Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kthe_YGOB_EST37.128ON1931939361e-130
Kwal_YGOB_EST37.128ON1921905241e-67
KLTH0F12606gsingletonOFF96955002e-65
Sklu_YGOB_EST37.128ON1961893043e-34
Kwal_55.20848singletonOFF96872762e-31
ADL016C7.128ON2021772834e-31
YIL009C-A (EST3)7.128ON1811832537e-27
Skud_9.1637.128ON1801842381e-24
TDEL0H029007.128ON1881922321e-23
Smik_9.1857.128ON1821842311e-23
Suva_9.1957.128ON1891922303e-23
CAGL0C03828g7.128ON1801912276e-23
NCAS0E021507.128ON1851842277e-23
KAFR0L004807.128ON1801852251e-22
Zrou_YGOB_EST37.128ON1681652196e-22
NDAI0E036907.128ON1961912209e-22
KNAG0L009607.128ON1851812172e-21
KLLA0D14289g7.128ON1841842069e-20
Kpol_1062.557.128ON1821901971e-18
Sklu_YGOB_Anc_7.128singletonOFF98971702e-15
TPHA0C043107.128ON2011961605e-13
TBLA0A009607.128ON215891404e-10
ZYRO0C05258gsingletonOFF87831072e-06
Ecym_53343.115ON101956720.69
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kthe_YGOB_EST3
         (193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...   365   e-130
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   206   1e-67
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...   197   2e-65
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   121   3e-34
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...   110   2e-31
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   113   4e-31
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   102   7e-27
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...    96   1e-24
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...    94   1e-23
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...    94   1e-23
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....    93   3e-23
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...    92   6e-23
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...    92   7e-23
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...    91   1e-22
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...    89   6e-22
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...    89   9e-22
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...    88   2e-21
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    84   9e-20
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...    80   1e-18
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    70   2e-15
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...    66   5e-13
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    59   4e-10
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    46   2e-06
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    32   0.69 

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score =  365 bits (936), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 179/193 (92%), Positives = 179/193 (92%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 61  EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN 120
           EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN
Sbjct: 61  EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN 120

Query: 121 TILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFDYL 180
           TILLIGSGTLKYLPVHEAYTQWSLSI              EQCAVFDLDQVEARPSFDYL
Sbjct: 121 TILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPSFDYL 180

Query: 181 YQLTPFKKLFCEV 193
           YQLTPFKKLFCEV
Sbjct: 181 YQLTPFKKLFCEV 193

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  206 bits (524), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 128/190 (67%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M K  +  K+KQ ES FLR WI  DV  V+K H  LP+WPAV  FVP + +  G +   S
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60

Query: 61  EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN 120
           ++L NRRHFLKIT FH++  FAV+ASGRD++C+ILVEFTP+CVS FER + +RITA+TVN
Sbjct: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120

Query: 121 TILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFDYL 180
           TI LIG+ T+KY+P++E    W  +                +C VFDLDQVE+R  F+YL
Sbjct: 121 TIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYL 180

Query: 181 YQLTPFKKLF 190
           Y L+ FK +F
Sbjct: 181 YHLSHFKDIF 190

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score =  197 bits (500), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
          MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 61 EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95
          EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL
Sbjct: 61 EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  121 bits (304), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (55%), Gaps = 3/189 (1%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPL--AKLHGHVPF 58
           M K+  S++ K+++S++L  WI+  +L  ++E   + I   V +FVP L    +   V  
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 59  KSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKT 118
             +I+LN RHF+K+T F++V  + V+AS RD+ C ILVEFT  CVS FERL+  RIT++T
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITSET 120

Query: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIXXXX-XXXXXXXXXXEQCAVFDLDQVEARPSF 177
            NT+ +IG   L ++       ++ + I                Q  V+D+DQVE+   F
Sbjct: 121 TNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESNRKF 180

Query: 178 DYLYQLTPF 186
            + YQ   F
Sbjct: 181 PFFYQSEAF 189

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score =  110 bits (276), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%)

Query: 9  KEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSEILLNRRH 68
          K+KQ ES FLR WI  DV  V+K H  LP+WPAV  FVP + +  G +   S++L NRRH
Sbjct: 9  KKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSSQLLQNRRH 68

Query: 69 FLKITNFHRVEKFAVFASGRDNNCRIL 95
          FLKIT FH++  FAV+ASGRD++C+IL
Sbjct: 69 FLKITGFHKIHNFAVYASGRDDSCQIL 95

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  113 bits (283), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (52%), Gaps = 1/177 (0%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M K+V +++  + +S+FLREW++  V+  ++       W  V  F+P L      +  + 
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATLSLEP 60

Query: 61  EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN 120
            ++ N + FL+I  F RV  FAV A  RD  C ILVEFTP CVS FER    RIT+ TVN
Sbjct: 61  TVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSSTVN 120

Query: 121 TILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSF 177
           ++ +IG+ +L +    +A   + +                + CA+FD DQVE+   F
Sbjct: 121 SLFVIGNTSLLFYARSDAAAAFEVPALMNGSSTLPVLRVGD-CAIFDQDQVESHRRF 176

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  102 bits (253), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 101/183 (55%), Gaps = 5/183 (2%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M K++  +  K  +SVFL+ WI     A++++++    +    + +P L K    +P  S
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIK----ALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMS 56

Query: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTV 119
             IL N  HF KIT F+ V  + V+AS RD++ +ILVEF+ +CVS FER ++ RIT++T 
Sbjct: 57  PTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETT 116

Query: 120 NTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFDY 179
           N +++IG   L Y+    A + + + +               Q  +FD+DQV +  +F +
Sbjct: 117 NCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPF 176

Query: 180 LYQ 182
           +Y+
Sbjct: 177 VYK 179

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score = 96.3 bits (238), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 98/184 (53%), Gaps = 8/184 (4%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M +I+  +  K  +S+FL+ WI + V     +H P          +P L +    VP  S
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRP------SERVIPSLTRQDLLVPHMS 54

Query: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL-VEFTPQCVSAFERLNSIRITAKT 118
            +IL N  HF KIT F+ V  + V AS RD+  +IL VEF+ +CVS FER ++ RIT++T
Sbjct: 55  AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114

Query: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFD 178
           +N +++IG   L Y+  ++   ++ + +               Q  +FD+DQV +  +F 
Sbjct: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFP 174

Query: 179 YLYQ 182
           ++Y+
Sbjct: 175 FVYK 178

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 96/192 (50%), Gaps = 13/192 (6%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAP--LPIWPAVPNFVPPLAKLHGHVP- 57
           M K + S+  KQ ++VFL  WI   +  ++ + +   LP++    NF+P L       P 
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56

Query: 58  FKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAK 117
               IL N  HF+K+  FH V +F VFA+ RD+  +ILVEFTPQCVS FER +  RIT +
Sbjct: 57  LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116

Query: 118 TVNTILLIGSGTLKYLPVHEAYTQWSL------SIXXXXXXXXXXXXXXEQCAVFDLDQV 171
           T +++ +I    L +   +     + +      S                Q + F++DQ+
Sbjct: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176

Query: 172 EARPSFDYLYQL 183
           E+   F YLY L
Sbjct: 177 ESFEHFPYLYTL 188

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score = 93.6 bits (231), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 98/184 (53%), Gaps = 6/184 (3%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M ++V  +  K  +S+FL+ WI + V    + H   P      + +P L +    +P  S
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHP----SDHVIPVLTEQDLKLPHMS 56

Query: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL-VEFTPQCVSAFERLNSIRITAKT 118
            +IL N  HF KIT F+ V  + V AS RD+  +IL VEF+P+CVS FER+++ RITA+T
Sbjct: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116

Query: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFD 178
           VN +++IG  +L         + + + +               Q  +FD+DQV +  +F 
Sbjct: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176

Query: 179 YLYQ 182
           ++Y+
Sbjct: 177 FVYK 180

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score = 93.2 bits (230), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 101/192 (52%), Gaps = 15/192 (7%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M ++   +  +Q +S+FL+ WI   ++    EH  +P      + +P LA+    +P   
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWI-KLLIDDNSEHHHIP----SDHVIPALAQQDLALPHMC 55

Query: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL---------VEFTPQCVSAFERLN 110
            +IL N  HF +IT F+ V  + V+AS RD+  +IL         VEF+ +CVS FER+N
Sbjct: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115

Query: 111 SIRITAKTVNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQ 170
           + RIT++T N +++IG   L Y+   +A  ++ + +               Q  +FD+DQ
Sbjct: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175

Query: 171 VEARPSFDYLYQ 182
           V +  +F ++Y+
Sbjct: 176 VGSLNNFPFVYK 187

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score = 92.0 bits (227), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 95/191 (49%), Gaps = 21/191 (10%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAV-PNFVPPLAKLHGHVPFK 59
           M   +  ++    ESV+L  W+  D+L   K    + + P V P+           +P  
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWV-RDMLLESKTSQNIAVIPRVDPD--------EASIPLL 51

Query: 60  SE-ILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKT 118
           S  I  NRRHF+KIT F +V  ++V+AS +D+  +IL +FTP+CVS FE  N  RIT+ T
Sbjct: 52  SRRIYANRRHFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDT 111

Query: 119 VNTILLIGSGTLKYLPVHE---AYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARP 175
           VNT+ +IG   L  + V E    + +  +S+               Q  + D DQVEA  
Sbjct: 112 VNTLFMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEA-- 169

Query: 176 SFDYLYQLTPF 186
                +++TPF
Sbjct: 170 -----FKMTPF 175

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score = 92.0 bits (227), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 98/184 (53%), Gaps = 5/184 (2%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M +++ S+K  Q +S+FL+ WI   +   +++   LP        VP L +     P  S
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAPQCS 58

Query: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTV 119
            ++L N  HF K+T F ++  +A+ AS RD+  ++LVEFTP+CVS FER +  R+T++T+
Sbjct: 59  PKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETL 118

Query: 120 NTILLIGSGTLKYLPVHEAYTQWSLS--IXXXXXXXXXXXXXXEQCAVFDLDQVEARPSF 177
           N +L+IG   + Y    +  TQ+     I               Q ++FD DQV+   SF
Sbjct: 119 NCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSF 178

Query: 178 DYLY 181
            ++Y
Sbjct: 179 PFVY 182

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 91/185 (49%), Gaps = 12/185 (6%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M  +  +++  + +S+F+ +WI   +L    +    PI+ A+P    P+   +   P  S
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWI-KPLLDENCQGLLRPIYRAIP----PINNTNVRNPLSS 55

Query: 61  E-ILLNRR---HFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITA 116
              LL  +   HF KI  F++VE F +FAS RD   +ILVEFTP CVS FER N  R+T+
Sbjct: 56  RPSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTS 115

Query: 117 KTVNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPS 176
            T N  LLIG  +++Y   HE    + L+                Q ++ D DQ      
Sbjct: 116 DTTNCTLLIGDCSIEYKSSHEISQNYRLNF---PNKRLLPVLTINQASILDRDQATLLEQ 172

Query: 177 FDYLY 181
           F ++Y
Sbjct: 173 FPFVY 177

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score = 89.0 bits (219), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 84/165 (50%), Gaps = 14/165 (8%)

Query: 14  ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVP-FKSEILLNRRHFLKI 72
           +SVFL+ WI +     + EH P          +PP+       P   S++L N RHF+K+
Sbjct: 12  DSVFLQPWIQT----ALAEHDPR----LGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKV 63

Query: 73  TNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVNTILLIGSGTLKY 132
           T F  V+ + V+AS RD+  ++LVEFTPQCVS FER    RITA+T N + +I    L Y
Sbjct: 64  TRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIY 123

Query: 133 LPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSF 177
                +Y +    I               Q A+FD DQVE+  ++
Sbjct: 124 H--SPSYIENHYKI---VTRGETPVLRVNQTAIFDWDQVESLETY 163

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score = 89.4 bits (220), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 98/191 (51%), Gaps = 12/191 (6%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M +++ S+K+  ++SVFL+ WI + +   ++    LP    +   +  L++     P  S
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLS--IARLSRRDMDAPEIS 58

Query: 61  EILLNR-RHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTV 119
           E +LN   HF K+T F  V  + +FAS RD+  +ILVEFTPQCV  FER+   RIT++TV
Sbjct: 59  ETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSETV 118

Query: 120 NTILLIGSGTLKYLP---VHEAYTQWSLSIXXXXXXXXXX------XXXXEQCAVFDLDQ 170
           N + +IG  T+ Y     +  ++ ++ L                       Q ++FD DQ
Sbjct: 119 NCLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSDQ 178

Query: 171 VEARPSFDYLY 181
           V+    F ++Y
Sbjct: 179 VQLLFEFPFIY 189

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score = 88.2 bits (217), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 91/181 (50%), Gaps = 6/181 (3%)

Query: 5   VSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSE-IL 63
           +S    K  E +F   WI + V    +E   + +   V   +P L       P +S+ +L
Sbjct: 6   LSQTGHKFQEWIFTHPWIKNLVKLPTEE---ISLMRPVRQIIPKLTTNDLKNPTRSKRVL 62

Query: 64  LNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVNTIL 123
            N+ HF K+  F+ V  + VFA  RD+ C++LVEF P+CVS FER +  RIT+ TVN + 
Sbjct: 63  KNKTHFAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGTVNCLF 122

Query: 124 LIGSGTLKYLPVHEAYTQWSLSI--XXXXXXXXXXXXXXEQCAVFDLDQVEARPSFDYLY 181
           +IG+  L+Y  V     ++ ++I                 Q  V D  Q+EA+ +F +++
Sbjct: 123 VIGNCDLEYRSVARVNDEFRINILPRKQKLMDQIPVLVINQATVADWGQMEAQTTFPFVH 182

Query: 182 Q 182
           Q
Sbjct: 183 Q 183

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 84.0 bits (206), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 90/184 (48%), Gaps = 6/184 (3%)

Query: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60
           M  +V S++   N+SVFL+EWI   V     ++     WP     V  L + H  +    
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLE-HDIIESAF 59

Query: 61  EILLNR--RHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKT 118
           +  LN   + F++I  FHRV  + V+A+ RD+   IL  FT  CV  +E +N+ RIT  T
Sbjct: 60  QTALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNT 119

Query: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQVEARPSFD 178
           +NT+ +IG+ TL++    E    ++                 E+  +FD DQ+ +   F+
Sbjct: 120 LNTLFVIGNVTLQFWNHRECKLWFNQDF---PGLRMVPVLKIEKARMFDRDQISSNVQFE 176

Query: 179 YLYQ 182
           ++Y 
Sbjct: 177 WVYD 180

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 89/190 (46%), Gaps = 24/190 (12%)

Query: 4   IVSSAKEKQNESVFLREWI----------LSDVLAVMKEHAPLPIWPAVPNFVPPLAKLH 53
           I+ S K    +S +L+EWI            +V+ ++ E+     +    +++  +  L 
Sbjct: 5   ILPSNKSSCVDSTYLQEWIDLIIDRNYDNTGEVIPILDEYG----FNDSQSYMSSVINLI 60

Query: 54  GHVPFKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIR 113
              P+         HF K+TNF  V  ++V+AS RD   ++L EFT  CVS+FERL + R
Sbjct: 61  IKKPY---------HFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSR 111

Query: 114 ITAKTVNTILLIGSGTLKYLPVHEAYTQWSLSIXXXXXXXXXX-XXXXEQCAVFDLDQVE 172
           IT  T+N + LIG   LK++   E    + L +                Q  +FD  Q++
Sbjct: 112 ITENTINCLFLIGDCKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIK 171

Query: 173 ARPSFDYLYQ 182
           +   FD++Y 
Sbjct: 172 SFEKFDWIYN 181

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPL--AKLHGHVPF 58
          M K+  S++ K+++S++L  WI+  +L  ++E   + I   V +FVP L    +   V  
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 59 KSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95
            +I+LN RHF+K+T F++V  + V+AS RD+ C IL
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score = 66.2 bits (160), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 85/196 (43%), Gaps = 32/196 (16%)

Query: 14  ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSEILLNR-RHFLKI 72
           +S+FL+ WI  + +   K+++   I          L +L  +   K +++L      +K+
Sbjct: 15  DSIFLKPWI-KEFIEDGKKNSIGKI--------GNLDELLNNTNVKLQLILKYPNQLVKL 65

Query: 73  TNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVNTILLIGSGTLKY 132
           TN + +  + VF S RDN  ++LVEFT  CVS FER   IRIT +T N + LIG   +KY
Sbjct: 66  TNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGDCIIKY 125

Query: 133 LPVHE----------------------AYTQWSLSIXXXXXXXXXXXXXXEQCAVFDLDQ 170
           +   E                       + ++   +               Q  +FD DQ
Sbjct: 126 VTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMIFDWDQ 185

Query: 171 VEARPSFDYLYQLTPF 186
           V    ++ ++Y   P+
Sbjct: 186 VVTFENYPFVYSQIPY 201

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%)

Query: 50  AKLHGHVPFKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERL 109
           A  +  +P  S +L N  H +KIT F +V  + + AS +D  C+ILVE TP CV+ +ER 
Sbjct: 73  ADSYNVIPLSSSLLSNNNHIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERK 132

Query: 110 NSIRITAKTVNTILLIGSGTLKYLPVHEA 138
              R+T+ T++ + +IG   L +   +E 
Sbjct: 133 TRDRMTSNTLDCLFVIGDCRLYFQNKNEV 161

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 9/83 (10%)

Query: 14 ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVP-FKSEILLNRRHFLKI 72
          +SVFL+ WI +     + EH P          +PP+       P   S++L N RHF+K+
Sbjct: 12 DSVFLQPWIQT----ALAEHDPR----LGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKV 63

Query: 73 TNFHRVEKFAVFASGRDNNCRIL 95
          T F  V+ + V+AS RD+  ++L
Sbjct: 64 TRFFDVDHYTVYASIRDSKAQLL 86

>Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar to
           Ashbya gossypii AER035W
          Length = 1019

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 54  GHVPFKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERL 109
           G    KS +L NRRH + +    +V+K+ + +      C++L  F P+ + +F+ L
Sbjct: 386 GSALLKSCLLTNRRHVITLNTLGQVQKWDIVS------CKLLDTFEPE-IGSFDEL 434

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,413,672
Number of extensions: 655549
Number of successful extensions: 1764
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1755
Number of HSP's successfully gapped: 25
Length of query: 193
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 89
Effective length of database: 41,556,135
Effective search space: 3698496015
Effective search space used: 3698496015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)