Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_YGOB_YDR119W-A8.273ON75753846e-50
TPHA0A017408.273ON79752033e-22
SAKL0H16786g8.273ON74681443e-13
CAGL0B01875g8.273ON74551416e-13
Ecym_42978.273ON74461364e-12
TDEL0F040008.273ON62421233e-10
KLLA0F19371g8.273ON80681173e-09
TBLA0F030308.273ON75651122e-08
YDR119W-A (COX26)8.273ON66701113e-08
Smik_4.3648.273ON65701103e-08
Suva_2.2808.273ON66701079e-08
Skud_4.3808.273ON66681061e-07
KNAG0H031708.273ON7171982e-06
Kwal_YGOB_YDR119W-A8.273ON7428982e-06
NDAI0J012908.273ON7576931e-05
KLTH0G13442g8.273ON7469932e-05
KLLA0F19382gsingletonON7572896e-05
KAFR0B054408.273ON6649843e-04
ZYRO0D06908g8.273ON7759800.001
KAFR0B027608.273ON7967740.012
KAFR0A004702.418ON59364680.23
ZYRO0A06578g5.401ON72051584.7
NOTE: 1 genes in the same pillar as Kpol_YGOB_YDR119W-A were not hit in these BLAST results
LIST: NCAS0B03770

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_YGOB_YDR119W-A
         (75 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...   152   6e-50
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    83   3e-22
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    60   3e-13
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    59   6e-13
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    57   4e-12
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    52   3e-10
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    50   3e-09
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    48   2e-08
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    47   3e-08
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    47   3e-08
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    46   9e-08
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    45   1e-07
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    42   2e-06
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    42   2e-06
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    40   1e-05
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    40   2e-05
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    39   6e-05
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    37   3e-04
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    35   0.001
KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273...    33   0.012
KAFR0A00470 Chr1 (87358..89139) [1782 bp, 593 aa] {ON} Anc_2.418...    31   0.23 
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    27   4.7  

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score =  152 bits (384), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
          MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI
Sbjct: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60

Query: 61 LSWPFIIYHYKAPDY 75
          LSWPFIIYHYKAPDY
Sbjct: 61 LSWPFIIYHYKAPDY 75

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 82.8 bits (203), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 54/75 (72%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
          MFS+I++++TAR+   Q +R++S A +   + H+GESW +TEAKRV P ++ WG+ +T +
Sbjct: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60

Query: 61 LSWPFIIYHYKAPDY 75
          L WP  I ++K P+Y
Sbjct: 61 LLWPSFIKYFKDPNY 75

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 60.1 bits (144), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 1  MFSRILARTTARVGR-VQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTA 59
          MFS  + R+TA + R   A + AS     A+ G +GE WA+TEAKR+ PTI  WG ++ A
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 60 ILSWPFII 67
          +L WPF +
Sbjct: 61 VLGWPFAV 68

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 58.9 bits (141), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%)

Query: 20 RYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHYKAPD 74
          R  S+  +  A G IG SW + E KR+ PT+IGW + LT  L WPF IY +K P+
Sbjct: 20 RSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKKPN 74

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 57.0 bits (136), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 31/46 (67%)

Query: 25 ANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHY 70
          A +AA + HIGE W VTE KR+ PTI+ WG T+T IL WP I   Y
Sbjct: 23 ARRAATSKHIGEPWMVTETKRLVPTILIWGGTMTGILLWPIIFRVY 68

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 52.0 bits (123), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 33 HIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHYKAPD 74
          H  +SWAV+EAKR+ P I+GWG  L   L WPF I H+ + +
Sbjct: 21 HNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFMSAN 62

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 49.7 bits (117), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGH-IGESWAVTEAKRVFPTIIGWGTTLTA 59
          MF     R+TA +    A +  +T   A  +G  +GE+WAVTEA+R+ PTI+ +GT + +
Sbjct: 1  MFFTKALRSTATIAMNHATQ--TTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVS 58

Query: 60 ILSWPFII 67
          +L WPF++
Sbjct: 59 VLGWPFLV 66

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 47.8 bits (112), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 7  ARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFI 66
          AR++A + R+Q  R       +    +  ESWAVTE KR+ P I  W T L+  L WPF 
Sbjct: 7  ARSSASMARMQLRR-------SFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPFC 59

Query: 67 IYHYK 71
             Y+
Sbjct: 60 FVWYQ 64

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 47.4 bits (111), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
           FS++L R++AR   ++  RY          G IGESW +TE +R+ P I  W   L+  
Sbjct: 2  FFSQVL-RSSARAAPIK--RYT--------GGRIGESWVITEGRRLIPEIFQWSAVLSVC 50

Query: 61 LSWPFIIYHY 70
          L WP  +Y +
Sbjct: 51 LGWPGAVYFF 60

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 47.0 bits (110), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
           FS +L R++AR   ++  RY          G +GESW +TE +R+ P +  W  TL+  
Sbjct: 2  FFSEVL-RSSARAAPIK--RYT--------GGRVGESWVITEGRRLIPEVFQWSATLSIC 50

Query: 61 LSWPFIIYHY 70
          L WP  +Y +
Sbjct: 51 LGWPSAVYFF 60

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 45.8 bits (107), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 11/70 (15%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
           FS++L R++AR   ++  RY          G +GE+W +TE++R+ P +  WG  +   
Sbjct: 2  FFSQVL-RSSARAAPIK--RYT--------GGRVGEAWMITESRRLIPEVFQWGAVICTC 50

Query: 61 LSWPFIIYHY 70
          L WP  +Y +
Sbjct: 51 LGWPGAVYFF 60

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 45.4 bits (106), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 11/68 (16%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
           FS++L R++AR   ++  RY          G +GESW +TE +R+ P ++ W   L+  
Sbjct: 2  FFSQVL-RSSARAAPIK--RYT--------GGRVGESWVITEGRRLIPEVLQWSAALSIC 50

Query: 61 LSWPFIIY 68
          L WP  +Y
Sbjct: 51 LGWPGAVY 58

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 42.4 bits (98), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
          MF   ++++  R+ +   +RYAS+       G +G  +  TE KR  P +  WG+ L  +
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSG------GRVGPGFYRTEIKRRIPQVALWGSGLFLV 54

Query: 61 LSWPFIIYHYK 71
          L WPF    Y 
Sbjct: 55 LEWPFFFKWYN 65

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 42.4 bits (98), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 38 WAVTEAKRVFPTIIGWGTTLTAILSWPF 65
          WAV EAKR+ PT+  W T++T +L WPF
Sbjct: 40 WAVIEAKRIVPTVAMWATSMTIMLGWPF 67

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 40.4 bits (93), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHI-GESWAVTEAKRVFPTIIGWGTTLTA 59
          +F+ +L R+     R  AVR   T   A     + G  W  +E +RV PTI+ W T L  
Sbjct: 2  LFNSVLKRSI----RNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVV 57

Query: 60 ILSWPFIIYHYKAPDY 75
          +L WP   Y+Y    Y
Sbjct: 58 VLGWPAPFYYYHKIKY 73

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 40.4 bits (93), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGES--WAVTEAKRVFPTIIGWGTTLT 58
          M S  + ++ A +  V A + + +A++    G    +  WAV EAKR+ P I  WG  + 
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60

Query: 59 AILSWPFII 67
          A+L WPF +
Sbjct: 61 AVLGWPFAV 69

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 38.9 bits (89), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQA--AAAGHIGESWAVTEAKRVFPTIIGWGTTLT 58
          MF R+L     R G+     +A+TA +   A+  H+GESW  +E +R+ P +I +   + 
Sbjct: 1  MFIRLL-----RAGK----EHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIG 51

Query: 59 AILSWPFIIYHY 70
           +++WP+ +  Y
Sbjct: 52 TMVTWPYWVKEY 63

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 37.0 bits (84), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 21 YASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYH 69
          YA+T+     A HIG  +   +AK+   TI  WGT L   L WP +IY+
Sbjct: 16 YAATSK--THAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 12 RVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHY 70
          +V R  AV     A +  +    GE W + EA+R+    + W  +L+ IL+WP  I  +
Sbjct: 5  QVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKF 63

>KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 79

 Score = 33.1 bits (74), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60
          +FS++L +   ++   QA++ +        +G  G  W + E KR    I G+  TL+ +
Sbjct: 2  IFSKVLHQKNLKL---QAIK-SQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVL 57

Query: 61 LSWPFII 67
            WPF I
Sbjct: 58 CFWPFSI 64

>KAFR0A00470 Chr1 (87358..89139) [1782 bp, 593 aa] {ON} Anc_2.418
           YLR028C
          Length = 593

 Score = 30.8 bits (68), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 3   SRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAILS 62
           S  L RT ++  ++  +RY +  +Q+ A   IGE  A T   +V     G+   L A+ S
Sbjct: 187 SDFLRRTYSQNEKMLQLRYGTNPHQSDAQAFIGEG-ANTLPLKVLNGSPGYINLLDALNS 245

Query: 63  WPFI 66
           WP +
Sbjct: 246 WPLV 249

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 26.9 bits (58), Expect = 4.7,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 26  NQAAAAGHIGESWAVTEAKRVFPTII---GWGTTLTAILSWPFIIYHYKAP 73
           N   A  H  +S A+ +A+R + T+I   G GT+ TA +S      HY +P
Sbjct: 545 NVYLAVDHDDQSIAIAQARRKYTTLITPDGAGTSATASIS------HYLSP 589

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.132    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,109,715
Number of extensions: 159107
Number of successful extensions: 492
Number of sequences better than 10.0: 22
Number of HSP's gapped: 492
Number of HSP's successfully gapped: 22
Length of query: 75
Length of database: 53,481,399
Length adjustment: 47
Effective length of query: 28
Effective length of database: 48,092,097
Effective search space: 1346578716
Effective search space used: 1346578716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)