Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kthe_YGOB_Anc_6.66.6ON62623211e-40
Kwal_56.223336.6ON62612654e-32
Sklu_YGOB_Anc_6.66.6ON61612316e-27
TDEL0G046506.6ON62622152e-24
Kpol_1045.826.6ON62612118e-24
TBLA0A072006.6ON65612082e-23
ZYRO0F00418g6.6ON62622021e-22
Klac_YGOB_Anc_6.66.6ON61612022e-22
TPHA0J002306.6ON62621943e-21
CAGL0A01111g6.6ON69611926e-21
Skud_16.66.6ON62601856e-20
KNAG0E027906.6ON65621822e-19
Suva_16.346.6ON62561804e-19
NDAI0I027406.6ON66591788e-19
YPL271W (ATP15)6.6ON62601771e-18
Smik_6.4796.6ON62601727e-18
NCAS0D022006.6ON85591702e-17
KAFR0B064906.6ON66601674e-17
ACR021W6.6ON62611492e-14
Ecym_30086.6ON61611441e-13
Suva_8.1895.474ON62626601.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kthe_YGOB_Anc_6.6
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...   128   1e-40
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...   106   4e-32
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    94   6e-27
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    87   2e-24
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    86   8e-24
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    85   2e-23
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    82   1e-22
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    82   2e-22
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    79   3e-21
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    79   6e-21
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       76   6e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    75   2e-19
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    74   4e-19
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    73   8e-19
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    73   1e-18
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    71   7e-18
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    70   2e-17
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    69   4e-17
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    62   2e-14
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    60   1e-13
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...    28   1.5  

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score =  128 bits (321), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 KN 62
          KN
Sbjct: 61 KN 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score =  106 bits (265), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/61 (83%), Positives = 55/61 (90%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGLTYNNYMAIAAQTVRSALK + QTA+VL RSKTEARF+KYE GT  AE+QPL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 93.6 bits (231), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (88%), Gaps = 1/61 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGLTYNNY++IAA+TVR+ALK + QTAQVL RSK+EA+FIK+E GTP ++  PL
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59

Query: 61 K 61
          K
Sbjct: 60 K 60

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 54/62 (87%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          M+AWRKAGLTYN Y+++AA+TVR+ALK +LQ A+VL RSKT+AR++KYEKG+  +++ PL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 KN 62
          + 
Sbjct: 61 QE 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 85.9 bits (211), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAG+TYN Y+ IAAQTVR ALKN+L+T  VL RSKTEA+F+ +E G P  E  P+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 K 61
          +
Sbjct: 61 Q 61

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 84.7 bits (208), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 50/61 (81%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAG+TYN Y+AIAA+TVR+ALK +LQTA V+ RS TEARF KY KG+P A+   L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 82.4 bits (202), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGLTYN Y+++AA+TVRSALK + QTA VL R + ++++ K+EKG P  E +PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

Query: 61 KN 62
           N
Sbjct: 61 VN 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 82.4 bits (202), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%), Gaps = 1/61 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MS WRKAGLT+NNY+++AA TVR+ALK +LQT  VL RSK+EA+FIK+E G   +E  PL
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59

Query: 61 K 61
          K
Sbjct: 60 K 60

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 79.3 bits (194), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MS WRKAGLTY+NY+A+AA+TVR +LKNDL+T  VL RSKT+ ++  +EKGT  +E   +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 KN 62
           +
Sbjct: 61 SD 62

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 78.6 bits (192), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 50/61 (81%)

Query: 2  SAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLK 61
          +AWRKAGL+Y++++AIAA+TVR +LK +LQT  V+GR KT+A + KYEKG+P ++  PL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 N 62
           
Sbjct: 69 E 69

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAG++Y  Y+ +AAQT+RS+LK +LQTA VL RSKT+A + KY+ G   +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 74.7 bits (182), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (75%), Gaps = 1/62 (1%)

Query: 1  MSA-WRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQP 59
          MSA W+KAG+TY  Y+ + A+T+RSALKN+LQT  VL R  T+A +  YEKGTP A+ QP
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 LK 61
          L+
Sbjct: 61 LQ 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 45/56 (80%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAE 56
          MSAWRKAG++Y  Y+ +AAQT+RS+LK +LQTA VL RS+T+A + KY+ GT  +E
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASE 56

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 73.2 bits (178), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (77%)

Query: 4  WRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLKN 62
          WRKAG+TY+ Y++IAA+T+R+ALK +LQTA V+ RS T+A F KY+ G P +E + L+ 
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAG++Y  Y+ +AAQ +RS+LK +LQTA VL RS+T+A + +Y+ GT  +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 70.9 bits (172), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 45/60 (75%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAG++Y  Y+ +AA+ +RS+LK +LQTA VL RSKT+A + +Y+ G   +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 70.1 bits (170), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 45/59 (76%)

Query: 4  WRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLKN 62
           RKAG+TY  Y+ +A++T+R++LK +LQT  V+ RS T+A + KYEKG+P+A+  PL+ 
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQT 82

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 68.9 bits (167), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%)

Query: 2  SAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLK 61
          S WRKAGLTY +Y++IA++T+R  LK + QTA V  RS TEA    Y+ G+P+++ +PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 62.0 bits (149), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGLTYN+Y+A+AA+TVR+ALK +LQ+  VL RS TEA+ I Y      AEA PL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 K 61
          +
Sbjct: 61 R 61

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 60.1 bits (144), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60
          MSAWRKAGL+YN YMA+AA+ VRSALK +L+ A VL RS TEA+ I Y+ G   ++A PL
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGA-ASDAVPL 59

Query: 61 K 61
          K
Sbjct: 60 K 60

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 27.7 bits (60), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 19/26 (73%)

Query: 6   KAGLTYNNYMAIAAQTVRSALKNDLQ 31
           + G+ YN+Y+ + A+ ++S LKN ++
Sbjct: 108 QTGIFYNSYLYVHAKNIQSKLKNSIK 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.123    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,288,634
Number of extensions: 123419
Number of successful extensions: 255
Number of sequences better than 10.0: 21
Number of HSP's gapped: 255
Number of HSP's successfully gapped: 21
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)