------QRNY 113
              +   S E     VT++A    + K + + S D T+++WD     +        +   
Sbjct: 522 GQCSLTLSIE---DGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT 578

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDL-----GENQCVHQLAPEDDTP------L 162
            H+ +V  VV   +   ++S   D +V++W+L     G  +     A  + T       +
Sbjct: 579 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFV 638

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSD---- 218
            S++   +   +++G+       W  P      +  P+   + H   +  V +++D    
Sbjct: 639 LSVATTQNDEFILSGSKDRGVLFWDTP------SGNPLLMLQGHRNSVISVAVANDHPLG 692

Query: 219 --VKHLATCSADHTARVW 234
                 AT S D  AR+W
Sbjct: 693 PEYGVFATGSGDCKARIW 710

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 63/153 (41%), Gaps = 19/153 (12%)

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           N GE ++   +   +++ +   + V +L+              D +   +GN+       
Sbjct: 386 NDGEYLATGCNKTTQVYKVSTGELVARLS-------------EDAASAPSGNSGDGASGA 432

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
           +   QT A     V+   S   YI  V  S D K LAT + D   R+W +    ++  TL
Sbjct: 433 ENAEQTPA-----VSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTR-RIVMTL 486

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
             H++ ++   +      LV+   D  VR+WDL
Sbjct: 487 QGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL 519

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 97/226 (42%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GHRG V  +     +N+W  + S D TIKVWD+ +  ++   + H   V ++ I      
Sbjct: 112 GHRGWVRCVKVDPVDNEWFATGSNDSTIKVWDLASGKLKVTLQGHIMTVKDIAISTRHPY 171

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           + S  +D  V+ WDL +N  +        + + S+ V     ++V+        +W +  
Sbjct: 172 MFSASEDKLVKCWDLEKNMVIRDFYGT-LSGVYSVDVHPTLDLIVSAGRDSVVRIWDIRS 230

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
           +T       V     H   I +    +    + +CS D T R+W I     ++ TL +H+
Sbjct: 231 RT------CVMTLAGHKGPINKARCLAVDPQVVSCSTDATVRLWDITAGKTIK-TLTHHK 283

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V D  F+       TAC+D  +R W L   +++  +     G I
Sbjct: 284 RNVRDITFNPAEFSFTTACTDD-IRSWMLPKGQLLTNFQSDSLGII 328

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 112/255 (43%), Gaps = 12/255 (4%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           + SA  D  ++ W+    +  R    + S V  +++      + +AG  +V R++DIR+ 
Sbjct: 172 MFSASEDKLVKCWDLEKNMVIRDFYGTLSGVYSVDVHPTLDLIVSAGRDSVVRIWDIRSR 231

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-PSVQRNYKHQAAVNEV 122
               V +  GH+G +        +  +VS S D T+++WD+ A  +++    H+  V ++
Sbjct: 232 TC--VMTLAGHKGPINKARCLAVDPQVVSCSTDATVRLWDITAGKTIKTLTHHKRNVRDI 289

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
             +P +    +   D ++R W L + Q +     +    + SLS   DG +L AG++ G+
Sbjct: 290 TFNPAEFSFTTACTD-DIRSWMLPKGQLLTNFQSDSLGIINSLSCNQDG-VLFAGSDDGH 347

Query: 183 C--YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
              + ++  H+  +     V       + I      +    L TC  D + ++W+ D + 
Sbjct: 348 LSFFDYKSGHKYQSTQTIEVPGSLESERGILASCFDATGLRLITCERDKSIKIWNQDADA 407

Query: 241 QLETTLDNHQRWVWD 255
             ET    H    WD
Sbjct: 408 SPET----HPSLPWD 418

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 218 DVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           D +  AT S D T +VW +    +L+ TL  H   V D A S    Y+ +A  D  V+ W
Sbjct: 126 DNEWFATGSNDSTIKVWDLASG-KLKVTLQGHIMTVKDIAISTRHPYMFSASEDKLVKCW 184

Query: 278 DLSTREIVRQYGGHHKGAICV 298
           DL    ++R + G   G   V
Sbjct: 185 DLEKNMVIRDFYGTLSGVYSV 205

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 34/192 (17%), Positives = 70/192 (36%), Gaps = 53/192 (27%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
           ++ SAG D  +R W+  +  C  T+      +N+   ++ D + ++ +    VRL+DI  
Sbjct: 213 LIVSAGRDSVVRIWDIRSRTCVMTLAGHKGPINKARCLAVDPQVVSCSTDATVRLWDI-- 270

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQEN------------KWMV------------------- 91
           T    + +   H+ NV  I F                 WM+                   
Sbjct: 271 TAGKTIKTLTHHKRNVRDITFNPAEFSFTTACTDDIRSWMLPKGQLLTNFQSDSLGIINS 330

Query: 92  ----------SSSEDGTIKVWDVRAP---------SVQRNYKHQAAVNEVVIHPNQGELI 132
                     + S+DG +  +D ++           V  + + +  +           LI
Sbjct: 331 LSCNQDGVLFAGSDDGHLSFFDYKSGHKYQSTQTIEVPGSLESERGILASCFDATGLRLI 390

Query: 133 SCDQDGNVRIWD 144
           +C++D +++IW+
Sbjct: 391 TCERDKSIKIWN 402

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 132/311 (42%), Gaps = 42/311 (13%)

Query: 26  RTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI-------RTTNPNPVTSFEGHRGN- 77
           ++++H+ S V  ++ S+D ++LA   +   +++ +       R ++ N  +   G  G+ 
Sbjct: 310 KSLEHT-SVVCCVKFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSD 368

Query: 78  -------VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQG 129
                  + S+ F  + K++ + +ED  I++WD+    +    + H   V  +   P+  
Sbjct: 369 SGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGD 428

Query: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-- 187
           +L+S   D  VRIWDL   QC   L+ ED     ++S   DG  + AG+      VW   
Sbjct: 429 KLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSE 487

Query: 188 ---MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET 244
              +  + D+ N         H   +  V+ + D   + + S D + ++W++    + E 
Sbjct: 488 TGFLVERLDSENELGT----GHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKEN 543

Query: 245 TLDN---------------HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYG 289
             DN               H+ +V     +A+  ++++   D  V  WD +T   +    
Sbjct: 544 AADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQ 603

Query: 290 GHHKGAICVAL 300
           GH    I VA+
Sbjct: 604 GHRNSVISVAV 614

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 63/125 (50%), Gaps = 16/125 (12%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D  V  + +S       AAG L+  VR++D  T
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSET 488

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKH 115
                   + N + +  GHR +V S+ F ++   +VSSS D ++K+W++R      N K 
Sbjct: 489 GFLVERLDSENELGT--GHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRG----YNEKE 542

Query: 116 QAAVN 120
            AA N
Sbjct: 543 NAADN 547

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 78  VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136
           + S+ F  + K++ + +ED  I++WD+    +    + H+  +  +   P+  +L+S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 137 DGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQ 191
           D  VRIWDL   QC   L+ ED     ++S   DG ++ AG+      +W      +  +
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 591

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID-----------DNF 240
            D+ N         H   +  V+ + D   + + S D + ++W++            +  
Sbjct: 592 LDSEN----ELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTA 647

Query: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             E T   H+ +V   A + +  ++++   D  V  WD  +   +    GH    I VA+
Sbjct: 648 ASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 707

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 93/226 (41%), Gaps = 40/226 (17%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYDIRT 62
           L S   D T+R W+  TG CS T+   D  V  + +S     L AAG L+  VR++D  T
Sbjct: 527 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKLIAAGSLDRTVRIWDSET 585

Query: 63  T-------NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR---------- 105
                   + N + +  GH+ +V S+ F ++   +VS S D ++K+W++R          
Sbjct: 586 GFLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGK 643

Query: 106 ---APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL----------GENQCVH 152
              A S      H+  V  V    N   ++S  +D  V  WD           G    V 
Sbjct: 644 ANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVI 703

Query: 153 QLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPK 198
            +A  +D PL       +  +   G+      +W+   QT  A PK
Sbjct: 704 SVAVANDHPL-----GPEYGVFATGSGDCKARIWKYSKQTSNAEPK 744

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 105/258 (40%), Gaps = 36/258 (13%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
            LA+   D  IR W+  T     T+Q  +  +  L+   S  + ++ +G   VR++D+RT
Sbjct: 484 FLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 543

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSV--------QRNY 113
              +   S E     VT++A    + K + + S D T+++WD     +        +   
Sbjct: 544 GQCSLTLSIE---DGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT 600

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDL-----GENQCVHQLAPEDDTP------L 162
            H+ +V  VV   +   ++S   D +V++W+L     G  +     A  + T       +
Sbjct: 601 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSD---- 218
            S++   +   +++G+       W  P         P+   + H   +  V +++D    
Sbjct: 661 LSVATTQNDEFILSGSKDRGVLFWDTPSG------NPLLMLQGHRNSVISVAVANDHPLG 714

Query: 219 --VKHLATCSADHTARVW 234
                 AT S D  AR+W
Sbjct: 715 PEYGVFATGSGDCKARIW 732

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T   D  +R+WDL+TR IV    GH +
Sbjct: 472 YIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQ 513

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (42%), Gaps = 21/221 (9%)

Query: 77  NVTSIAFQQENKWMVSSSEDGT---------IKVWD-VRAPSVQRNYKHQAAVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D +   S    Y+H+  V  V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLIHNKSYTFEYEHRKNVQCVALNP 65

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
               L+S D+DG   + +      +H    ++  P+  L  + DG +      +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHFNFKE--PVSDLKFSPDGKVFAIACGR-FVQVW 122

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLL---SSDVKHLATCSADHTARVWSIDDNFQ-- 241
           + P   +     P  + R HA + + ++    S D + L + S D TAR+WS+D   +  
Sbjct: 123 KTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGL 182

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
              T   H+ +V    FSAD   + T   D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPR 223

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 112/274 (40%), Gaps = 35/274 (12%)

Query: 33  SQVNRLEISSDKRFL-AAAGHLNVRLYDIRTTNPNPVT-SFEGHRGNVTSIAFQQENKWM 90
           S +  L  S D RFL + +  L  R++ + +      + +F GHR  V    F  + + +
Sbjct: 147 SNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQERI 206

Query: 91  VSSSEDGTIKVWDVRA----------------PSV------QRNYKH--QAAVNEVVIHP 126
            + S+DG +  W+                   PS+      ++NY +  QA V  V  H 
Sbjct: 207 YTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWRITKKNYFYASQARVKCVTFHA 266

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYV 185
           N   L+    +G  R+++L E   + QL+   +  + ++ V   G  L  G++K G   V
Sbjct: 267 NSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNA-VNTVCVNDSGEWLAFGSSKLGQLLV 325

Query: 186 WQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETT 245
           ++   ++       + K + H      V  S D   + T S D   ++W +   F L  T
Sbjct: 326 YEWQSES------YILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCL-VT 378

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
              H   V   AF+     L +A  D  VR WDL
Sbjct: 379 FQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDL 412

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 94/212 (44%), Gaps = 18/212 (8%)

Query: 78  VTSIAFQQENKWM-VSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHPNQGELISCD 135
           V ++      +W+   SS+ G + V++ ++ S + +   H  A N V   P+   +++  
Sbjct: 301 VNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTAS 360

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
           +DG ++IWD+    C+     E    + +L+ A  G +L + +  G    W +    +  
Sbjct: 361 EDGKIKIWDVVSGFCLVTFQ-EHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRN-- 417

Query: 196 NPKPVTKFRSH--AKYITRVLLSSDVKHLATCSAD---HTARVWSIDDNFQLETTLDNHQ 250
                  FR+   A+ I    L++D      C+         VWS+    QL  TLD H+
Sbjct: 418 -------FRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQTG-QLVETLDGHE 469

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
             V   +FS +++ L +A  D  +R+W +  R
Sbjct: 470 GPVSCLSFSQENSVLASASWDKTIRIWSIFGR 501

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           +GH     ++ +  +   +V++SEDG IK+WDV +      ++ H AAV+ +        
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVWQMP 189
           L S   DG VR WDL   +        +      L+    G ++ AG+ +    +VW + 
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV- 456

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
            QT     + V     H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 457 -QTG----QLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 498

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 94/211 (44%), Gaps = 27/211 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAG--HLNVRLYDI 60
           +L SA  D T+R W+ +     RT   ++  Q N L        + A       V ++ +
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV 456

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAV 119
           +T     V + +GH G V+ ++F QEN  + S+S D TI++W +   S Q    +  A V
Sbjct: 457 QTGQL--VETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYADV 514

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTP------------------ 161
             + + P+  E+ +   DG +  +D+ E + V+ +  + D                    
Sbjct: 515 LSLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDGKKDILSGRHLEDRFTSQNSARSK 574

Query: 162 -LQSLSVASDG-SMLVAGNNKGNCYVWQMPH 190
              ++  + DG S++ AGNN   C ++ +P+
Sbjct: 575 HFTTIDYSFDGLSIVAAGNNNSIC-LYDIPN 604

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 121/281 (43%), Gaps = 27/281 (9%)

Query: 5   LASAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           LA+AG+ D  I+ W +L G    T+  +++     + ++D    +   H           
Sbjct: 502 LAAAGFQDSYIKIW-SLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKH---------QE 551

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
           + N  T   GH G V S +F  +NK ++S SED T+++W +   S   +YK H   V +V
Sbjct: 552 HVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDV 611

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVH----QLAPEDDTPLQSLSVASDGSMLVAGN 178
              P      +   D   R+W      C H    ++     + +  ++   +G  +  G+
Sbjct: 612 AFSPMGHYFATASHDQTARLW-----SCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGS 666

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
           +   C +W      D +  + V  F  H   +  + +S D + LA+ S D    VW I  
Sbjct: 667 SDKTCRMW------DVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
             +L+    + +  V    FS +   +++  +D+ VR+WD+
Sbjct: 721 GKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 82/193 (42%), Gaps = 16/193 (8%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRL----- 57
           +L S   D T+R W   T     + +  +  V  +  S    + A A H    RL     
Sbjct: 577 LLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDH 636

Query: 58  -YDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KH 115
            Y +R         F GH  +V  + F     ++ + S D T ++WDV      R +  H
Sbjct: 637 IYSLRI--------FAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 116 QAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLV 175
            A V  + + P+   L S  +DG + +WD+G  + + Q+       + S+  + +G++++
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVII 748

Query: 176 AGNNKGNCYVWQM 188
           +G    +  VW M
Sbjct: 749 SGGTDNSVRVWDM 761

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 63/138 (45%), Gaps = 9/138 (6%)

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           S S + D  +L++G+      +W M  Q+       +  ++ H   +  V  S    + A
Sbjct: 568 STSFSPDNKLLISGSEDKTVRLWAMDTQS------TLVSYKGHNHPVWDVAFSPMGHYFA 621

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDC-AFSADSAYLVTACSDHYVRLWDLSTR 282
           T S D TAR+WS D  + L      H   V DC  F  +  Y+ T  SD   R+WD+ST 
Sbjct: 622 TASHDQTARLWSCDHIYSLRI-FAGHLSDV-DCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 283 EIVRQYGGHHKGAICVAL 300
           E VR + GH    + + +
Sbjct: 680 ETVRLFLGHTAPVVSLGV 697

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 69/178 (38%), Gaps = 5/178 (2%)

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
             H    E++S D   + R+   G      ++   D + L +L+ +++ +     N   N
Sbjct: 483 TFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLT-STNNTHFTKKNTADN 541

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
               +  HQ         TK   H+  +     S D K L + S D T R+W++D    L
Sbjct: 542 NLHSKKKHQEHVNTN---TKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTL 598

Query: 243 ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             +   H   VWD AFS    Y  TA  D   RLW       +R + GH     CV  
Sbjct: 599 -VSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTF 655

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 5/148 (3%)

Query: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVRLYD 59
           M    A+A +D T R W        R      S V+ +    +  +    +     R++D
Sbjct: 616 MGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWD 675

Query: 60  IRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA-- 117
           + T     V  F GH   V S+    + +W+ S SEDG I VWD+ +    +  +     
Sbjct: 676 VSTGET--VRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRN 733

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDL 145
           AVN +V       +IS   D +VR+WD+
Sbjct: 734 AVNSIVFSQEGTVIISGGTDNSVRVWDM 761

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 112/275 (40%), Gaps = 23/275 (8%)

Query: 44  KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103
           K F  A G+L   L D   T      S       + S+ F  + K++ + +ED  I++WD
Sbjct: 342 KIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWD 401

Query: 104 VRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPL 162
           +    +    + H+  +  +    +  +L+S   D  +RIWDL   QC   L+ ED    
Sbjct: 402 IAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTT 461

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQ-----MPHQTDAANPKPVTKFRSHAKYITRVLLSS 217
            ++S   +G+ + AG+      VW      +  + D+     V     H   +  V+ + 
Sbjct: 462 VAVS-PGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV----GHKDSVYSVVFTR 516

Query: 218 DVKHLATCSADHTARVWSIDD------------NFQLETTLDNHQRWVWDCAFSADSAYL 265
           D K++ + S D + ++W++ +                E T   H+ +V     + +  Y+
Sbjct: 517 DGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYI 576

Query: 266 VTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           ++   D  V  WD  +   +    GH    I VA+
Sbjct: 577 LSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAV 611

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 104/263 (39%), Gaps = 24/263 (9%)

Query: 40  ISSDKRFLAAAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGT 98
            S D +FLA       +R++DI       V    GH  ++ S+ + Q    +VS S D T
Sbjct: 381 FSPDGKFLATGAEDKLIRIWDI--AQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRT 438

Query: 99  IKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQ-DGNVRIWDLGENQCVHQLAPE 157
           I++WD+           +  V  V + P  G  ++    D  VR+WD      V +L  E
Sbjct: 439 IRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSE 498

Query: 158 DDT------PLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA-NPKPVTK------FR 204
            +T       + S+    DG  +V+G+   +  +W + +   A+ +P+P T+      + 
Sbjct: 499 GETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYI 558

Query: 205 SHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCA------F 258
            H  ++  V  + + +++ + S D     W       L   L  H+  V   A       
Sbjct: 559 GHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPL-LMLQGHRNSVISVAVANGKPL 617

Query: 259 SADSAYLVTACSDHYVRLWDLST 281
            A+     T   D   ++W   T
Sbjct: 618 GANYNVFATGSGDCKAKIWKFQT 640

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 73/162 (45%), Gaps = 24/162 (14%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN--VRLYD--- 59
           L S   D TIR W+  TG CS T+   D  V  + +S       AAG L+  VR++D   
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 60  ---IRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR---------AP 107
              +   +    T   GH+ +V S+ F ++ K +VS S D ++K+W++R          P
Sbjct: 489 GFLVERLDSEGETGV-GHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQP 547

Query: 108 SVQRNYK-----HQAAVNEVVIHPNQGELISCDQDGNVRIWD 144
             + N +     H+  V  V    N   ++S  +D  V  WD
Sbjct: 548 KTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWD 589

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 120/293 (40%), Gaps = 40/293 (13%)

Query: 41  SSDKRFL-AAAGHLNVRLYDIRTTNPN-PVTSFEGHRGNVTSIAFQQENKWMVSSSEDGT 98
           S D RFL   +  L+ +++ + +   +   T+F GHR  V    F  + + + + S+DG 
Sbjct: 155 SQDSRFLLTTSKDLSAKIWSVNSEETDLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGA 214

Query: 99  IKVWDV-RAPSVQRN---------------------------YKHQAAVNEVVIHPNQGE 130
           + VW+  + PS   +                           Y +Q+ V  V  HP    
Sbjct: 215 VFVWEFTKKPSENDDEDDDDASDDEQDDISKYSWRITNKHFFYANQSKVKCVTFHPATRL 274

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQMP 189
           L+     G  R++DL E   + QL+   + P+ +++V + G  L  G++K G   V++  
Sbjct: 275 LVVGFTSGEFRLYDLPEFTLIQQLSMGQN-PVNTVTVNNTGEWLAFGSSKLGQLLVYEWQ 333

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNH 249
            ++       + K + H      +  S D   + T S D   +VW +   F L  T + H
Sbjct: 334 SES------YILKQQGHFDSTNSLAYSPDGSRVVTASDDGKIKVWDVTSGFCL-ATFEEH 386

Query: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
              V    F+     + ++  D  VR WDL      R + G  +    C+A++
Sbjct: 387 TSSVTAVQFAKRGQVMFSSSMDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 439

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 77/169 (45%), Gaps = 12/169 (7%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGE 130
           +GH  +  S+A+  +   +V++S+DG IKVWDV +      + +H ++V  V        
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASDDGKIKVWDVTSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVW--Q 187
           + S   DG VR WDL   +        +      L+V   G ++ AG+ +  + +VW  Q
Sbjct: 402 MFSSSMDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 461

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
                DA +         H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 462 TGQLLDALS--------GHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 102/221 (46%), Gaps = 22/221 (9%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS  N L  S D  R + A+    ++++D+  T+   + +FE H  +VT++ F +  +
Sbjct: 344 HFDS-TNSLAYSPDGSRVVTASDDGKIKVWDV--TSGFCLATFEEHTSSVTAVQFAKRGQ 400

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELISCDQDGN--VR 141
            M SSS DGT++ WD+      RN++      +   N + + P+ GE++      N  + 
Sbjct: 401 VMFSSSMDGTVRAWDLIR---YRNFRTFTGTERIQFNCLAVDPS-GEVVCAGSLDNFDIH 456

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVT 201
           +W +   Q +  L+  +  P+  LS + + S+L + +      +W +  ++    P  V 
Sbjct: 457 VWSVQTGQLLDALSGHEG-PVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEV- 514

Query: 202 KFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
                   +  + +  D K +A  +      +++I+D  Q+
Sbjct: 515 -----YSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQV 550

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/244 (19%), Positives = 97/244 (39%), Gaps = 52/244 (21%)

Query: 44  KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103
           K+ L+  G+  V ++D+   N +    +E HR N+ ++   ++   ++S  EDG   + +
Sbjct: 27  KQLLSPVGN-RVSVFDL-INNKSFTFEYE-HRKNIAAVDLTKQGTLLLSVDEDGRAILVN 83

Query: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQ 163
            +A +V  ++  +   + V   P+ G+L +      ++IW   +     Q A        
Sbjct: 84  FKARNVLHHFNFKEKCSAVKFSPD-GKLFALASGRFLQIWKTPDVNKDRQFA-------- 134

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL---SSDVK 220
                                              P  ++R HA +   ++    S D +
Sbjct: 135 -----------------------------------PFVRYRVHAGHFQDIISLTWSQDSR 159

Query: 221 HLATCSADHTARVWSI--DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278
            L T S D +A++WS+  ++     TT + H+ +V    FS D   + T   D  V +W+
Sbjct: 160 FLLTTSKDLSAKIWSVNSEETDLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWE 219

Query: 279 LSTR 282
            + +
Sbjct: 220 FTKK 223

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +      + A    N  ++    
Sbjct: 401 VMFSSSMDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                + +  GH G V+ ++F QEN  + S+S D TI++W +   S Q    +  + V  
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLA 520

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDTPL 162
           + + P+  E+      G + I+++ + + V  +                     E     
Sbjct: 521 LSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNEDRFTAKNSERSKFF 580

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            ++  + DG  +VAG N  +  ++ +P++
Sbjct: 581 TTIHYSFDGMAIVAGGNNNSICLYDVPNE 609

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 117/299 (39%), Gaps = 40/299 (13%)

Query: 35  VNRLEISSDKRF-LAAAGHLNVRLYDIRTTNPN-PVTSFEGHRGNVTSIAFQQENKWMVS 92
           +  L  S D RF L  +  L+ +++ + +   N   T+F GHR  V    F  + + + +
Sbjct: 149 ITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYT 208

Query: 93  SSEDGTIKVWDV----------------------------RAPSVQRNYKHQAAVNEVVI 124
            S+DG + VW+                             R       Y +QA V  V  
Sbjct: 209 VSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTF 268

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNC 183
           HP    L      G  R++DL +   + QL+   + P+ ++SV   G  L  G++K G  
Sbjct: 269 HPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQN-PVNTVSVNQTGEWLAFGSSKLGQL 327

Query: 184 YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            V++   ++       + K + H      +  S D   + T S D   +VW I   F L 
Sbjct: 328 LVYEWQSES------YILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCL- 380

Query: 244 TTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
            T + H   V    F+     + ++  D  VR WDL      R + G  +    C+A++
Sbjct: 381 ATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 439

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 95/215 (44%), Gaps = 13/215 (6%)

Query: 74  HRGNVTSIAFQQENKWMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELI 132
            +GN+T   F  + K ++S   +  + V+D +   S    Y+H+  +  + ++     LI
Sbjct: 16  RQGNIT---FSDDGKQLLSPVGN-RVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLI 71

Query: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
           S D+DG   + +      +H    ++     ++  + DG +    + +    +W+ P   
Sbjct: 72  SIDEDGRAILVNFKARNVLHHFNFKEKC--SAVKFSPDGRLFALASGRF-LQIWKTPDVN 128

Query: 193 DAANPKPVTKFRSHAKY---ITRVLLSSDVKHLATCSADHTARVWSIDDNFQ--LETTLD 247
                 P  + R HA +   IT +  S D + + T S D +A++WS+D   +    TT +
Sbjct: 129 KDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFN 188

Query: 248 NHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
            H+ +V    FS D   + T   D  V +W+ + R
Sbjct: 189 GHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKR 223

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 77/169 (45%), Gaps = 12/169 (7%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGE 130
           +GH  +  S+A+  +   +V++SEDG IKVWD+ +      + +H ++V  V        
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVW--Q 187
           + S   DG VR WDL   +        +      L+V   G ++ AG+ +  + +VW  Q
Sbjct: 402 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 461

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
                DA +         H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 462 TGQLLDALS--------GHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 101/234 (43%), Gaps = 20/234 (8%)

Query: 56  RLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWM-VSSSEDGTIKVWDVRAPS-VQRNY 113
           RLYD+   +   +      +  V +++  Q  +W+   SS+ G + V++ ++ S + +  
Sbjct: 285 RLYDL--PDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQ 342

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            H  + N +   P+   +++  +DG +++WD+    C+     E  + + ++  A  G +
Sbjct: 343 GHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFE-EHTSSVTAVQFAKRGQV 401

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHA--KYITRVLLSSDVKHLATCSA---D 228
           + + +  G    W +    +         FR+    + I    L+ D      C+    +
Sbjct: 402 MFSSSLDGTVRAWDLIRYRN---------FRTFTGTERIQFNCLAVDPSGEVVCAGSLDN 452

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
               VWS+    QL   L  H+  V   +FS +++ L +A  D  +R+W +  R
Sbjct: 453 FDIHVWSVQTG-QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGR 505

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 102/221 (46%), Gaps = 22/221 (9%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS  N L  S D  R + A+    ++++DI  T+   + +FE H  +VT++ F +  +
Sbjct: 344 HFDS-TNSLAYSPDGSRVVTASEDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFAKRGQ 400

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELISCDQDGN--VR 141
            M SSS DGT++ WD+      RN++      +   N + + P+ GE++      N  + 
Sbjct: 401 VMFSSSLDGTVRAWDLIR---YRNFRTFTGTERIQFNCLAVDPS-GEVVCAGSLDNFDIH 456

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVT 201
           +W +   Q +  L+  +  P+  LS + + S+L + +      +W +  ++    P  V 
Sbjct: 457 VWSVQTGQLLDALSGHEG-PVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEV- 514

Query: 202 KFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
                   +  + +  D K +A  +      +++I+D  Q+
Sbjct: 515 -----YSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQV 550

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +      + A    N  ++    
Sbjct: 401 VMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                + +  GH G V+ ++F QEN  + S+S D TI++W +   S Q    +  + V  
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLA 520

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDTPL 162
           + + P+  E+      G + I+++ + + V  +                     E     
Sbjct: 521 LSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFF 580

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            ++  + DG  +VAG N  +  ++ +P++
Sbjct: 581 TTIHYSFDGMAIVAGGNNNSICLYDVPNE 609

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 73  GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK------HQAAVNEVVIHP 126
           GH  ++TS+ + Q++++++++S+D + K+W V   S ++N        H+  V       
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSV--DSEEKNLAATTFNGHRDYVMGAFFSH 201

Query: 127 NQGELISCDQDGNVRIWDL 145
           +Q ++ +  +DG V +W+ 
Sbjct: 202 DQEKIYTVSKDGAVFVWEF 220

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 113/254 (44%), Gaps = 35/254 (13%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-----RAPSVQRNYKHQAAV 119
           P  + ++EGH   + S+A  ++ +W+ ++S+D T  +W       R  +  +   H ++V
Sbjct: 412 PINMETYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSV 471

Query: 120 NEVVIHPN---QGE---LISCDQDGNVRIW----------DLGENQCVHQLAPED----- 158
             V + PN   +G    LI+   D  ++ W          D       H +   +     
Sbjct: 472 TAVGL-PNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHA 530

Query: 159 -DTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS 217
            D  + S+S++ + S++  G+   +C +W +       + + V    +H + I  V    
Sbjct: 531 HDKDINSISISPNDSLIATGSYDKSCKLWNLD------SGELVATLNNHKRGIWDVSFCQ 584

Query: 218 DVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             K +ATCS D T ++WS+ D F +  T   H   V  C F      LV++ +D  +++W
Sbjct: 585 FDKLIATCSGDKTIKLWSL-DTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIW 643

Query: 278 DLSTREIVRQYGGH 291
           D +T + ++   GH
Sbjct: 644 DCTTGDCLKTLDGH 657

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 114/284 (40%), Gaps = 36/284 (12%)

Query: 30  HSDSQVNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF--- 83
           H+D  +N L  + D ++LA A   +  +   Y   T+       F GH  +VT++     
Sbjct: 421 HTD-LLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLPNV 479

Query: 84  --QQENKWMVSSSEDGTIKVWDVRAPSVQRN------------------YKHQAAVNEVV 123
             +   ++++++S D TIK W +  PS +R+                  + H   +N + 
Sbjct: 480 LLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSIS 539

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNC 183
           I PN   + +   D + ++W+L   + V  L       +  +S      ++   +     
Sbjct: 540 ISPNDSLIATGSYDKSCKLWNLDSGELVATLN-NHKRGIWDVSFCQFDKLIATCSGDKTI 598

Query: 184 YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLE 243
            +W +   T A     +  F  H   + R    +  K L +  AD   ++W       L+
Sbjct: 599 KLWSL--DTFAV----LKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLK 652

Query: 244 TTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW-DLSTREIVR 286
           T LD H   +W      D   +V+A +D  ++ W D +  EI++
Sbjct: 653 T-LDGHDNRIWALTTWNDGELIVSADADGVLQFWNDCTELEILQ 695

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 4/143 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS-DKRFLAAAGHLNVRLYDIRT 62
           ++A+  YD + + W   +G    T+ +    +  +     DK     +G   ++L+ + T
Sbjct: 546 LIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDT 605

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
                + +F GH   V    F  + K +VSS  DG IK+WD       +           
Sbjct: 606 FAV--LKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWA 663

Query: 123 VIHPNQGELI-SCDQDGNVRIWD 144
           +   N GELI S D DG ++ W+
Sbjct: 664 LTTWNDGELIVSADADGVLQFWN 686

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/349 (20%), Positives = 120/349 (34%), Gaps = 93/349 (26%)

Query: 47  LAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK---WMVSSSE-DGTIKVW 102
           L A G  +  +  +   N     SF+GH G ++S+ F   N    W++ S + +G +K+W
Sbjct: 132 LVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIW 191

Query: 103 D-VRAPSVQRNYKHQAAVNEVVIHPNQGE-------LISCDQDGNVRIWDLGENQCVHQL 154
           D V+   +    +H +AV  + +     E       L+S  +D  V +W+    +    L
Sbjct: 192 DLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEFNLRKLCKLL 251

Query: 155 AP--------------EDDTPLQSLSVASDGSML-------------------------- 174
                           + D  LQ +   + G  +                          
Sbjct: 252 KTLPVNQQVESCGFIHDHDNELQDIIYTAGGEAIFQLISLSKGSVIKRTVKPTEELFIIG 311

Query: 175 ----VAGNNKGNCYV------WQMPHQTDAANP----KPVTKFRS-----HAKYITRVLL 215
                A NN  N Y+       QM + T A +P     P+ +  S     H        +
Sbjct: 312 TLPFTATNNDLNSYIVMSDQTLQMINLTKALSPTELSNPIIEIESCIAGNHGTIADMKFV 371

Query: 216 SSDVKHLATCSADHTARVWSI--------DDNFQLET--------TLDNHQRWVWDCAFS 259
             D+  LA  +   T R+  +        D N Q  +        T + H   +   A +
Sbjct: 372 GQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPINMETYEGHTDLLNSLAAT 431

Query: 260 ADSAYLVTACSDHYVRLWDLSTREIVR-----QYGGHHKGAICVALNDV 303
            D  +L TA  DH   LW  S+ E  R     ++ GH      V L +V
Sbjct: 432 EDGQWLATASKDHTSILWKYSS-ETSRFFAYAKFIGHSSSVTAVGLPNV 479

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 62/160 (38%), Gaps = 35/160 (21%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYI----------- 210
           L SL+   DG  L   +      +W+   +T        ++F ++AK+I           
Sbjct: 425 LNSLAATEDGQWLATASKDHTSILWKYSSET--------SRFFAYAKFIGHSSSVTAVGL 476

Query: 211 TRVLLSSDVKHLATCSADHTARVWSI--------DDNFQLET--------TLDNHQRWVW 254
             VLL    + L T S D T + W I        DD  + +T        T   H + + 
Sbjct: 477 PNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDIN 536

Query: 255 DCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKG 294
             + S + + + T   D   +LW+L + E+V     H +G
Sbjct: 537 SISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRG 576

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 110/250 (44%), Gaps = 32/250 (12%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW----DVRAPSVQRNY-KHQAAV 119
           P  V  +EGH   + S+   ++  W+ ++S+D +  VW    D     +   Y  H +AV
Sbjct: 379 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAV 438

Query: 120 NEVVIHPN---QGE---LISCDQDGNVRIWDLGENQCVHQL-----------APEDDTPL 162
             V + PN   +G    L++   D  ++ W + +    + +           A E D  +
Sbjct: 439 TAVGL-PNVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKD--I 495

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL 222
            +LSV+ + S+    +    C +W +       N +      +H + +  V      K L
Sbjct: 496 NALSVSPNDSIFATASYDKTCKIWNL------ENGELEATLANHKRGLWDVSFCQYDKLL 549

Query: 223 ATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           ATCS D T ++WS++  F +  TL+ H   V  C+F      LV+  +D  +++WD  + 
Sbjct: 550 ATCSGDKTVKIWSLE-TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSG 608

Query: 283 EIVRQYGGHH 292
           E ++   GH+
Sbjct: 609 ECLKTLDGHN 618

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 72/185 (38%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           I A+A YD T + W    G    T+ +                                 
Sbjct: 506 IFATASYDKTCKIWNLENGELEATLAN--------------------------------- 532

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
                     H+  +  ++F Q +K + + S D T+K+W +   SV +  + H  AV   
Sbjct: 533 ----------HKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRC 582

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                Q +L+SC  DG ++IWD    +C+  L   ++  L +L+  +DG  +V+ +  G 
Sbjct: 583 SFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNR-LWALNTMNDGDTIVSADADGI 641

Query: 183 CYVWQ 187
              W+
Sbjct: 642 FQFWK 646

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 101/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N L+ + D  ++A A   N  +   Y+  T+  +    + GH   VT++       +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 451

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRN-----------YKHQAAVNEVVIHPNQGELISCD 135
            ++++++S D TIK W +  P+   +           + H+  +N + + PN     +  
Sbjct: 452 PEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 511

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
            D   +IW+L EN  +          L  +S      +L   +      +W +   +   
Sbjct: 512 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFS--- 567

Query: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255
               +     H   + R    +  K L +C AD   ++W       L+ TLD H   +W 
Sbjct: 568 ---VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLK-TLDGHNNRLWA 623

Query: 256 CAFSADSAYLVTACSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 624 LNTMNDGDTIVSADADGIFQFW 645

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 72/145 (49%), Gaps = 16/145 (11%)

Query: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG-HLNVRLYDIRTTNPNPVTSFE 72
           ++ ++  TG   R+++ S S    L+  S    LA  G   ++ + DI   N     S +
Sbjct: 85  LKIFQLKTGKVVRSMKIS-SPSYILDTDSTSTLLAVGGTDGSIIVVDIE--NGYITHSLK 141

Query: 73  GHRGNVTSIAF--QQENK-WMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAAVNEVVI--- 124
           GH G ++S+ F  Q ++K W+++S + +G +KVWD V+   +    +H +AV  + I   
Sbjct: 142 GHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEV 201

Query: 125 ----HPNQGELISCDQDGNVRIWDL 145
                P+  +LIS  +D  V  WD 
Sbjct: 202 ENNDGPSHLKLISGGRDDIVNFWDF 226

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV-- 219
           L SL    DG  +   +   +  VW+  +  D +      K+  H+  +T V L + +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWK--YNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPK 449

Query: 220 ---KHLATCSADHTARVWSI-----DDNFQL----ETTLDNHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W I      ++ Q+    E T   H++ +   + S + +   T
Sbjct: 450 GYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 509

Query: 268 ACSDHYVRLWDLSTREIVRQYGGHHKG 294
           A  D   ++W+L   E+      H +G
Sbjct: 510 ASYDKTCKIWNLENGELEATLANHKRG 536

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 96  DGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE----LISCDQDGNVRIWDLGENQC 150
           DG+I V D+    +  + K H   ++ +  +         L S D +G V++WDL + +C
Sbjct: 123 DGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKC 182

Query: 151 VHQL 154
           +H L
Sbjct: 183 LHTL 186

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 69.7 bits (169), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 127/295 (43%), Gaps = 26/295 (8%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ Q  +  V    +++D  + L+A+    +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDKQYGVPVRSFQGHNHIVQDCSLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+ +V S+A  ++   ++S S D T+KVW +R   +     H 
Sbjct: 91  LWDVATGQT--YQRFVGHKSDVMSVAIDRKASMIISGSRDRTVKVWTIRGQCLATMLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V I P +        +IS   D  V+ W++ + Q        ++  + +++ + D
Sbjct: 149 DWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQFQIEADFIGHNNY-VNTITASPD 207

Query: 171 GSMLVAGNNKGNCYVW----QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCS 226
           GS++ +    G   +W    ++P  T +A  +      S  +Y      SS +K      
Sbjct: 208 GSLVASAGKDGEIMLWNLADKVPMYTLSAQDEVFALAFSPNRYWLSAATSSGIKIFCL-- 265

Query: 227 ADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            D    V  +   F   T            A+SAD   L    +D+ +R+W + T
Sbjct: 266 -DPKYLVDELKPEFAGYTKASEPH--AVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 98/226 (43%), Gaps = 22/226 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     Q     R+++ H   V + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDC 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   Q   +      + + S+++    SM+++G+    
Sbjct: 72  SLTADGAYALSASWDKTLRLWDVATGQTYQRFVGHK-SDVMSVAIDRKASMIISGSRDRT 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS------DVKHLATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V ++       D   + +   D   + W++
Sbjct: 131 VKVWTIRGQC-------LATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNV 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           +  FQ+E     H  +V     S D + + +A  D  + LW+L+ +
Sbjct: 184 N-QFQIEADFIGHNNYVNTITASPDGSLVASAGKDGEIMLWNLADK 228

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  + +   +   H   V DC+
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDCS 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD++T +  +++ GH    + VA++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAID 116

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 107/249 (42%), Gaps = 30/249 (12%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYKHQAAV 119
           P  V  +EGH   + S+   ++  W+ ++S+D T  VW     S +     +   H AAV
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAV 437

Query: 120 NEV----VIHPNQGE-LISCDQDGNVRIWDLGENQCVHQL-----------APEDDTPLQ 163
             V    ++     E L++   D  ++ W + +      +           A E D  + 
Sbjct: 438 TAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKD--IN 495

Query: 164 SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLA 223
           +LSV+ + S+    +    C +W +       N +      +H + +  V      K LA
Sbjct: 496 ALSVSPNDSIFATASYDKTCKIWNL------ENGELEATLANHKRGLWDVSFCQYDKLLA 549

Query: 224 TCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           T S D T ++WS+D  F +  TL+ H   V  C+F      L++  +D  +++WD S+ E
Sbjct: 550 TSSGDKTVKIWSLD-TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGE 608

Query: 284 IVRQYGGHH 292
            ++   GH+
Sbjct: 609 CLKTLDGHN 617

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           I A+A YD T + W    G    T+ +                                 
Sbjct: 505 IFATASYDKTCKIWNLENGELEATLAN--------------------------------- 531

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
                     H+  +  ++F Q +K + +SS D T+K+W +   SV +  + H  AV   
Sbjct: 532 ----------HKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRC 581

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                Q +LISC  DG ++IWD    +C+  L   ++  L +LS  +DG M+V+ +  G 
Sbjct: 582 SFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNR-LWALSTMNDGDMIVSADADGV 640

Query: 183 CYVWQ 187
              W+
Sbjct: 641 FQFWK 645

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/262 (19%), Positives = 101/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N L+ + D  ++A A   N  +   Y+  +   +    + GH   VT++       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGY 450

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-----------HQAAVNEVVIHPNQGELISCD 135
            ++++++S D TIK W +  P+   + +           H+  +N + + PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 510

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
            D   +IW+L EN  +          L  +S      +L   +      +W +   +   
Sbjct: 511 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFS--- 566

Query: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255
               +     H   + R    +  K L +C AD   ++W       L+T LD H   +W 
Sbjct: 567 ---VMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKT-LDGHNNRLWA 622

Query: 256 CAFSADSAYLVTACSDHYVRLW 277
            +   D   +V+A +D   + W
Sbjct: 623 LSTMNDGDMIVSADADGVFQFW 644

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 73/144 (50%), Gaps = 15/144 (10%)

Query: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG-HLNVRLYDIRTTNPNPVTSFE 72
           ++ +   TG   R+++ S S    L+  S    LA  G   ++ + DI   N     SF+
Sbjct: 85  LKIFHLKTGKVVRSMKIS-SPSYILDADSTSTLLAVGGTDGSIIVVDIE--NGYITHSFK 141

Query: 73  GHRGNVTSIAF--QQENK-WMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAAVN--EVVIH 125
           GH G ++S+ F  Q  +K W+++S + +G +KVWD V+   +    +H +AV   +++  
Sbjct: 142 GHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEV 201

Query: 126 PNQGE----LISCDQDGNVRIWDL 145
           P+  E    L+S  +D  + +WD 
Sbjct: 202 PDNDEPSLNLLSGGRDDIINLWDF 225

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 21/95 (22%)

Query: 96  DGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE----LISCDQDGNVRIWDLGENQC 150
           DG+I V D+    +  ++K H   ++ +  +         L S D +G V++WDL + +C
Sbjct: 123 DGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKC 182

Query: 151 VHQL--------------APEDDTPLQSLSVASDG 171
           +H L               P++D P  SL++ S G
Sbjct: 183 LHTLQEHTSAVRGLDIIEVPDNDEP--SLNLLSGG 215

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV-- 219
           L SL    DG  +   +      VW+  +  ++       K+  H+  +T V L + V  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAIVWR--YNENSCKFDIYAKYIGHSAAVTAVGLPNIVSK 448

Query: 220 ---KHLATCSADHTARVWSIDD-----NFQL----ETTLDNHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W I       + Q+    E T   H++ +   + S + +   T
Sbjct: 449 GYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 508

Query: 268 ACSDHYVRLWDLSTREIVRQYGGHHKG 294
           A  D   ++W+L   E+      H +G
Sbjct: 509 ASYDKTCKIWNLENGELEATLANHKRG 535

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 125/277 (45%), Gaps = 24/277 (8%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRL-------YDIRTTNP---NPV 68
           +L  V   T  ++   +  LE S++ + LAA+G  +  +       Y +   +    NP+
Sbjct: 505 SLPSVSIYTFHNTQKNMTSLEFSNNYK-LAASGFQDSYIKIWSLDGYPLSENDEMPNNPI 563

Query: 69  TS----FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVV 123
           +S    F GH G V S +F   +++++S+SED T+++W V+      +YK H+  V +V 
Sbjct: 564 SSTCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVE 623

Query: 124 IHPNQGELI-SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
             P+   L  +   D   R+W       +  +A   +  +  +S  S+G  +  G++   
Sbjct: 624 FSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLND-VDCVSFHSNGRYIFTGSSDKT 682

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
             +W      D      V  F  H   +T + +S D K ++T S D    +W I    +L
Sbjct: 683 VRMW------DINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKL 736

Query: 243 ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +    + +  +   +++ +   LV+  +D  VR+WDL
Sbjct: 737 KNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 79/158 (50%), Gaps = 5/158 (3%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFL-AAAGHLNVRLYDIRT 62
           + A+A  D T R W        R +    + V+ +   S+ R++   +    VR++DI T
Sbjct: 631 LFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINT 690

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKH--QAAVN 120
            +   V  F GH   VTS++   + KW+ + S+DG I +WD+ +    +N +   +++++
Sbjct: 691 GDS--VRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIH 748

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPED 158
            +  +P    L+S   D +VR+WDL +      L PE+
Sbjct: 749 SLSYNPEGTLLVSGGADQSVRVWDLNKGTFEPSLTPEE 786

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 5/187 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS--DKRFLAAAGHLNVRLYDIRT 62
           L SA  D T+R W         + +  +  V  +E S   +  F  A+     RL+    
Sbjct: 589 LLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDR 648

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNE 121
             P  V +  GH  +V  ++F    +++ + S D T+++WD+    SV+    H + V  
Sbjct: 649 VYPLRVMA--GHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTS 706

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           + + P+   + +   DG + IWD+G  + +  +     + + SLS   +G++LV+G    
Sbjct: 707 LSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQ 766

Query: 182 NCYVWQM 188
           +  VW +
Sbjct: 767 SVRVWDL 773

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (42%), Gaps = 38/235 (16%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127
           + +F   + N+TS+ F    K   S  +D  IK+W +    +  N +           PN
Sbjct: 511 IYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEM----------PN 560

Query: 128 QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187
                +C          +G +  V+           S S ++    L++ +      +W 
Sbjct: 561 NPISSTCKTF-------IGHSGTVY-----------STSFSAGDEYLLSASEDKTVRLWS 602

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL-ATCSADHTARVWSIDDNFQLETTL 246
           +  Q D    KP+  ++ H K +  V  S    +L AT S D TAR+WS D  + L   +
Sbjct: 603 V--QDD----KPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRV-M 655

Query: 247 DNHQRWVWDC-AFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             H   V DC +F ++  Y+ T  SD  VR+WD++T + VR + GH+     +++
Sbjct: 656 AGHLNDV-DCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSV 709

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 117/297 (39%), Gaps = 61/297 (20%)

Query: 45  RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104
           R +  +G    R++D  T  P  + + +GH   V  +A+  + + + + S D TI++WD 
Sbjct: 157 RMVTGSGDNTARIWDCNTNTP--MYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDS 214

Query: 105 -RAPSVQRNYK-HQAAVNEVVIHP-------NQGELISCDQDGNVRIWDLGENQCVHQLA 155
            +  S     + H   +  +   P       +Q  L S  +DG ++IWD     CV  L+
Sbjct: 215 NKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLS 274

Query: 156 PEDDTPLQSLSVASDGS--MLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
              +    S+S    G   +L +G++      W M     AA  K +   +SHA +I  +
Sbjct: 275 GHTN----SVSCVKWGGRGILYSGSHDKTIRAWDM-----AAGGKCINILKSHAHWINHL 325

Query: 214 LLSSDV---------------------------------------KHLATCSADHTARVW 234
            L++D                                        + + T S D T  +W
Sbjct: 326 SLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLW 385

Query: 235 SIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
                 +  T +  HQ+ V   AFS D  Y+V+A  D+ ++LWD      +  + GH
Sbjct: 386 DPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGH 442

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 127/304 (41%), Gaps = 32/304 (10%)

Query: 4   ILASAGYDHTIRFW---------EALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR W         EAL G        +   ++ ++     R  +A+    
Sbjct: 199 LIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGT 258

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK 114
           ++++D  TT    V +  GH  +V+ + +      + S S D TI+ WD+ A        
Sbjct: 259 IKIWD--TTRRVCVLTLSGHTNSVSCVKWGGRGI-LYSGSHDKTIRAWDMAAGG------ 309

Query: 115 HQAAVNEVVIHPNQGELISCDQDGNVRIWDL---GENQCVHQLAPEDDTPLQSLSVASDG 171
               +N +  H +    +S + D  +R+      GE     + A              +G
Sbjct: 310 --KCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNG 367

Query: 172 ---SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
               ++V  ++    Y+W  P +      KP+T+   H K +  V  S D +++ + S D
Sbjct: 368 QLEELMVTASDDFTMYLWD-PLKAS----KPITRMTGHQKLVNHVAFSPDGRYIVSASFD 422

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
           ++ ++W    N     T   H   V+  A+S+D   LV+   D  +++WD+ T+++    
Sbjct: 423 NSIKLWD-GRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDL 481

Query: 289 GGHH 292
            GH+
Sbjct: 482 PGHN 485

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 93/224 (41%), Gaps = 42/224 (18%)

Query: 4   ILASAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAA------------ 50
           IL S  +D TIR W+ A  G C   ++     +N L +++D      A            
Sbjct: 290 ILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPE 349

Query: 51  -------------GHLNVRLYDIRTT----------NP----NPVTSFEGHRGNVTSIAF 83
                           N +L ++  T          +P     P+T   GH+  V  +AF
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 84  QQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRI 142
             + +++VS+S D +IK+WD R  +    ++ H A+V +V    +   L+SC +D  +++
Sbjct: 410 SPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 469

Query: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           WD+   +    L   +D  + ++  + DG  + +        +W
Sbjct: 470 WDVRTKKLSVDLPGHNDE-VYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 52/132 (39%), Gaps = 13/132 (9%)

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233
           +V G+      +W      D     P+   + H  ++  V    D + +AT S D+T R+
Sbjct: 158 MVTGSGDNTARIW------DCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRL 211

Query: 234 WSIDDNFQLETTLDNHQRWV----WD---CAFSADSAYLVTACSDHYVRLWDLSTREIVR 286
           W  +        L  H +W+    W+      + D   L +A  D  +++WD + R  V 
Sbjct: 212 WDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVL 271

Query: 287 QYGGHHKGAICV 298
              GH     CV
Sbjct: 272 TLSGHTNSVSCV 283

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 109/266 (40%), Gaps = 35/266 (13%)

Query: 41  SSDKRFL-AAAGHLNVRLYDIRTTNPNPV-TSFEGHRGNVTSIAFQQENKWMVSSSEDGT 98
           S D RFL + +  L  +++ I +   +   T+F GHR  V    F  + + + + S+DG 
Sbjct: 155 SKDSRFLLSTSKDLTAKIWSIDSEEKDLASTTFAGHRDYVVGAFFSADQEKIYTVSKDGA 214

Query: 99  IKVWDV------------------------RAPSVQRNYKHQAAVNEVVIHPNQGELISC 134
           +  W+                         R  S    Y +QA V  V  H N   L+  
Sbjct: 215 LFTWEYTPRPEDVEAAEENDEEVDISKYNWRITSKNYFYANQAKVKCVTFHCNSNMLVVG 274

Query: 135 DQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQMPHQTD 193
             +G  R+++L     + QL+   + P+ +++V S G  L  G++K G   V++   ++ 
Sbjct: 275 FTNGEFRLYELPHFTLIQQLSMGQN-PVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSES- 332

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
                 + K + H      +  S D   + T + D   +VW +   F L  TLD H   V
Sbjct: 333 -----YILKQQGHFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCL-ATLDEHTAAV 386

Query: 254 WDCAFSADSAYLVTACSDHYVRLWDL 279
               F+     L +A  D  V+ WDL
Sbjct: 387 TQVQFAKKGQVLFSASLDGTVKAWDL 412

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 80/190 (42%), Gaps = 9/190 (4%)

Query: 99  IKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPE 157
           + V+D V   S    Y+H+  +    ++     L+S D DG   + +      +H    +
Sbjct: 37  VSVFDLVNNKSFTFEYEHRKNIACFDLNRQGTLLLSIDDDGRAILVNYKSRNVLHHFNFK 96

Query: 158 DDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLL-- 215
           D      +  + DG +    + +    +W+ P  T      P  ++R HA +   ++   
Sbjct: 97  D--KCSQIKFSPDGKLFAVASGRF-LQIWKTPDATQDRQFAPFVRYRVHAGHFQDLISLT 153

Query: 216 -SSDVKHLATCSADHTARVWSIDDNFQ--LETTLDNHQRWVWDCAFSADSAYLVTACSDH 272
            S D + L + S D TA++WSID   +    TT   H+ +V    FSAD   + T   D 
Sbjct: 154 WSKDSRFLLSTSKDLTAKIWSIDSEEKDLASTTFAGHRDYVVGAFFSADQEKIYTVSKDG 213

Query: 273 YVRLWDLSTR 282
            +  W+ + R
Sbjct: 214 ALFTWEYTPR 223

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 8/167 (4%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGE 130
           +GH  +  S+ +  +   +V+++EDG IKVWDV +        +H AAV +V        
Sbjct: 338 QGHFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATLDEHTAAVTQVQFAKKGQV 397

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVWQMP 189
           L S   DG V+ WDL   +        +     SL+V   G ++ AG+ +  + +VW + 
Sbjct: 398 LFSASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVWSV- 456

Query: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
            QT     + +     H   ++ +  S +   LA+ S D T R+W I
Sbjct: 457 -QTG----QLLDSLSGHEGPVSCLAFSQENGVLASASWDKTIRIWYI 498

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L SA  D T++ W+ +     R    ++  Q N L +      + A    N  ++    
Sbjct: 397 VLFSASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVWSV 456

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-YKHQAAVNE 121
                + S  GH G V+ +AF QEN  + S+S D TI++W +   S Q +  +  + V  
Sbjct: 457 QTGQLLDSLSGHEGPVSCLAFSQENGVLASASWDKTIRIWYIFGRSQQVDPIEVYSDVLS 516

Query: 122 VVIHPNQGELISCDQDGNVRIWDL------GENQCVHQLA-------------PEDDTPL 162
           + I P+  ++      G + ++D+      G   C   +               E     
Sbjct: 517 LTIRPDGKQVAVSTLKGQISMFDVENGTQAGNIDCRRDIFSGRHLEDRFTSENSERSKFF 576

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            +++ + DG  +VAG +  +  ++ +P++
Sbjct: 577 STINYSFDGMAIVAGGSNNSICLYDVPNE 605

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 87/197 (44%), Gaps = 9/197 (4%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG-HLNVRLYD-IRT 62
           + +A  D  I+ W+ ++G C  T+    + V +++ +   + L +A     V+ +D IR 
Sbjct: 356 VVTAAEDGKIKVWDVVSGFCLATLDEHTAAVTQVQFAKKGQVLFSASLDGTVKAWDLIRY 415

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDG-TIKVWDVRAPSVQRNYK-HQAAVN 120
            N    T+ E  R    S+A     + + + S D   I VW V+   +  +   H+  V+
Sbjct: 416 RNFRVFTAAE--RIQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQTGQLLDSLSGHEGPVS 473

Query: 121 EVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN 179
            +      G L S   D  +RIW + G +Q V  +    D  + SL++  DG  +     
Sbjct: 474 CLAFSQENGVLASASWDKTIRIWYIFGRSQQVDPIEVYSD--VLSLTIRPDGKQVAVSTL 531

Query: 180 KGNCYVWQMPHQTDAAN 196
           KG   ++ + + T A N
Sbjct: 532 KGQISMFDVENGTQAGN 548

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 128/299 (42%), Gaps = 21/299 (7%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           S ++  AG D+T R W+  T    +T++   + V  +  S D   +A     N +RL+  
Sbjct: 156 SRMVTGAG-DNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQ- 213

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDVRAPSVQRNY 113
                N   +  GH   +TS++++        +   + S+S+DGTIK+WD          
Sbjct: 214 SEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTL 273

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDL-GENQCVHQLAPEDDTPLQSLSVASDGS 172
                    V    +G L S   D  +R WD+    +C++ L       +  LS+++D +
Sbjct: 274 SGHTNSVSCVKWGGRGVLYSGSHDKTIRAWDMNAGGKCINILKSHAHW-INHLSLSTDYA 332

Query: 173 MLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTAR 232
           + V   +    +  + P   + A  K +  +   AK   ++      + + T S D T  
Sbjct: 333 LRVGAFD----HTGKKPSSPEEARAKALENYEKIAKKNGKL-----EELMVTASDDFTMY 383

Query: 233 VWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +W    + +  T +  HQ+ V   AFS D  Y+V+A  D+ ++LWD      +  + GH
Sbjct: 384 LWDPIKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGTFIATFRGH 442

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 108/280 (38%), Gaps = 63/280 (22%)

Query: 4   ILASAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L S  +D TIR W+    G C   ++     +N L +S+D         L V  +D   
Sbjct: 290 VLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYA-------LRVGAFDHTG 342

Query: 63  TNPN-PVTSFEGHRGNVTSIAFQ--QENKWMVSSSEDGTIKVWDV--RAPSVQRNYKHQA 117
             P+ P  +      N   IA +  +  + MV++S+D T+ +WD       + R   HQ 
Sbjct: 343 KKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQK 402

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            VN V   P+   ++S   D ++++WD                         DG+ +   
Sbjct: 403 LVNHVAFSPDGRYIVSASFDNSIKLWD-----------------------GRDGTFIAT- 438

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
                                    FR H   + +V  SSD + L +CS D T +VW + 
Sbjct: 439 -------------------------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 473

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              +L   L  H+  V+   +S D   + +A  D  VR+W
Sbjct: 474 TK-KLSVDLPGHKDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 57/152 (37%), Gaps = 13/152 (8%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S       S +V G       +W      D     P+   + H  ++  V
Sbjct: 138 IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------DCNTNTPMQTLKGHFNWVLCV 191

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLV 266
             S D + +AT S D+T R+W  +        L  H +W+   ++         D   L 
Sbjct: 192 AWSPDGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLA 251

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           +A  D  +++WD + R  +    GH     CV
Sbjct: 252 SASKDGTIKIWDTARRVCLFTLSGHTNSVSCV 283

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S+ +VT   D+  R+WD +T   ++   GH    +CVA
Sbjct: 155 SSRMVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVA 192

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 127/304 (41%), Gaps = 32/304 (10%)

Query: 4   ILASAGYDHTIRFWE---------ALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN 54
           ++A+   D+TIR WE         AL G        S   ++ ++     R   A+    
Sbjct: 200 LIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGT 259

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK 114
           ++++D  TT    + +  GH  +V+ + +  +N  + S S D TI+ WD+          
Sbjct: 260 IKIWD--TTRRVCLLTLCGHTSSVSCVKWGGKNV-LYSGSHDKTIRCWDMNL-------- 308

Query: 115 HQAAVNEVVIHPNQGELISCDQDGNVRIWDL---GENQCVHQLAPEDDTPLQSLSVASDG 171
           +   +N +  H +    +S   D  +R+      GE     + A +             G
Sbjct: 309 NGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKG 368

Query: 172 ---SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
               ++V  ++    Y+W     T     KP+T+   H K +  V  S D +++ + S D
Sbjct: 369 DFEELMVTASDDFTMYLWNPLKST-----KPITRMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288
           ++ ++W   D  +  +T   H   V+  A+S+D   LV+   D  +++WD+ TR++    
Sbjct: 424 NSIKLWDGRDG-KFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDL 482

Query: 289 GGHH 292
            GH 
Sbjct: 483 PGHQ 486

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 137/302 (45%), Gaps = 27/302 (8%)

Query: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDI 60
           S ++  AG D+T   W+  T     T+Q   + V     S D   +A     N +RL++ 
Sbjct: 157 SRMVTGAG-DNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWES 215

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQ-------ENKWMVSSSEDGTIKVWDV-RAPSVQRN 112
               P    +  GH   +TS++++        +   + ++S+DGTIK+WD  R   +   
Sbjct: 216 SKGKPYG-DALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTL 274

Query: 113 YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN-QCVHQLAPEDDTPLQSLSVASDG 171
             H ++V+  V    +  L S   D  +R WD+  N +C++ L       +  LS+++D 
Sbjct: 275 CGHTSSVS-CVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHW-VNHLSLSTDY 332

Query: 172 SM-LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL-ATCSADH 229
           ++ L A ++KG     + P   + A  K +  +   AK         D + L  T S D 
Sbjct: 333 ALRLGAFDHKG-----ETPASPEEAQQKALKNYEKVAKR------KGDFEELMVTASDDF 381

Query: 230 TARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYG 289
           T  +W+   + +  T +  HQ+ V   AFS D  Y+V+A  D+ ++LWD    + +  + 
Sbjct: 382 TMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFR 441

Query: 290 GH 291
           GH
Sbjct: 442 GH 443

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 110/280 (39%), Gaps = 63/280 (22%)

Query: 4   ILASAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L S  +D TIR W+  L G C   ++     VN L +S+D      A       +D + 
Sbjct: 291 VLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGA-------FDHKG 343

Query: 63  TNP-NPVTSFEGHRGNVTSIAFQQEN--KWMVSSSEDGTIKVWDVRAPS--VQRNYKHQA 117
             P +P  + +    N   +A ++ +  + MV++S+D T+ +W+    +  + R   HQ 
Sbjct: 344 ETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQK 403

Query: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177
            VN V   P                                           DG  +V+ 
Sbjct: 404 LVNHVAFSP-------------------------------------------DGRYIVSA 420

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +   +  +W      D  + K ++ FR H   + +V  SSD + L +CS D T +VW + 
Sbjct: 421 SFDNSIKLW------DGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 474

Query: 238 DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              +L   L  HQ  V+   +S D   + +   D  VR+W
Sbjct: 475 TR-KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 55/152 (36%), Gaps = 13/152 (8%)

Query: 154 LAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRV 213
           +A    T L S    +  S +V G       +W    QT           + H  ++   
Sbjct: 139 IAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCT------LQGHHNWVLCC 192

Query: 214 LLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS-------ADSAYLV 266
             S D + +AT S D+T R+W           L  H +W+   ++         D   L 
Sbjct: 193 SWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLA 252

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           TA  D  +++WD + R  +    GH     CV
Sbjct: 253 TASKDGTIKIWDTTRRVCLLTLCGHTSSVSCV 284

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRT 62
           ++ SA  D  ++ W+       R      S V+ +++      +A+AG    VRL+DIRT
Sbjct: 182 LMFSASEDKLVKCWDLEKNTVVRDYHGHFSGVHTVDVHPTLDLIASAGRDAVVRLWDIRT 241

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA-AVNE 121
             P  V +  GH+G +  +     +  ++S S D T+++WD+RA    +   H + +V  
Sbjct: 242 RVP--VMTLAGHKGPINQVKCFPVDPQIMSGSADSTVRLWDIRAGKAMKILTHHSKSVRA 299

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
           +  +P++   ++     ++R W L + Q +     ED   +  LSV  DG +L AG + G
Sbjct: 300 IAGNPSESS-VATASTSDIRSWRLQDGQLLTNFRSEDTGIINCLSVNPDG-VLFAGGDDG 357

Query: 182 NC--YVWQMPHQ-TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
           +   Y ++  H+  D    K      S    ++     + ++ L T  +D + +VW
Sbjct: 358 HLSFYDYKTGHKFQDLPTIKVPGSLESERGILSASFDQTGLR-LITGESDKSIKVW 412

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 96/237 (40%), Gaps = 12/237 (5%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
           F   +    ++++D+ +       +  GH   V SIA  Q +  M S+SED  +K WD+ 
Sbjct: 141 FATGSNDTTIKVWDLASGKLK--LTLAGHVMTVRSIAISQRHPLMFSASEDKLVKCWDLE 198

Query: 106 APSVQRNY-KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQS 164
             +V R+Y  H + V+ V +HP    + S  +D  VR+WD+     V  LA     P+  
Sbjct: 199 KNTVVRDYHGHFSGVHTVDVHPTLDLIASAGRDAVVRLWDIRTRVPVMTLAGHKG-PINQ 257

Query: 165 LSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLAT 224
           +        +++G+      +W      D    K +     H+K +  +  +     +AT
Sbjct: 258 VKCFPVDPQIMSGSADSTVRLW------DIRAGKAMKILTHHSKSVRAIAGNPSESSVAT 311

Query: 225 CSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            S     R W + D  QL T   +    + +C        L     D ++  +D  T
Sbjct: 312 ASTSDI-RSWRLQDG-QLLTNFRSEDTGIINCLSVNPDGVLFAGGDDGHLSFYDYKT 366

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 94/232 (40%), Gaps = 12/232 (5%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V  +     +N+W  + S D TIKVWD+ +  ++     H   V  + I      
Sbjct: 123 GHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQRHPL 182

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           + S  +D  V+ WDL +N  V        + + ++ V     ++ +        +W    
Sbjct: 183 MFSASEDKLVKCWDLEKNTVVRDYHGH-FSGVHTVDVHPTLDLIASAGRDAVVRLW---- 237

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             D     PV     H   I +V        + + SAD T R+W I     ++  L +H 
Sbjct: 238 --DIRTRVPVMTLAGHKGPINQVKCFPVDPQIMSGSADSTVRLWDIRAGKAMK-ILTHHS 294

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
           + V   A +   + + TA +   +R W L   +++  +     G I C+++N
Sbjct: 295 KSVRAIAGNPSESSVATASTSD-IRSWRLQDGQLLTNFRSEDTGIINCLSVN 345

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 94/226 (41%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V ++A    +N+W  + S D TIK+WD+    ++     H   V ++ I      
Sbjct: 127 GHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPY 186

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           + S  +D  V+ WDL +N+ +        + + ++ +    +++          +W    
Sbjct: 187 MFSASEDKLVKCWDLEKNRVIRDYHGH-LSGVHTVDIHPTLNLIATAGRDSVVRLW---- 241

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             D     PV     H   I RV        + +CSAD T R+W I     L+  L +H+
Sbjct: 242 --DIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKTLK-VLTHHK 298

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V D         + +AC+D  +R W L   +++  +     G I
Sbjct: 299 RSVRDIGIHPGEFSISSACTDD-IRSWKLPEGQLLTNFQSEKTGII 343

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/296 (18%), Positives = 115/296 (38%), Gaps = 21/296 (7%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-VRLYDIRTT 63
            A+   D TI+ W+  TG    T+      V  + IS    ++ +A     V+ +D+   
Sbjct: 145 FATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKN 204

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAP-SVQRNYKHQAAVNEV 122
               +  + GH   V ++        + ++  D  +++WD+R    V     H++ +N V
Sbjct: 205 RV--IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRV 262

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
              P   +++SC  D  VR+WD+   + +  L     + ++ + +   G   ++     +
Sbjct: 263 KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRS-VRDIGIHP-GEFSISSACTDD 320

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITR--------VLLSSDVKHLATCSADHTARVW 234
              W++P        + +T F+S    I          VL +     + +     T   +
Sbjct: 321 IRSWKLPEG------QLLTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKY 374

Query: 235 SIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290
              D  ++  +L++ +R +    F      L+T  SD  +++W          Y G
Sbjct: 375 QQLDTTEIPGSLES-ERGILTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            AT S D T ++W +    +L+ TL  H   V D   S    Y+ +A  D  V+ WDL  
Sbjct: 145 FATGSNDTTIKIWDLATG-KLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEK 203

Query: 282 REIVRQYGGHHKGAICVAL 300
             ++R Y GH  G   V +
Sbjct: 204 NRVIRDYHGHLSGVHTVDI 222

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/244 (20%), Positives = 95/244 (38%), Gaps = 48/244 (19%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ISSDKRFLAAAGHLNVRLYDIRT 62
           ++A+AG D  +R W+  T +   T+    S +NR++ +  D + ++ +    VRL+DI  
Sbjct: 228 LIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDI-- 285

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
                                          +   T+KV             H+ +V ++
Sbjct: 286 -------------------------------TAGKTLKVL----------THHKRSVRDI 304

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG- 181
            IHP +  + S   D ++R W L E Q +     E    + +LS+  D  +L AG++ G 
Sbjct: 305 GIHPGEFSISSACTD-DIRSWKLPEGQLLTNFQSEKTGIINTLSINQD-DVLFAGSDNGV 362

Query: 182 -NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240
            + Y ++  H+    +   +       + I           L T  +D + ++W  D + 
Sbjct: 363 LSFYDYKTGHKYQQLDTTEIPGSLESERGILTSTFDQTGLRLITGESDKSIKIWKQDQDA 422

Query: 241 QLET 244
             ET
Sbjct: 423 TPET 426

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 108/245 (44%), Gaps = 10/245 (4%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L S   D T++ W+       R      S V  + I      +A AG  +V +L+DIRT 
Sbjct: 197 LFSVSEDKTVKCWDLEKNHIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIRTR 256

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
            P  V +  GH+G +  +     +  +VSSS D T+++WD+ A    +    H+ +V   
Sbjct: 257 MP--VITLVGHKGPINQVQCTPVDPQIVSSSTDATVRLWDIVAGKAMKVLTHHKRSVRAT 314

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +HP +  L S   D ++R W + +   +     E    + +LS+  D  +L AG + G 
Sbjct: 315 ALHPKEFSLASACTD-DIRSWGIADGSLLTNFESEKTGIINTLSINQD-DVLFAGGDDGT 372

Query: 183 C--YVWQMPHQTDA-ANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
              Y ++  H+  + A  + V    S    +      + ++ L T  AD + ++W  D+ 
Sbjct: 373 LSFYDYKSGHKYQSLATREMVGSLESERSVLCSTFDKTGLR-LITGEADKSIKIWKQDET 431

Query: 240 FQLET 244
              E+
Sbjct: 432 ATRES 436

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 92/226 (40%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V   A    +N+W V+ S D T+KVWD+    ++     H   V ++ +      
Sbjct: 137 GHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLATGKLKTTLAGHVMTVRDIAVSDRHPY 196

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L S  +D  V+ WDL +N  +        + ++++S+     ++          +W    
Sbjct: 197 LFSVSEDKTVKCWDLEKNHIIRDYYGH-LSGVRTVSIHPTLDLIATAGRDSVVKLW---- 251

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             D     PV     H   I +V  +     + + S D T R+W I     ++  L +H+
Sbjct: 252 --DIRTRMPVITLVGHKGPINQVQCTPVDPQIVSSSTDATVRLWDIVAGKAMK-VLTHHK 308

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V   A       L +AC+D  +R W ++   ++  +     G I
Sbjct: 309 RSVRATALHPKEFSLASACTDD-IRSWGIADGSLLTNFESEKTGII 353

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
             T S D T +VW +    +L+TTL  H   V D A S    YL +   D  V+ WDL  
Sbjct: 155 FVTGSNDTTMKVWDLATG-KLKTTLAGHVMTVRDIAVSDRHPYLFSVSEDKTVKCWDLEK 213

Query: 282 REIVRQYGGHHKGAICVALN 301
             I+R Y GH  G   V+++
Sbjct: 214 NHIIRDYYGHLSGVRTVSIH 233

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 240 FQLETTLDNHQRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           ++L   ++ H  WV   A    D+ + VT  +D  +++WDL+T ++     GH      +
Sbjct: 129 WKLLRVINGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLATGKLKTTLAGHVMTVRDI 188

Query: 299 ALND 302
           A++D
Sbjct: 189 AVSD 192

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 108/265 (40%), Gaps = 46/265 (17%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N ++ + D  +LA A      +   YD  T    P   F GH  +VT++       +  
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHW 484

Query: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG 146
            ++++++S D TIK W++  PS +    H    +E                         
Sbjct: 485 PEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYT----------------------- 521

Query: 147 ENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSH 206
                 + A E D  + +LSV+ + S+    +      +W      D    +      +H
Sbjct: 522 ------RRAHEKD--INALSVSPNDSVFATASYDKTSKIW------DLETGELTATLANH 567

Query: 207 AKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLV 266
            + +  V      K LATCS D T ++WS+D  F +  TL+ H   V  C F      LV
Sbjct: 568 KRGLWDVSFCQYDKLLATCSGDKTIKIWSLD-TFSVVRTLEGHTNAVQRCHFINKQTQLV 626

Query: 267 TACSDHYVRLWDLSTREIVRQYGGH 291
           ++ +D  +++WD S+ E V+   GH
Sbjct: 627 SSGADGLIKIWDCSSGECVKTLDGH 651

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 5/167 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAA-AGHLNVRLYDIRT 62
           + A+A YD T + W+  TG  + T+ +    +  +      + LA  +G   ++++ + T
Sbjct: 540 VFATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDT 599

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122
              + V + EGH   V    F  +   +VSS  DG IK+WD  +    +     A     
Sbjct: 600 F--SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWA 657

Query: 123 VIHPNQGELI-SCDQDGNVRIW-DLGENQCVHQLAPEDDTPLQSLSV 167
           +     GELI S D DG  + W D  E Q    L  E +   Q  S+
Sbjct: 658 LTIQRDGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQEQSL 704

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV-- 219
           L ++    DG  L   +      VW+   +T  A  KP  KF  H+  +T V L + +  
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDET--AKFKPYAKFIGHSSSVTAVGLPNVMLR 482

Query: 220 ---KHLATCSADHTARVWSI---DDNFQ-------LETTLDNHQRWVWDCAFSADSAYLV 266
              + L T S D T + W+I    D  +        E T   H++ +   + S + +   
Sbjct: 483 HWPEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKG 294
           TA  D   ++WDL T E+      H +G
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRG 570

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/256 (19%), Positives = 102/256 (39%), Gaps = 33/256 (12%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEG-------------HRGNVTSIAFQQENKWMVS 92
            L A+  L ++ ++I    P P    EG             H  ++ +++    +    +
Sbjct: 488 LLTASNDLTIKKWNI----PKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFAT 543

Query: 93  SSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCV 151
           +S D T K+WD+    +      H+  + +V        L +C  D  ++IW L     V
Sbjct: 544 ASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVV 603

Query: 152 HQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYIT 211
             L    +  +Q     +  + LV+    G   +W      D ++ + V     HA  I 
Sbjct: 604 RTLEGHTNA-VQRCHFINKQTQLVSSGADGLIKIW------DCSSGECVKTLDGHANRIW 656

Query: 212 RVLLSSDVKHLATCSADHTARVWS------IDDNFQLETTLDNHQRWVWDCAFSAD--SA 263
            + +  D + +A+  AD   + W+       + + + E  L   ++ + +   + D  +A
Sbjct: 657 ALTIQRDGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQEQSLQNYLANEDWANA 716

Query: 264 YLVTACSDHYVRLWDL 279
           +L+    DH +RL+++
Sbjct: 717 FLLAITLDHPMRLFNV 732

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 112/266 (42%), Gaps = 30/266 (11%)

Query: 14  IRFWEALTGVCSRTIQ-HSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFE 72
           ++  E  TG   R+++  S S +   E +S    L A G  +  +  +   N     SF+
Sbjct: 114 LKIVEVATGKVMRSMKISSPSYIMDSEATST---LVAVGGTDGSIIVVDIENGYVTHSFK 170

Query: 73  GHRGNVTSIAFQQE---NKWMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAAVNEVVIH-- 125
           GH G ++ + F  E   N W+++S + +G IKVW+ V         +H +AV  + I   
Sbjct: 171 GHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSI 230

Query: 126 -----PNQGELISCDQDGNVRIWDL-GENQC-VHQLAPEDDTPLQSLSVASDGSMLVAGN 178
                  Q ++IS  +D  V  W+L  + +C + Q  P      Q   +AS G   +   
Sbjct: 231 SDDTKSMQLQMISGGRDDVVNYWELDNKKKCKLLQTIPAHQQVEQCGFIASPGHKNLIYT 290

Query: 179 NKGNCYVWQMPHQTDA---ANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235
           + G+  +  +  +  +    + KP+ +      +I  VL  S  + L +  +D +     
Sbjct: 291 SGGDAIMQFISLEKGSIVKKSKKPIEEL-----FIIGVLPISQGEKLISVMSDQSLHYLD 345

Query: 236 IDDNFQLETTLDNHQRWVWDCAFSAD 261
           ++ N +      N +   ++ A + +
Sbjct: 346 VESNLKAT----NEEELTYESALAGN 367

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 119/274 (43%), Gaps = 45/274 (16%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAFQQ--ENKW 89
           +N L+ + D  ++A A   N  +   ++           F GH  +VTS++      N W
Sbjct: 333 LNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGW 392

Query: 90  ---MVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLG 146
              +++SS D T+K W V +P+ +                        D D ++ +  + 
Sbjct: 393 PEFIITSSNDFTVKKWKVPSPTKK-----------------------SDNDDDMHLIKVS 429

Query: 147 ENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSH 206
           E     + A E D  + +LS+A + S+    +    C +W      D  + + +    +H
Sbjct: 430 E---YTRRAHEKD--INALSIAPNDSIFATASYDKTCKIW------DLDSGELMATLANH 478

Query: 207 AKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLV 266
            + +  V      K++AT S D T ++WS++  F++  TL+ H   V  C+F      +V
Sbjct: 479 KRGLWDVSFCQYDKYIATASGDKTIKIWSLE-TFKVVNTLEGHTNAVQRCSFINKQKQIV 537

Query: 267 TACSDHYVRLWDLSTREIVRQYGGHHKG--AICV 298
           +  +D  +++WD S+ E ++   GH     A+CV
Sbjct: 538 STGADGLIKIWDCSSGECLKTLDGHANRIWALCV 571

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 96/229 (41%), Gaps = 15/229 (6%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           I A+A YD T + W+  +G    T+  H     +      DK    A+G   ++++ + T
Sbjct: 451 IFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLET 510

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNE 121
                V + EGH   V   +F  + K +VS+  DG IK+WD  +    +    H   +  
Sbjct: 511 F--KVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWA 568

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM--LVAGNN 179
           + +  +   +I+ D DG  + W      C  ++  E D   + L V  + S+   +A   
Sbjct: 569 LCVLRDGDMIITADADGVFQFW----KDCTEEVK-EQDLEKEKLRVEQEQSLRNFIANGE 623

Query: 180 KGNCYVWQM----PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLAT 224
             N ++  M    P +      + +T + S      +V+ + ++ H+ +
Sbjct: 624 WTNAFLLAMTLDHPMRLYNVLKQSMTSYESDETGSNKVIFNPELDHVIS 672

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 90/240 (37%), Gaps = 42/240 (17%)

Query: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGE 130
           F+    NV+          + + SEDG+I    +  P V         +N V +  N G 
Sbjct: 3   FKSSYSNVSLSPIYASTGAVATISEDGSI----LATPVVDE-------INIVALEDNAGN 51

Query: 131 ---LISCDQD--------GNVRIWDLGENQCVHQLAPEDDT--PLQSLSVASDGSMLVAG 177
              L + + D        G V + D+ EN   H L     T   L+    + D   L+A 
Sbjct: 52  GTLLTTVENDDEQDXXXGGPVSVLDI-ENYITHSLKGHGATISSLKFYGESEDSVWLLAS 110

Query: 178 NNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLS-----SDVKHLATCSADHTAR 232
            +     VW      D    K +   + H+  +  +        SD+ HL T   D+   
Sbjct: 111 GDTNMVKVW------DLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIIN 164

Query: 233 VWSID--DNFQLETTLDNHQRWVWDCAF---SADSAYLVTACSDHYVRLWDLSTREIVRQ 287
            W+I    NF+L  T   HQ+ V  C F   + D   + TA  D   ++  LS   ++++
Sbjct: 165 HWTISGLKNFKLIRTFPVHQQ-VEACGFIKSTEDDNCIYTAGGDAVFQILSLSNGSVIKK 223

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 70  SFEGHRGNVTSIAFQQENK---WMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEV 122
           S +GH   ++S+ F  E++   W+++S +   +KVWD V+   +    +H +AV  +
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGI 140

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 101/238 (42%), Gaps = 6/238 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L S   D T++ W+       R      S V  + I      +A AG  +V +L+DIRT 
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDIRTR 256

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
            P  V +  GH+G +  +     +  +VSSS D T+++WDV A    +    H+ +V   
Sbjct: 257 VP--VITLVGHKGPINQVQCTPVDPQIVSSSTDATVRLWDVVAGKAMKVLTHHKRSVRAT 314

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-G 181
            +HP +  + S   D ++R W L E   +     E    + +LS+  D  +   G+N   
Sbjct: 315 ALHPKEFSVASACTD-DIRSWGLVEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGIL 373

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
           + Y ++  H+  +   K +       + +           L T  AD + ++W  D+ 
Sbjct: 374 SFYDYKSGHKYQSLATKEMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIWKQDET 431

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 91/226 (40%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V   A     N+W ++ S D T+KVWD+    ++     H   V ++ I      
Sbjct: 137 GHLGWVRCAAIDPVNNEWFITGSNDTTMKVWDLATGKLRTTLAGHVMTVRDIAISDRHPY 196

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L S  +D  V+ WDL +NQ +        + ++++S+     ++          +W    
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYYGH-LSGVRTVSIHPTLDLIATAGRDSVIKLW---- 251

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
             D     PV     H   I +V  +     + + S D T R+W +     ++  L +H+
Sbjct: 252 --DIRTRVPVITLVGHKGPINQVQCTPVDPQIVSSSTDATVRLWDVVAGKAMK-VLTHHK 308

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V   A       + +AC+D  +R W L    ++  +     G I
Sbjct: 309 RSVRATALHPKEFSVASACTDD-IRSWGLVEGSLLTNFESEKTGII 353

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
           F+  +    ++++D+ T      T+  GH   V  IA    + ++ S SED T+K WD+ 
Sbjct: 155 FITGSNDTTMKVWDLATGKLR--TTLAGHVMTVRDIAISDRHPYLFSVSEDKTVKCWDLE 212

Query: 106 APSVQRN-YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
              + R+ Y H + V  V IHP    + +  +D  +++WD+
Sbjct: 213 KNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDI 253

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
             T S D T +VW +    +L TTL  H   V D A S    YL +   D  V+ WDL  
Sbjct: 155 FITGSNDTTMKVWDLATG-KLRTTLAGHVMTVRDIAISDRHPYLFSVSEDKTVKCWDLEK 213

Query: 282 REIVRQYGGHHKGAICVAL 300
            +I+R Y GH  G   V++
Sbjct: 214 NQIIRDYYGHLSGVRTVSI 232

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 110/239 (46%), Gaps = 13/239 (5%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGEL 131
           +GHR +V +I    +NK + ++S +G++K+W+++  S  R ++   A+    + P    +
Sbjct: 382 KGHRTDVRAIDISDDNKLLATAS-NGSLKIWNIKTKSCIRTFECGYALACKFL-PGGALV 439

Query: 132 ISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ---- 187
           +   + G++ ++DL  +  +  +       + SL + +DG  LV G+   +   W     
Sbjct: 440 VIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSADKSVRFWDFQVE 499

Query: 188 ---MPHQTDAANPKPVTKFRSHAKY---ITRVLLSSDVKHLATCSADHTARVWSIDDNFQ 241
              +P  TD   PK      +  +    +  V +S D + LA    D+T +V+ +D + +
Sbjct: 500 QELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVKVFFLD-SMK 558

Query: 242 LETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              +L  H+  V     S DS  L+T+ +D  +++W L   +  +    H    + VA 
Sbjct: 559 FFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGDCHKSLFAHSDSIMKVAF 617

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 122/296 (41%), Gaps = 38/296 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +LA+A  + +++ W   T  C RT +   +   +  +      +      ++ L+D+ ++
Sbjct: 399 LLATAS-NGSLKIWNIKTKSCIRTFECGYALACKF-LPGGALVVIGTKTGDLNLFDLASS 456

Query: 64  NPNPVTSFEG-HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------------PSV 109
               ++S E  H G + S+    + K +V+ S D +++ WD +              P +
Sbjct: 457 TL--LSSIEAAHSGAIWSLDLTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKL 514

Query: 110 QRNYKHQAAVNE----VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSL 165
           +  +     +N+    V I P+   L     D  V+++ L   +    L      P+ S+
Sbjct: 515 KMFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSI 573

Query: 166 SVASDGSMLVAGNNKGNCYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
            ++ D  +L+  +   N  VW +     H++            +H+  I +V    +  +
Sbjct: 574 DISFDSKLLITSSADKNIKVWGLDFGDCHKS----------LFAHSDSIMKVAFLPESHN 623

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             +C  D   + W   D F+    L  HQ+ VW  A S D  ++V+A  D  +R+W
Sbjct: 624 FFSCGKDGLVKYWD-GDKFECIQKLAAHQKEVWTIAISHDGTFVVSASHDQSIRVW 678

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVV 123
           P  V +        T + +  E K + +   DG +K+WD+ + SV  N+  H++A+  + 
Sbjct: 65  PGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLK 124

Query: 124 IHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNC 183
                  LIS  +D ++ +WDL     + +L    D+         D   LV+ +  G  
Sbjct: 125 FDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGED--WLVSTSKDGLI 182

Query: 184 YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
            VW +  Q      + V    +H      + +  D+  + TC  D+  ++WS+D
Sbjct: 183 KVWDLKTQ------QCVETHVAHVGECWSMGVHEDL--VVTCGGDNQIKLWSVD 228

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 60/111 (54%), Gaps = 10/111 (9%)

Query: 47  LAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD- 103
           L AAG+ +  V+++D+   + + + +F GH+  +T + F      ++S S+D  I VWD 
Sbjct: 89  LLAAGYNDGVVKIWDL--LSKSVLINFNGHKSAITVLKFDSTGTRLISGSKDSDIIVWDL 146

Query: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGE--LISCDQDGNVRIWDLGENQCVH 152
           V    + +   H+ ++  +     +GE  L+S  +DG +++WDL   QCV 
Sbjct: 147 VGEVGLFKLRSHKDSITGLWC---EGEDWLVSTSKDGLIKVWDLKTQQCVE 194

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 129/299 (43%), Gaps = 38/299 (12%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 30  LLLSASRDKTLISWK-LTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIR 88

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+G+V S+A  ++   ++S S D TIKVW ++   +     H 
Sbjct: 89  LWDVSTGET--FQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGECLATMLGHN 146

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN         +IS   D  V+ W++ + Q        ++  + ++  + D
Sbjct: 147 DWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVNQFQIDADFIGHNNY-INAIVASPD 205

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           GS++ +    G   +W      D A  + +    +H +     L  S  ++    +    
Sbjct: 206 GSLIASAGKDGEIMMW------DLAQKRALYTLSAHDEVFA--LAFSPNRYWLAAATSSG 257

Query: 231 ARVWSID-----DNFQLE-----TTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            +++S++     DN   E        + H       A+SAD   L    +D+ +R+W +
Sbjct: 258 IKIFSLEPQGIIDNLNPEFAGYTKAAEPHPL---SLAWSADGQTLFAGYTDNVIRVWQV 313

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/235 (19%), Positives = 100/235 (42%), Gaps = 22/235 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     Q     R++K H   V + 
Sbjct: 10  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDC 69

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   +   +        + S+++    SM+++G+    
Sbjct: 70  ALTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGD-VMSVAIDRKASMIISGSRDKT 128

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSS------DVKHLATCSADHTARVWSI 236
             VW +  +        +     H  ++++V ++       D   + +  +D   + W++
Sbjct: 129 IKVWSIKGEC-------LATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNV 181

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
           +  FQ++     H  ++     S D + + +A  D  + +WDL+ +  +     H
Sbjct: 182 N-QFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQKRALYTLSAH 235

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  + +   +   H   V DCA
Sbjct: 11  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCA 70

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD+ST E  +++ GH    + VA++
Sbjct: 71  LTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAID 114

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 107/266 (40%), Gaps = 35/266 (13%)

Query: 41  SSDKRFL-AAAGHLNVRLYDIRTTNPNPV-TSFEGHRGNVTSIAFQQENKWMVSSSEDGT 98
           S D RFL   +  L  R++ + + +     T+F GHR  V    F Q+ + + + S+DG 
Sbjct: 155 SHDSRFLLTTSKDLTSRIWSVASEDKELASTTFAGHRDYVLGAFFSQDQEKIYTVSKDGA 214

Query: 99  IKVWDV------------------------RAPSVQRNYKHQAAVNEVVIHPNQGELISC 134
           + VW+                         R  +    + +QA V  V  HP    L+  
Sbjct: 215 LFVWEYTTDPDEEDVEDESDEEIDLSKYSWRITAKHYFFANQAKVKCVTFHPQTNMLVVG 274

Query: 135 DQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYVWQMPHQTD 193
             +G  R+++L     + QL+     P+ ++SV S G  L  G+   G   V++   ++ 
Sbjct: 275 FTNGEFRLYELPSFVLLQQLSM-GQHPVNTVSVNSTGEWLAFGSKTLGQLLVYEWQSES- 332

Query: 194 AANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWV 253
                 + K + H   +  +  S D   + T S D   ++W +   F L  T + H   V
Sbjct: 333 -----YILKQQGHFDTLNGLTYSPDGSRVVTASEDGKIKIWDVVSGFCL-ATFEEHTSAV 386

Query: 254 WDCAFSADSAYLVTACSDHYVRLWDL 279
               FS     L +A  D  VR WDL
Sbjct: 387 SAVQFSKRGQVLFSASLDGTVRAWDL 412

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 97/225 (43%), Gaps = 8/225 (3%)

Query: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEG 73
            R +E  + V  + +      VN + ++S   +LA       +L      + + +   +G
Sbjct: 280 FRLYELPSFVLLQQLSMGQHPVNTVSVNSTGEWLAFGSKTLGQLLVYEWQSESYILKQQG 339

Query: 74  HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGELI 132
           H   +  + +  +   +V++SEDG IK+WDV +      + +H +AV+ V        L 
Sbjct: 340 HFDTLNGLTYSPDGSRVVTASEDGKIKIWDVVSGFCLATFEEHTSAVSAVQFSKRGQVLF 399

Query: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVWQMPHQ 191
           S   DG VR WDL   +        +     SL+V   G ++ AG+ +     VW +  Q
Sbjct: 400 SASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDPSGEVVCAGSIDNYEIQVWSV--Q 457

Query: 192 TDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
           T     + +     H   ++ +  S +   LA+ S D T RVWSI
Sbjct: 458 TG----QLLDCLAGHEGPVSCLAFSQENNVLASASWDKTIRVWSI 498

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 86/207 (41%), Gaps = 10/207 (4%)

Query: 81  IAFQQENKWMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGN 139
           + F  + K ++S   +  + V+D +   S    Y+H+  ++   ++     L+S D DG 
Sbjct: 20  LVFSHDGKQLLSPVGN-RVSVFDLINNKSFTFEYEHRKNISTFDLNRQGTLLLSVDDDGR 78

Query: 140 VRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKP 199
             + +      +H    ++      L  + DG      + +    +W+ P         P
Sbjct: 79  AILVNFKSRNVLHHFNFKEKCT--HLKFSPDGKWFAIASGRF-LQIWKTPDVGQDRQFAP 135

Query: 200 VTKFR---SHAKYITRVLLSSDVKHLATCSADHTARVWSI--DDNFQLETTLDNHQRWVW 254
             + R    H + +T V  S D + L T S D T+R+WS+  +D     TT   H+ +V 
Sbjct: 136 FVRHRIQAGHFQDLTSVSWSHDSRFLLTTSKDLTSRIWSVASEDKELASTTFAGHRDYVL 195

Query: 255 DCAFSADSAYLVTACSDHYVRLWDLST 281
              FS D   + T   D  + +W+ +T
Sbjct: 196 GAFFSQDQEKIYTVSKDGALFVWEYTT 222

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 82/209 (39%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L +      + A    N  +     
Sbjct: 397 VLFSASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDPSGEVVCAGSIDNYEIQVWSV 456

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                +    GH G V+ +AF QEN  + S+S D TI+VW +   S Q       A V  
Sbjct: 457 QTGQLLDCLAGHEGPVSCLAFSQENNVLASASWDKTIRVWSIFGRSQQVEPIDVSADVLA 516

Query: 122 VVIHPNQGELISCDQDGNVRIWDL------GENQCVHQLA-------------PEDDTPL 162
           + I P+  ++      G + ++D+      G   C   +               E     
Sbjct: 517 LSIRPDGRQVAVSTLKGQITMFDIESGLQVGNIDCRRDIISGRHLEDRFTSKNSERSKYF 576

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            ++  + DG  LVA  N  +  ++ +P++
Sbjct: 577 TTIHYSFDGLALVAAGNNNSICLYDIPNE 605

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 93/212 (43%), Gaps = 18/212 (8%)

Query: 78  VTSIAFQQENKWMVSSSED-GTIKVWDVRAPS-VQRNYKHQAAVNEVVIHPNQGELISCD 135
           V +++     +W+   S+  G + V++ ++ S + +   H   +N +   P+   +++  
Sbjct: 301 VNTVSVNSTGEWLAFGSKTLGQLLVYEWQSESYILKQQGHFDTLNGLTYSPDGSRVVTAS 360

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
           +DG ++IWD+    C+     E  + + ++  +  G +L + +  G    W +    +  
Sbjct: 361 EDGKIKIWDVVSGFCLATF-EEHTSAVSAVQFSKRGQVLFSASLDGTVRAWDLIRYRN-- 417

Query: 196 NPKPVTKFRSH--AKYITRVLLSSDVKHLATCSA---DHTARVWSIDDNFQLETTLDNHQ 250
                  FR+   A+ I    L+ D      C+    ++  +VWS+    QL   L  H+
Sbjct: 418 -------FRTFTAAERIQFNSLAVDPSGEVVCAGSIDNYEIQVWSVQTG-QLLDCLAGHE 469

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
             V   AFS ++  L +A  D  +R+W +  R
Sbjct: 470 GPVSCLAFSQENNVLASASWDKTIRVWSIFGR 501

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 103/243 (42%), Gaps = 6/243 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L S   D T++ W+       R      S V  + I      +A AG  +V +L+D+RT 
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTR 256

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
            P  V +  GH+G +  +     +  +VSSS D T+++WDV A    +    H+ +V   
Sbjct: 257 IP--VITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRAT 314

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG- 181
            +HP +  + S   D ++R W L E   +     E    + +LS+  D  +   G+N   
Sbjct: 315 ALHPKEFSVASACTD-DIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVL 373

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQ 241
           + Y ++  H+  +   + +       + +           L T  AD + ++W  D+   
Sbjct: 374 SFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIWKQDETAT 433

Query: 242 LET 244
            E+
Sbjct: 434 KES 436

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 95/226 (42%), Gaps = 11/226 (4%)

Query: 73  GHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGE 130
           GH G V  +A    +N+W ++ S D T+KVWD+    ++     H   V +V +      
Sbjct: 137 GHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPY 196

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPH 190
           L S  +D  V+ WDL +NQ +        + ++++S+     ++          +W M  
Sbjct: 197 LFSVSEDKTVKCWDLEKNQIIRDYYGH-LSGVRTVSIHPTLDLIATAGRDSVIKLWDMRT 255

Query: 191 QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQ 250
           +       PV     H   I +V  +     + + S D T R+W +     ++  L +H+
Sbjct: 256 RI------PVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMK-VLTHHK 308

Query: 251 RWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           R V   A       + +AC+D  +R W L+   ++  +     G I
Sbjct: 309 RSVRATALHPKEFSVASACTDD-IRSWGLAEGSLLTNFESEKTGII 353

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 46  FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVR 105
           F+  +    ++++D+ T      T+  GH   V  +A    + ++ S SED T+K WD+ 
Sbjct: 155 FITGSNDTTMKVWDLATGKLK--TTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLE 212

Query: 106 APSVQRN-YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
              + R+ Y H + V  V IHP    + +  +D  +++WD+
Sbjct: 213 KNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDM 253

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
             T S D T +VW +    +L+TTL  H   V D A S    YL +   D  V+ WDL  
Sbjct: 155 FITGSNDTTMKVWDLATG-KLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEK 213

Query: 282 REIVRQYGGHHKGAICVAL 300
            +I+R Y GH  G   V++
Sbjct: 214 NQIIRDYYGHLSGVRTVSI 232

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 240 FQLETTLDNHQRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           ++L   ++ H  WV   A    D+ + +T  +D  +++WDL+T ++     GH      V
Sbjct: 129 WKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDV 188

Query: 299 ALND 302
           A++D
Sbjct: 189 AVSD 192

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 109/250 (43%), Gaps = 32/250 (12%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYKHQAAV 119
           P  V  +EGH   + S+   ++  W+ ++S+D T  +W     + +     +   H +AV
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAV 437

Query: 120 NEVVIHPN---QGE---LISCDQDGNVRIWDLGENQCVHQL-----------APEDDTPL 162
             V + PN   +G    L++   D  ++ W + +   +  +           A E D  +
Sbjct: 438 TAVGL-PNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKD--I 494

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL 222
            +LSV+ + S+    +    C +W +       N +      +H + +  V      K L
Sbjct: 495 NALSVSPNDSIFATASYDKTCKIWSLE------NGELEATLANHKRGLWDVSFCQYDKLL 548

Query: 223 ATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           AT S D T ++WS+D  F +  TL+ H   V  C+F      LV+  +D  +++WD S+ 
Sbjct: 549 ATSSGDKTVKIWSLD-TFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSG 607

Query: 283 EIVRQYGGHH 292
           E +    GH+
Sbjct: 608 ECLNTLDGHN 617

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 75/185 (40%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           I A+A YD T + W    G    T+ +                                 
Sbjct: 505 IFATASYDKTCKIWSLENGELEATLAN--------------------------------- 531

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
                     H+  +  ++F Q +K + +SS D T+K+W +   SV +  + H  AV   
Sbjct: 532 ----------HKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRC 581

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                Q +L+SC  DG ++IWD    +C++ L   ++  L +L+  +DG M+V+ +  G 
Sbjct: 582 SFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNR-LWALNTMNDGDMIVSADADGV 640

Query: 183 CYVWQ 187
              W+
Sbjct: 641 FQFWK 645

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 102/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAF-----QQE 86
           +N L+ + D  ++A A   N  +   Y+ RT+  +    + GH   VT++       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 450

Query: 87  NKWMVSSSEDGTIKVWDVRAPS----VQ-------RNYKHQAAVNEVVIHPNQGELISCD 135
            ++++++S D TIK W V  P+    VQ         + H+  +N + + PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 510

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
            D   +IW L EN  +          L  +S      +L   +      +W +   +   
Sbjct: 511 YDKTCKIWSL-ENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFS--- 566

Query: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255
               +     H+  + R    +  K L +C AD   ++W       L  TLD H   +W 
Sbjct: 567 ---VMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECL-NTLDGHNNRLWA 622

Query: 256 CAFSADSAYLVTACSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 623 LNTMNDGDMIVSADADGVFQFW 644

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 71/153 (46%), Gaps = 15/153 (9%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG-HLNVRLYDIRTT 63
           LA       ++ ++  TG   R+++ S S    L+       LA  G   ++ + DI   
Sbjct: 76  LAYVSQAQLLKIFQLKTGRIVRSLKIS-SPSYILDTDPTSTLLAVGGTDGSIVIVDIE-- 132

Query: 64  NPNPVTSFEGHRGNVTSIAFQQE---NKWMVSSSE-DGTIKVWD-VRAPSVQRNYKHQAA 118
           N     S +GH G ++S+ F  +     W+++S + +G +KVWD V+   +    +H +A
Sbjct: 133 NGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSA 192

Query: 119 VNEV-VIHPNQGE-----LISCDQDGNVRIWDL 145
           V  + +I    G+     L+S  +D  V +WD 
Sbjct: 193 VRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDF 225

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 54/153 (35%), Gaps = 28/153 (18%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYI----------- 210
           L SL    DG  +   +      +W+   +T        +KF  +AKYI           
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERT--------SKFDIYAKYIGHSSAVTAVGL 442

Query: 211 TRVLLSSDVKHLATCSADHTARVWSIDDNFQL---------ETTLDNHQRWVWDCAFSAD 261
             V+     + L T S D T + W +     +         E T   H++ +   + S +
Sbjct: 443 PNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPN 502

Query: 262 SAYLVTACSDHYVRLWDLSTREIVRQYGGHHKG 294
            +   TA  D   ++W L   E+      H +G
Sbjct: 503 DSIFATASYDKTCKIWSLENGELEATLANHKRG 535

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 56/231 (24%), Positives = 109/231 (47%), Gaps = 19/231 (8%)

Query: 64  NPNPVTSF----EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAV 119
           NP+P   +    +GHR ++ SI    +NK + S+S +G +K+W+++  S  R +    A+
Sbjct: 372 NPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASAS-NGLLKIWNLKTKSCIRTFDCGYAL 430

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN 179
               + P+    +   ++G ++++DL  +  +  +    +  + SL +  DG  LV G+ 
Sbjct: 431 TCKFL-PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSA 489

Query: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYI--TRVLLSSDV---------KHLATCSAD 228
             +   W    + D   P    KF    K I  T + L+ D+         K+LA    D
Sbjct: 490 DKSIKFWNFSIEQDLV-PGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLD 548

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
           +T +V+ + D+ +   +L  H+  V     S DS  ++T+ +D  +++W L
Sbjct: 549 NTVKVFFL-DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 61/296 (20%), Positives = 117/296 (39%), Gaps = 38/296 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +LASA  +  ++ W   T  C RT     +   +  + S    +       ++L+D+ T+
Sbjct: 401 LLASAS-NGLLKIWNLKTKSCIRTFDCGYALTCKF-LPSGTLCVIGTREGQIQLFDLVTS 458

Query: 64  NPNPVTSFE-GHRGNVTSIAFQQENKWMVSSSEDGTIKVW-------------DVRAPSV 109
               + S +  H   + S+   Q+ K +V+ S D +IK W             D   P +
Sbjct: 459 TL--IESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVM 516

Query: 110 QRNYKHQAAVNE----VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSL 165
           +  +     +N+    V I P    L     D  V+++ L   +    L      P+ S+
Sbjct: 517 KLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSI 575

Query: 166 SVASDGSMLVAGNNKGNCYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
            ++ D  +++  +   N  +W +     H++            +H   I  V    +  +
Sbjct: 576 DISFDSKLIITSSADKNIKIWGLDFGDCHKS----------LFAHQDSIMNVCFLPESHN 625

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
             + S D   + W   D F+    L  HQ  VW  A ++D + +V++  DH +R+W
Sbjct: 626 FFSSSKDGLVKYWD-GDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 11/124 (8%)

Query: 33  SQVNRLEISSDKRFLAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWM 90
           ++V  LE   D+  L AAG+ +  ++++D+ +     + SF GH+  VT + F      +
Sbjct: 78  AEVTYLEYH-DETNLLAAGYADGVIKIWDLMSKTV--LLSFSGHKSGVTILKFDSTGTRL 134

Query: 91  VSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGE--LISCDQDGNVRIWDLGE 147
           +S S D  I +WD V    V +   H+ A+  +     +GE  L+S  +DG +++WDL  
Sbjct: 135 MSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC---EGEDWLVSTAKDGLIKLWDLKT 191

Query: 148 NQCV 151
            QCV
Sbjct: 192 QQCV 195

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 77  NVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-YKHQAAVNEVVIHPNQGELISCD 135
           ++ S+    E+K++  S  D T+KV+ + +     + Y H+  V  + I  +   +I+  
Sbjct: 529 DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588

Query: 136 QDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA 195
            D N++IW L    C   L    D+ + ++    +     + +  G    W      D  
Sbjct: 589 ADKNIKIWGLDFGDCHKSLFAHQDS-IMNVCFLPESHNFFSSSKDGLVKYW------DGD 641

Query: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
             + V K  +H   +  + ++SD   + + S DH+ RVW   D+
Sbjct: 642 KFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDD 685

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 11/117 (9%)

Query: 54  NVRLYDIRTTN----------PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103
           N+ L+DI+T            P  +         VT + +  E   + +   DG IK+WD
Sbjct: 46  NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWD 105

Query: 104 VRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDD 159
           + + +V  ++  H++ V  +        L+S  +D ++ IWDL     V +L    D
Sbjct: 106 LMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKD 162

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 111/260 (42%), Gaps = 42/260 (16%)

Query: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAP-----SVQRNYKH 115
           + T P  V  +EGH   + S+    +  W+ ++S+D ++ +W   A         +   H
Sbjct: 376 KETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGH 435

Query: 116 QAAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPED----------- 158
             +VN V + PN         +I+   D  ++ W + +   V    PED           
Sbjct: 436 VGSVNAVGL-PNVMPRSWPEFIITASNDLTIKKWKVPK---VTSDEPEDLILVKTSEYTR 491

Query: 159 ---DTPLQSLSVASDGSMLVAGNNKGNCYVWQM---PHQTDAANPKPVTKFRSHAKYITR 212
              +  + ++S++ + S+    +    C +W +     Q   AN         H + +  
Sbjct: 492 RAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLAN---------HKRGLWD 542

Query: 213 VLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDH 272
           V      K LATCS D T ++WS++ ++ +  TL+ H   V  C+F   +  L++  +D 
Sbjct: 543 VAFCQYDKLLATCSGDKTIKIWSLE-SYAVVKTLEGHTNAVQRCSFINKNKQLISTGADG 601

Query: 273 YVRLWDLSTREIVRQYGGHH 292
            V +WDLST E V+    H+
Sbjct: 602 LVIIWDLSTGESVKTLDAHN 621

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 103/271 (38%), Gaps = 34/271 (12%)

Query: 30  HSDSQVNRLEISSDKRFLAAAGHLNVRL---YDIRTTNPNPVTSFEGHRGNVTSIAFQQE 86
           H+D  +N L+ ++D  ++A A   +  +   Y  +  +  P T F GH G+V ++     
Sbjct: 389 HTD-LLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNV 447

Query: 87  N-----KWMVSSSEDGTIKVWDVRAPSVQRN---------------YKHQAAVNEVVIHP 126
                 ++++++S D TIK W V  P V  +                 H+  +N + I P
Sbjct: 448 MPRSWPEFIITASNDLTIKKWKV--PKVTSDEPEDLILVKTSEYTRRAHEKDINAISISP 505

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
           N     +   D   +IW+L + +    LA      L  ++      +L   +      +W
Sbjct: 506 NDSLFATASYDKTCKIWNLDDGEFQATLA-NHKRGLWDVAFCQYDKLLATCSGDKTIKIW 564

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
            +           V     H   + R    +  K L +  AD    +W +     ++T L
Sbjct: 565 SLESYA------VVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKT-L 617

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
           D H   +W  A   D    VTA +D +   W
Sbjct: 618 DAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 69/185 (37%), Gaps = 45/185 (24%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           + A+A YD T + W                         D  F A               
Sbjct: 509 LFATASYDKTCKIWNL----------------------DDGEFQA--------------- 531

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122
                 +   H+  +  +AF Q +K + + S D TIK+W + + +V +  + H  AV   
Sbjct: 532 ------TLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRC 585

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
                  +LIS   DG V IWDL   + V  L   ++  + +L+V +DG   V  +  G 
Sbjct: 586 SFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNR-IWALAVMNDGESFVTADADGF 644

Query: 183 CYVWQ 187
              W+
Sbjct: 645 FEFWR 649

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 99/235 (42%), Gaps = 12/235 (5%)

Query: 71  FEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQ 128
             GH G V  +A +  +N+W V+ S D T+KVWD+ +  ++     H   V +V +    
Sbjct: 82  INGHLGWVRCVAVEPVDNEWFVTGSNDTTLKVWDLASGKLKLTLSGHTMGVRDVAVSERH 141

Query: 129 GELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188
             + S  +D  V+ WDL +N  +        + + ++ +     ++  G       +W  
Sbjct: 142 PYMFSASEDKLVKCWDLEKNTAIRDYYGH-LSGVHTVDIHPTLDLIATGGRDAVVKLW-- 198

Query: 189 PHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDN 248
               D    K V     H   IT+V  +     + + S D T R+W I     ++  L +
Sbjct: 199 ----DIRTRKAVKTLVGHKAPITKVKCTPVDPQVVSSSTDTTVRLWDIVAGKSMK-VLTH 253

Query: 249 HQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALND 302
           H+R V   A       L +AC+D  VR W L    ++  +     G I  +++ND
Sbjct: 254 HKRAVRSIALHPGEFSLASACTDD-VRSWRLPEGSLLTNFQSQSTGVINTLSIND 307

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 100/233 (42%), Gaps = 6/233 (2%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGH-LNVRLYDIRTT 63
           + SA  D  ++ W+       R      S V+ ++I      +A  G    V+L+DIRT 
Sbjct: 144 MFSASEDKLVKCWDLEKNTAIRDYYGHLSGVHTVDIHPTLDLIATGGRDAVVKLWDIRTR 203

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-PSVQRNYKHQAAVNEV 122
               V +  GH+  +T +     +  +VSSS D T+++WD+ A  S++    H+ AV  +
Sbjct: 204 KA--VKTLVGHKAPITKVKCTPVDPQVVSSSTDTTVRLWDIVAGKSMKVLTHHKRAVRSI 261

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG- 181
            +HP +  L S   D +VR W L E   +     +    + +LS+  D  M   G+N   
Sbjct: 262 ALHPGEFSLASACTD-DVRSWRLPEGSLLTNFQSQSTGVINTLSINDDNVMFAGGDNGVL 320

Query: 182 NCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
           + Y ++  H     + + V       + +      +    L T   D + ++W
Sbjct: 321 SFYEYKSGHLYQQTSTQEVRGSLESERGVLTSTFDATGLRLITGEVDKSIKIW 373

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 119/297 (40%), Gaps = 38/297 (12%)

Query: 35  VNRLEISSDKRF-LAAAGHLNVRLYDIRTTNPN-PVTSFEGHRGNVTSIAFQQENKWMVS 92
           +  L  S D RF L  +  L+ +++ + +   +   T+F GHR  V    F  + + + +
Sbjct: 149 ITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKSLAATTFNGHRDYVMGAFFSHDQEKIYT 208

Query: 93  SSEDGTIKVWDV--------------------------RAPSVQRNYKHQAAVNEVVIHP 126
            S+DG + VW+                           R  S    Y +Q+ V  V  HP
Sbjct: 209 VSKDGAVFVWEFTKRSTNDDESEDDDEEEEVDISKYSWRITSKHFFYANQSKVKCVTFHP 268

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK-GNCYV 185
               L      G  R++D+ +   + QL+   + P+ ++SV + G  L  G++K G   V
Sbjct: 269 ATRLLAVGFTTGEFRLYDMPDFTLIQQLSMGQN-PVNTVSVNNTGEWLAFGSSKLGQLLV 327

Query: 186 WQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETT 245
           ++   ++       + K + H      +  S D   + T S D   +VW I   F L  T
Sbjct: 328 YEWQSES------YILKQQGHFDSTNSLAYSPDGSRVVTASDDGKIKVWDITSGFCL-AT 380

Query: 246 LDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI-CVALN 301
            + H   V    F+     + ++  D  VR WDL      R + G  +    C+A++
Sbjct: 381 FEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 437

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 96/215 (44%), Gaps = 13/215 (6%)

Query: 74  HRGNVTSIAFQQENKWMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELI 132
            +GN+T   F  + K ++S   +  + V+D +   S    Y+H+  +  + ++     LI
Sbjct: 16  RQGNLT---FSDDGKQLISPVGN-RVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLI 71

Query: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQT 192
           S D+DG   + +      +H    ++     ++  + DG +    + +    +W+ P   
Sbjct: 72  SIDEDGRAILVNFKARNVLHHFNFKE--RCSAVKFSPDGRLFALASGRF-LQIWKTPDVN 128

Query: 193 DAANPKPVTKFRSHAKY---ITRVLLSSDVKHLATCSADHTARVWSIDDNFQ--LETTLD 247
                 P  ++R HA +   IT +  S D + + T S D +A++WS+D   +    TT +
Sbjct: 129 RDRQFAPFVRYRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKSLAATTFN 188

Query: 248 NHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
            H+ +V    FS D   + T   D  V +W+ + R
Sbjct: 189 GHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKR 223

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 77/169 (45%), Gaps = 12/169 (7%)

Query: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNEVVIHPNQGE 130
           +GH  +  S+A+  +   +V++S+DG IKVWD+ +      + +H ++V  V        
Sbjct: 340 QGHFDSTNSLAYSPDGSRVVTASDDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 399

Query: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGN-NKGNCYVW--Q 187
           + S   DG VR WDL   +        +      L+V   G ++ AG+ +  + +VW  Q
Sbjct: 400 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 459

Query: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI 236
                DA +         H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 460 TGQLLDALS--------GHEGPVSCLSFSQENSVLASASWDKTIRIWSI 500

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 102/221 (46%), Gaps = 22/221 (9%)

Query: 30  HSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK 88
           H DS  N L  S D  R + A+    ++++DI  T+   + +FE H  +VT++ F +  +
Sbjct: 342 HFDS-TNSLAYSPDGSRVVTASDDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFAKRGQ 398

Query: 89  WMVSSSEDGTIKVWDVRAPSVQRNYK-----HQAAVNEVVIHPNQGELISCDQDGN--VR 141
            M SSS DGT++ WD+      RN++      +   N + + P+ GE++      N  + 
Sbjct: 399 VMFSSSLDGTVRAWDLIR---YRNFRTFTGTERIQFNCLAVDPS-GEVVCAGSLDNFDIH 454

Query: 142 IWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVT 201
           +W +   Q +  L+  +  P+  LS + + S+L + +      +W +  ++    P  V 
Sbjct: 455 VWSVQTGQLLDALSGHEG-PVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEV- 512

Query: 202 KFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242
                   +  + +  D K +A  +      +++I+D  Q+
Sbjct: 513 -----YSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQV 548

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 99/234 (42%), Gaps = 20/234 (8%)

Query: 56  RLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWM-VSSSEDGTIKVWDVRAPS-VQRNY 113
           RLYD+   +   +      +  V +++     +W+   SS+ G + V++ ++ S + +  
Sbjct: 283 RLYDM--PDFTLIQQLSMGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQ 340

Query: 114 KHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSM 173
            H  + N +   P+   +++   DG +++WD+    C+     E  + + ++  A  G +
Sbjct: 341 GHFDSTNSLAYSPDGSRVVTASDDGKIKVWDITSGFCLATF-EEHTSSVTAVQFAKRGQV 399

Query: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHA--KYITRVLLSSDVKHLATCSA---D 228
           + + +  G    W +    +         FR+    + I    L+ D      C+    +
Sbjct: 400 MFSSSLDGTVRAWDLIRYRN---------FRTFTGTERIQFNCLAVDPSGEVVCAGSLDN 450

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
               VWS+    QL   L  H+  V   +FS +++ L +A  D  +R+W +  R
Sbjct: 451 FDIHVWSVQTG-QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGR 503

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +      + A    N  ++    
Sbjct: 399 VMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 458

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQ-RNYKHQAAVNE 121
                + +  GH G V+ ++F QEN  + S+S D TI++W +   S Q    +  + V  
Sbjct: 459 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLA 518

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQCVHQL-------------------APEDDTPL 162
           + + P+  E+      G + I+++ + + V  +                     E     
Sbjct: 519 LSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNEDRFTAKNSERSKFF 578

Query: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQ 191
            ++  + DG  +VAG N  +  ++ +P++
Sbjct: 579 TTIHYSFDGMAIVAGGNNNSICLYDVPNE 607

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 58/119 (48%), Gaps = 11/119 (9%)

Query: 38  LEISSDKRFLAAAGHLNVRLYDIRTTNPN----PVTSFE---GHRGNVTSIAFQQENKWM 90
           ++ S D R  A A    ++++     N +    P   +    GH  ++TS+ + Q+++++
Sbjct: 102 VKFSPDGRLFALASGRFLQIWKTPDVNRDRQFAPFVRYRVHAGHFQDITSLTWSQDSRFI 161

Query: 91  VSSSEDGTIKVWDV----RAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145
           +++S+D + K+W V    ++ +      H+  V       +Q ++ +  +DG V +W+ 
Sbjct: 162 LTTSKDLSAKIWSVDSEEKSLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEF 220

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 80/214 (37%), Gaps = 51/214 (23%)

Query: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHP 126
           +T FE        IAF     W++ +    TI++WD R  ++   Y+ H+  V  V  HP
Sbjct: 4   LTKFESKSTRAKGIAFHSSRPWVLVALFSSTIQLWDYRMGTLLHRYEDHEGPVRAVDFHP 63

Query: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186
            Q   +S   D N+++W L  N+C++ L                                
Sbjct: 64  TQPLFVSAGDDYNIKVWSLDTNKCLYTLT------------------------------- 92

Query: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246
                              H  Y+  V   +++  + + S D T R+W+  +  ++   L
Sbjct: 93  ------------------GHLDYVRTVFFHNELPWIISASDDQTIRIWNWQNRKEI-ACL 133

Query: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280
             H  +V    F      +V+A  D  +R+WD+S
Sbjct: 134 TGHNHFVMSAQFHPTEDLVVSASLDETIRVWDIS 167

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 20/161 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           ++ SA  D TIR W+ ++G+  +   HS      LE     + L     L+    D    
Sbjct: 151 LVVSASLDETIRVWD-ISGLRKK---HSAPGATSLE----DQMLMQQNLLDGGFGDC--- 199

Query: 64  NPNPVTSF--EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV---RAPSVQRNYKHQAA 118
               V  F  EGH   V   +F      +VS  +D  +K+W +   +A  V     H   
Sbjct: 200 ----VVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNN 255

Query: 119 VNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDD 159
           V+ V+ HP+Q  +IS  +D  +R+WDL +   V Q   E+D
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKREND 296

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 94/239 (39%), Gaps = 27/239 (11%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKR-FLAAAGHLNVRLYDIRT 62
           +  SAG D+ I+ W   T  C  T+      V  +   ++    ++A+    +R+++ + 
Sbjct: 67  LFVSAGDDYNIKVWSLDTNKCLYTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQ- 125

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAV--- 119
            N   +    GH   V S  F      +VS+S D TI+VWD+    +++ +    A    
Sbjct: 126 -NRKEIACLTGHNHFVMSAQFHPTEDLVVSASLDETIRVWDISG--LRKKHSAPGATSLE 182

Query: 120 NEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDT-PLQSLSVASDGSMLVAGN 178
           +++++  N              + D G   CV +   E  T  +   S      ++V+G 
Sbjct: 183 DQMLMQQN--------------LLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGG 228

Query: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID 237
           +     +W+M     +     V   R H   +  V+       + +   D T RVW +D
Sbjct: 229 DDRQVKLWRM----SSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLD 283

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK 114
           V+L+ + +T    V +  GH  NV S+ F      ++S  ED T++VWD+   +  + +K
Sbjct: 233 VKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFK 292

Query: 115 HQAAVNE----VVIHPNQGELISCDQDGNVRIWDLG-ENQC--VHQ 153
            +   N+    +  HP+   L     D  + ++ L  E  C  +HQ
Sbjct: 293 RE---NDRFWLIAAHPHIN-LFGAAHDSGIMVFKLDRERPCSVIHQ 334

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 228 DHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQ 287
           D+  +VWS+D N  L  TL  H  +V    F  +  ++++A  D  +R+W+   R+ +  
Sbjct: 74  DYNIKVWSLDTNKCL-YTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 288 YGGHH 292
             GH+
Sbjct: 133 LTGHN 137

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 103/229 (44%), Gaps = 17/229 (7%)

Query: 65  PNPV----TSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120
           P P+       +GHR +V +I    + K + ++S +G +K+W++R  +  R ++   A+ 
Sbjct: 373 PTPIRVHSIELQGHRTDVRAIDISDDGKLLATAS-NGLLKIWNIRTKTCLRTFECGYALT 431

Query: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180
              + P    +I   + G ++++DL  +  +       D  + SL + SDG  LV G+  
Sbjct: 432 CKFL-PGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSDGRRLVTGSAD 490

Query: 181 GNCYVW-------QMPHQTDAANPKPVTKFRSHAKY---ITRVLLSSDVKHLATCSADHT 230
                W       ++P  TD   P       +  +    I  V +S + K LA    D+T
Sbjct: 491 KTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENKLLAVSLLDNT 550

Query: 231 ARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
            +V+ + +  +   +L  H+  V     S DS  ++T+ +D  +++W L
Sbjct: 551 VKVFYL-ETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 95/201 (47%), Gaps = 21/201 (10%)

Query: 5   LASAGYDHTIRFW------EALTGVCSRTIQ----HSDSQVNR------LEISSDKRFLA 48
           L +   D T++FW      + + G   + I     H D+ +        ++IS + + LA
Sbjct: 484 LVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENKLLA 543

Query: 49  AAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAP 107
            +   N V+++ + T       S  GH+  V SI    ++K +++SS D  IK+W +   
Sbjct: 544 VSLLDNTVKVFYLETMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601

Query: 108 SVQRN-YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166
              ++ + HQ ++  V   P      SC +D  V+ WD  + + + +LA    + + +L+
Sbjct: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGH-QSEVWALA 660

Query: 167 VASDGSMLVAGNNKGNCYVWQ 187
           VA  G+ +++ ++  +  VW+
Sbjct: 661 VARSGTCVISVSHDSSIRVWE 681

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 15/209 (7%)

Query: 33  SQVNRLEISSDKRFLAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWM 90
           ++V  ++  SD   LA  G+ +  ++++D+ +     + SF GHR  VT + F      +
Sbjct: 78  AEVTYMQYYSDTSLLAV-GYADGVIKIWDMFS--KTVLLSFNGHRSAVTQLLFDSTGTRL 134

Query: 91  VSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQ 149
           +S S D  I VWD V    + +   H+ ++  + + P++  L+S  +DG +++WDL   Q
Sbjct: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSL-PDENWLMSVSKDGLIKLWDLKIQQ 193

Query: 150 CVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAA---NPKPVTKFRSH 206
           CV         P +  ++  D  ++V  ++     +W +    DA      K + + +S 
Sbjct: 194 CVETHIAH---PGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVTEKGIFEKQSK 250

Query: 207 AK--YITRVLLSSDVKHLATCSADHTARV 233
            +   ++ + +S   K     +AD T  +
Sbjct: 251 QRGVAVSFITVSDGTKFFYVQNADKTLEI 279

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/296 (18%), Positives = 114/296 (38%), Gaps = 36/296 (12%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +LA+A  +  ++ W   T  C RT +   +   +  +      +       ++L+D+ ++
Sbjct: 401 LLATAS-NGLLKIWNIRTKTCLRTFECGYALTCKF-LPGGVLVIVGTRSGQLQLFDLASS 458

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW-------------DVRAPSVQ 110
                 + E H   + S+    + + +V+ S D T+K W             D   P++ 
Sbjct: 459 TILE-NNEEAHDAAIWSLDITSDGRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMS 517

Query: 111 RNYKHQAAVNE----VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166
            ++     +++    V I P    L     D  V+++ L   +    L      P+ S+ 
Sbjct: 518 LHHDTTLEMSDDILSVKISPENKLLAVSLLDNTVKVFYLETMKFFLSLYGHK-LPVLSID 576

Query: 167 VASDGSMLVAGNNKGNCYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL 222
           ++ D  +++  +   N  +W +     H++            +H   I  V    +  + 
Sbjct: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKS----------LFAHQDSIMNVKFLPESHNF 626

Query: 223 ATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278
            +CS D T + W   D F+    L  HQ  VW  A +     +++   D  +R+W+
Sbjct: 627 FSCSKDATVKYWD-GDKFETIQKLAGHQSEVWALAVARSGTCVISVSHDSSIRVWE 681

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 75/149 (50%), Gaps = 4/149 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSD-KRFLAAAGHLNVRLYDIRT 62
           +LA +  D+T++ +   T     ++      V  ++IS D K  + ++   N++++ +  
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNE 121
            + +   S   H+ ++ ++ F  E+    S S+D T+K WD  +  ++Q+   HQ+ V  
Sbjct: 601 GDCHK--SLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWA 658

Query: 122 VVIHPNQGELISCDQDGNVRIWDLGENQC 150
           + +  +   +IS   D ++R+W+  ++Q 
Sbjct: 659 LAVARSGTCVISVSHDSSIRVWEETDDQV 687

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/124 (19%), Positives = 51/124 (41%), Gaps = 9/124 (7%)

Query: 160 TPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDV 219
           T ++++ ++ DG +L   +N G   +W +  +T       +  F        + L    +
Sbjct: 388 TDVRAIDISDDGKLLATASN-GLLKIWNIRTKT------CLRTFECGYALTCKFLPGGVL 440

Query: 220 KHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDL 279
             + T S     +++ +  +  LE   + H   +W    ++D   LVT  +D  V+ W+ 
Sbjct: 441 VIVGTRSGQ--LQLFDLASSTILENNEEAHDAAIWSLDITSDGRRLVTGSADKTVKFWNF 498

Query: 280 STRE 283
              E
Sbjct: 499 IVEE 502

>Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON}
           (148854..151013) [2160 nt, 720 aa]
          Length = 719

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 123/299 (41%), Gaps = 33/299 (11%)

Query: 5   LASAGYDHTIRFWEALTGV------CSRTIQHSDSQVNRLEISSDKRFLAAAGH---LNV 55
           +AS   D T+R WE  +         ++ I  SDS +N +    D+  +   G    +N 
Sbjct: 27  IASVSRDGTVRVWEVASVEGNGGQWTNKIIHSSDSFLNSISYDHDEGLIYFGGKDSLVNA 86

Query: 56  RLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-- 113
           +         +P+ +  GH GNV S+  QQ    ++S S D T +VW   +  V+R    
Sbjct: 87  KSV-FSEVGEDPILTLVGHGGNVCSLRLQQGT--LISGSWDKTSRVW---SQGVERYVLK 140

Query: 114 KHQAAVNEVVIHPN-----QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA 168
            H A+V +    P+     Q   I+   D  VR+W   ++Q V       +  ++ +SV 
Sbjct: 141 GHTASVWDACPVPHFDGTLQDVFITASADKTVRLWK--KDQQVQCFTGIHEDVIRKVSVL 198

Query: 169 SDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
            +G   V  +N     +       D      +     H  ++  V++S   K L +C  D
Sbjct: 199 DNGRKFVTASNDTTIKI------CDLETGSVLKTLSGHESFVYSVIISPKSKELISCGED 252

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQ 287
            + R+WS + + Q    L     W  D   + D   ++   SD+ +R++   + +I  +
Sbjct: 253 RSVRIWSYEGDVQQVIRLPAISIWCVDVLPNGD---IIVGSSDNTIRIFTRDSAKIASK 308

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 64/140 (45%), Gaps = 3/140 (2%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63
           +  +A  D T+R W+    V   T  H D       + + ++F+ A+    +++ D+ T 
Sbjct: 162 VFITASADKTVRLWKKDQQVQCFTGIHEDVIRKVSVLDNGRKFVTASNDTTIKICDLETG 221

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123
             + + +  GH   V S+    ++K ++S  ED ++++W       Q       ++  V 
Sbjct: 222 --SVLKTLSGHESFVYSVIISPKSKELISCGEDRSVRIWSYEGDVQQVIRLPAISIWCVD 279

Query: 124 IHPNQGELISCDQDGNVRIW 143
           + PN G++I    D  +RI+
Sbjct: 280 VLPN-GDIIVGSSDNTIRIF 298

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 104/266 (39%), Gaps = 48/266 (18%)

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           +Y +R T        +GH  +V  +     N+ + S S DGT++VW+V   SV+ N    
Sbjct: 2   VYQLRAT-------LKGHTQDVRDVV-AISNERIASVSRDGTVRVWEV--ASVEGNGGQW 51

Query: 117 AAVNEVVIHPNQGEL--ISCDQDGNVRIWDLGENQCVHQ---LAPEDDTPLQSL------ 165
                 +IH +   L  IS D D  + I+  G++  V+     +   + P+ +L      
Sbjct: 52  T---NKIIHSSDSFLNSISYDHDEGL-IYFGGKDSLVNAKSVFSEVGEDPILTLVGHGGN 107

Query: 166 --SVASDGSMLVAGNNKGNCYVWQMP--------HQTDAANPKPVTKFRSHAKYITRVLL 215
             S+      L++G+      VW           H     +  PV  F    + +     
Sbjct: 108 VCSLRLQQGTLISGSWDKTSRVWSQGVERYVLKGHTASVWDACPVPHFDGTLQDV----- 162

Query: 216 SSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVR 275
                   T SAD T R+W  D   Q  T +  H+  +   +   +    VTA +D  ++
Sbjct: 163 ------FITASADKTVRLWKKDQQVQCFTGI--HEDVIRKVSVLDNGRKFVTASNDTTIK 214

Query: 276 LWDLSTREIVRQYGGHHKGAICVALN 301
           + DL T  +++   GH      V ++
Sbjct: 215 ICDLETGSVLKTLSGHESFVYSVIIS 240

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 103/238 (43%), Gaps = 8/238 (3%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           L SA  D  ++ W+    +  R      S V  + I      +A AG  +V RL+DIR+ 
Sbjct: 179 LFSASEDKLVKCWDLEKNMAIRDYHGHLSGVYSVAIHPTLDLIATAGRDSVVRLWDIRSR 238

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-PSVQRNYKHQAAVNEV 122
               V +  GH+G +  +     +  ++S S D T+ +WD+ A  S +    H+ +V ++
Sbjct: 239 ME--VMTLIGHKGPINKVRSLPVDPQIISCSTDATVHLWDIVAGKSAKVLTHHKRSVRDI 296

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            ++P++  L S   D ++R W L E   +     E    + SLS+  DG +L AG + G 
Sbjct: 297 ALNPSEFSLASACTD-DIRSWRLPEGSLLTNFESESSGIINSLSINQDG-VLAAGCDNGT 354

Query: 183 C--YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238
              Y ++  H+  +     V       + I           L T   D + ++W  DD
Sbjct: 355 LAFYDFKSGHKYQSLESPAVAGSLESERGILSSTFDQSGLRLITGGVDKSIKIWKQDD 412

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 95/232 (40%), Gaps = 19/232 (8%)

Query: 71  FEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQ 128
             GH G V  +A +  EN W  + S D T+KVWD+ +  ++     H   V ++ +    
Sbjct: 117 INGHMGWVNCVASEPVENTWFATGSTDTTVKVWDLVSGHLKLTLSGHVMPVRDITVSDRH 176

Query: 129 GELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW-- 186
             L S  +D  V+ WDL +N  +        + + S+++     ++          +W  
Sbjct: 177 PYLFSASEDKLVKCWDLEKNMAIRDYHGH-LSGVYSVAIHPTLDLIATAGRDSVVRLWDI 235

Query: 187 --QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLET 244
             +M   T   +  P+ K RS         L  D   + +CS D T  +W I    +   
Sbjct: 236 RSRMEVMTLIGHKGPINKVRS---------LPVD-PQIISCSTDATVHLWDIVAG-KSAK 284

Query: 245 TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296
            L +H+R V D A +     L +AC+D  +R W L    ++  +     G I
Sbjct: 285 VLTHHKRSVRDIALNPSEFSLASACTDD-IRSWRLPEGSLLTNFESESSGII 335

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            AT S D T +VW +     L+ TL  H   V D   S    YL +A  D  V+ WDL  
Sbjct: 137 FATGSTDTTVKVWDLVSG-HLKLTLSGHVMPVRDITVSDRHPYLFSASEDKLVKCWDLEK 195

Query: 282 REIVRQYGGHHKGAICVAL 300
              +R Y GH  G   VA+
Sbjct: 196 NMAIRDYHGHLSGVYSVAI 214

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 128/298 (42%), Gaps = 32/298 (10%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+ +V S+   ++   ++S S D TIKVW ++   +     H 
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+        +IS   D  V+ W+L + Q         ++ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ +    G   +W +         K      S    +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLA-------AKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDNFQLETTLDNHQRW-------VWDCAFSADSAYLVTACSDHYVRLWDLST 281
            +V+S+D  + ++        +           A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 22/227 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     +     R++K H   V + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   +   +      + + S+ +    SM+++G+    
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHK-SDVMSVDIDKKASMIISGSRDKT 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V +  + K       + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           +  FQ+E     H   +     S D   + +A  D  + LW+L+ ++
Sbjct: 184 N-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  F +   +   H   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           +Q  ++ +DG+  ++ +      +W      D A  +   +F  H   +  V +      
Sbjct: 68  VQDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA------DSAYLVTACSDHYVR 275
           + + S D T +VW+I    Q   TL  H  WV             DS  +++A +D  V+
Sbjct: 122 IISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 276 LWDLSTREIVRQYGGHH 292
            W+L+  +I   + GH+
Sbjct: 180 AWNLNQFQIEADFIGHN 196

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 128/298 (42%), Gaps = 32/298 (10%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+ +V S+   ++   ++S S D TIKVW ++   +     H 
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+        +IS   D  V+ W+L + Q         ++ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ +    G   +W +         K      S    +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLA-------AKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDNFQLETTLDNHQRW-------VWDCAFSADSAYLVTACSDHYVRLWDLST 281
            +V+S+D  + ++        +           A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 22/227 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     +     R++K H   V + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   +   +      + + S+ +    SM+++G+    
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHK-SDVMSVDIDKKASMIISGSRDKT 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V +  + K       + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           +  FQ+E     H   +     S D   + +A  D  + LW+L+ ++
Sbjct: 184 N-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  F +   +   H   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           +Q  ++ +DG+  ++ +      +W      D A  +   +F  H   +  V +      
Sbjct: 68  VQDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA------DSAYLVTACSDHYVR 275
           + + S D T +VW+I    Q   TL  H  WV             DS  +++A +D  V+
Sbjct: 122 IISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 276 LWDLSTREIVRQYGGHH 292
            W+L+  +I   + GH+
Sbjct: 180 AWNLNQFQIEADFIGHN 196

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 128/298 (42%), Gaps = 32/298 (10%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+ +V S+   ++   ++S S D TIKVW ++   +     H 
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+        +IS   D  V+ W+L + Q         ++ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ +    G   +W +         K      S    +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLA-------AKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDNFQLETTLDNHQRW-------VWDCAFSADSAYLVTACSDHYVRLWDLST 281
            +V+S+D  + ++        +           A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 22/227 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     +     R++K H   V + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   +   +      + + S+ +    SM+++G+    
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHK-SDVMSVDIDKKASMIISGSRDKT 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V +  + K       + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           +  FQ+E     H   +     S D   + +A  D  + LW+L+ ++
Sbjct: 184 N-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  F +   +   H   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           +Q  ++ +DG+  ++ +      +W      D A  +   +F  H   +  V +      
Sbjct: 68  VQDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA------DSAYLVTACSDHYVR 275
           + + S D T +VW+I    Q   TL  H  WV             DS  +++A +D  V+
Sbjct: 122 IISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 276 LWDLSTREIVRQYGGHH 292
            W+L+  +I   + GH+
Sbjct: 180 AWNLNQFQIEADFIGHN 196

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 128/298 (42%), Gaps = 32/298 (10%)

Query: 4   ILASAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVR 56
           +L SA  D T+  W+ LTG      V  R+ +     V    +++D  + L+A+    +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQ 116
           L+D+ T        F GH+ +V S+   ++   ++S S D TIKVW ++   +     H 
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 AAVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170
             V++V + PN+        +IS   D  V+ W+L + Q         ++ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230
           G+++ +    G   +W +         K      S    +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLA-------AKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDNFQLETTLDNHQRW-------VWDCAFSADSAYLVTACSDHYVRLWDLST 281
            +V+S+D  + ++        +           A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 22/227 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVWDVRAPSVQ-----RNYK-HQAAVNEV 122
           + EGH G VTS+A    +   ++S+S D T+  W +     +     R++K H   V + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            +  +    +S   D  +R+WD+   +   +      + + S+ +    SM+++G+    
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHK-SDVMSVDIDKKASMIISGSRDKT 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V +  + K       + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283
           +  FQ+E     H   +     S D   + +A  D  + LW+L+ ++
Sbjct: 184 N-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHLA-TCSADHTARVWSI---DDNFQLET-TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +   D  F +   +   H   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++A  D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 162 LQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH 221
           +Q  ++ +DG+  ++ +      +W      D A  +   +F  H   +  V +      
Sbjct: 68  VQDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA------DSAYLVTACSDHYVR 275
           + + S D T +VW+I    Q   TL  H  WV             DS  +++A +D  V+
Sbjct: 122 IISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 276 LWDLSTREIVRQYGGHH 292
            W+L+  +I   + GH+
Sbjct: 180 AWNLNQFQIEADFIGHN 196

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 99/237 (41%), Gaps = 44/237 (18%)

Query: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124
           P  V  +EGH   + S+   +++ W+ ++S+D +  +W  R  +V   Y+  A       
Sbjct: 397 PIDVDMYEGHTDLLNSLDSTEDSLWIATASKDNSCILW--RYNAVLEKYQIYAKF----- 449

Query: 125 HPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCY 184
                               LG    V  +       L ++   +    ++  +N     
Sbjct: 450 --------------------LGHASSVTAVG------LPNVLTKNYPDYVITASNDSTIK 483

Query: 185 VWQMPHQT------DAANPKPVT----KFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234
            W++P  T      D+  P  V       R+H K I  + +S +    AT S D T ++W
Sbjct: 484 KWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIW 543

Query: 235 SIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291
            ++    L+ TL NH+R +WD +F     ++VTA  D  +++W L T  +V+ + GH
Sbjct: 544 DLESG-DLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGH 599

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 84/229 (36%), Gaps = 30/229 (13%)

Query: 71  FEGHRGNVTSIAF-----QQENKWMVSSSEDGTIKVWDVRAPSVQRN----YK------- 114
           F GH  +VT++       +    +++++S D TIK W V  P+   +    +K       
Sbjct: 449 FLGHASSVTAVGLPNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLS 508

Query: 115 ------HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA 168
                 H   +N + I PN     +   D   +IWDL        L       L  +S  
Sbjct: 509 EYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHK-RGLWDVSFC 567

Query: 169 SDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228
                +V  +      +W +   T       V  F  H+  + R    +  K L +C AD
Sbjct: 568 QYDKFIVTASGDKTIKMWSLDTFT------VVKTFEGHSNAVQRCQFINKQKQLVSCGAD 621

Query: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277
              ++W      +   TLD H   +W  +   D   +++A +D   + W
Sbjct: 622 GLIKIWDCSSG-ECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 82/191 (42%), Gaps = 15/191 (7%)

Query: 4   ILASAGYDHTIRFWEALTGVCSRT-IQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRT 62
           I A+A YD T + W+  +G    T + H     +      DK  + A+G   ++++ + T
Sbjct: 530 IFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDT 589

Query: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNE 121
                V +FEGH   V    F  + K +VS   DG IK+WD  +    +    H   +  
Sbjct: 590 F--TVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWA 647

Query: 122 VVIHPNQGELISCDQDGNVRIWD--LGENQCVHQLAPEDDTPLQSLSVASDGSM--LVAG 177
           + +  +   +IS D DG  + W    GEN+       E D   + L V  + S+   +A 
Sbjct: 648 LSVINDGDVIISADADGVFQFWRDCTGENR-------EKDLEKERLKVEQEQSLQNYLAN 700

Query: 178 NNKGNCYVWQM 188
            +  N ++  M
Sbjct: 701 EDWTNAFLLAM 711

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 131/297 (44%), Gaps = 30/297 (10%)

Query: 4   ILASAGYDHTIRFWEAL-----TGVCSRTIQHSDSQVNRLEISSDKRF-LAAAGHLNVRL 57
           +L SA  D T+  W+        GV  R+ +     V  + ++ D  + L+A+    +RL
Sbjct: 32  LLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRL 91

Query: 58  YDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQA 117
           +++ T        F GH+ +V S+A  ++   ++S S D +IKVW ++   +     H  
Sbjct: 92  WEVATGET--FQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHND 149

Query: 118 AVNEVVIHPNQGE------LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDG 171
            V++V + PN  +      +IS   D  V+ W+L + Q        +   + +++ + DG
Sbjct: 150 WVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGN-VNTITASPDG 208

Query: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231
           S++ +    G   +W +      A+  P+    +  + +  +  S +   LA  +A    
Sbjct: 209 SLIASAGKDGEIMLWNL------ADKVPMYTLNAQDE-VFALAFSPNRYWLAAATASGI- 260

Query: 232 RVWSID-----DNFQLETTLDNH--QRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
           +V+S+D     D+ + E    N   +       +SAD   L    +D+ +R+W + T
Sbjct: 261 KVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 101/226 (44%), Gaps = 22/226 (9%)

Query: 70  SFEGHRGNVTSIAFQQ-ENKWMVSSSEDGTIKVW-----DVRAPSVQRNYK-HQAAVNEV 122
           + EGH G VTS+A    +   +VS+S D T+  W     D +     R++K H   V +V
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDV 71

Query: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182
            + P+    +S   D  +R+W++   +   +      + + S+++    SM+++G+   +
Sbjct: 72  TLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHK-SDVMSVAIDRKASMIISGSRDKS 130

Query: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKH------LATCSADHTARVWSI 236
             VW +  Q        +     H  ++++V ++ + K       + +   D   + W++
Sbjct: 131 IKVWTIKGQC-------LATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNL 183

Query: 237 DDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTR 282
           +  FQ+E     H   V     S D + + +A  D  + LW+L+ +
Sbjct: 184 N-QFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADK 228

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 203 FRSHAKYITRVLLSSDVKHL-ATCSADHTARVWSIDDNFQLET----TLDNHQRWVWDCA 257
              H  ++T +  S+   +L  + S D T   W +  + Q       +   H   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            + D AY ++A  D  +RLW+++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAID 116

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 109/245 (44%), Gaps = 10/245 (4%)

Query: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNV-RLYDIRTT 63
           + S   D T++ W+       R      S V+ ++I      +  AG  +V +++DIRT 
Sbjct: 173 MFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTR 232

Query: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD-VRAPSVQRNYKHQAAVNEV 122
            P  V +  GH+G +T +     +  ++SSS D +I++WD V   S++    HQ  V ++
Sbjct: 233 LP--VMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

Query: 123 VIHPNQGELIS-CDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKG 181
            +HP++    S C  D  +R W L + + +     +D   + ++S+  D  +L AG++ G
Sbjct: 291 SVHPSEFSFASACTND--IRSWLLPKGELLTNFVSQDLDVINTVSINQD-DVLFAGSDNG 347

Query: 182 NC--YVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239
           +   + ++  H+      K         + I           L T   D T ++W  D+ 
Sbjct: 348 SLTFFDYKSGHKYQTFKTKEAPGSPESERGILSSTFDGTGLRLLTGETDRTIKIWKQDET 407

Query: 240 FQLET 244
              +T
Sbjct: 408 ASQDT 412

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 103/256 (40%), Gaps = 19/256 (7%)

Query: 43  DKRFLAAAGHLNVRLYDIRTTNPNP--------VTSFEGHRGNVTSIAFQQ-ENKWMVSS 93
           +K+F    GH +V     +  N  P             GH G V  IA  + +N+W  + 
Sbjct: 75  NKKFADEQGHESVIERHDKLLNQTPRWHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATG 134

Query: 94  SEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH 152
           S D TIK+W++ +  ++   K H   V ++ I      + S  +D  V+ WDL +N  + 
Sbjct: 135 SNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIR 194

Query: 153 QLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITR 212
                  + + ++ +     ++V         VW      D     PV     H   IT+
Sbjct: 195 NYHGH-LSGVHTVDIHPTVDVVVTAGRDSVVKVW------DIRTRLPVMTLPGHKGPITK 247

Query: 213 VLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDH 272
           V        + + S D + R+W +     ++  L +HQR V D +         +AC++ 
Sbjct: 248 VRCLPVDPQVISSSVDASIRLWDLVAGKSMK-VLTHHQRTVRDISVHPSEFSFASACTND 306

Query: 273 YVRLWDLSTREIVRQY 288
            +R W L   E++  +
Sbjct: 307 -IRSWLLPKGELLTNF 321

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 222 LATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281
            AT S D T ++W++    +L+ TL  H   V D A S    Y+ +   D  V+ WDL  
Sbjct: 131 FATGSNDKTIKIWNLASG-KLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEK 189

Query: 282 REIVRQYGGHHKGAICVAL 300
              +R Y GH  G   V +
Sbjct: 190 NTAIRNYHGHLSGVHTVDI 208

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 51/128 (39%), Gaps = 8/128 (6%)

Query: 170 DGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLAT