Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_YGOB_Anc_5.7045.704ON20720710841e-152
ZYRO0G06556g5.704ON3792024847e-59
TDEL0B021605.704ON3752004281e-50
KLTH0E01012g5.704ON3862054263e-50
SAKL0E14960g5.704ON3842024142e-48
TPHA0D046205.704ON4061784142e-48
Kwal_55.196885.704ON3932024063e-47
KNAG0C066105.704ON3862033924e-45
NCAS0A031905.704ON3982113907e-45
CAGL0G02519g5.704ON3781913462e-38
KLLA0A00550g5.704ON3801903296e-36
KAFR0H002005.704ON3892023182e-34
NDAI0E050505.704ON4512012951e-30
AFR288C5.704ON4652052862e-29
Kwal_34.15999singletonOFF11767740.14
TPHA0M013903.321ON1455119682.6
Ecym_52271.239ON44289673.5
TDEL0A054408.599ON128844673.9
TDEL0B035408.755ON34061664.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_YGOB_Anc_5.704
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   422   e-152
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   191   7e-59
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    169   1e-50
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   168   3e-50
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   164   2e-48
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   164   2e-48
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   160   3e-47
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   155   4e-45
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    154   7e-45
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   137   2e-38
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   131   6e-36
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      127   2e-34
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   118   1e-30
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   114   2e-29
Kwal_34.15999 s34 (149856..150209) [354 bp, 117 aa] {OFF} [conti...    33   0.14 
TPHA0M01390 Chr13 (295610..299977) [4368 bp, 1455 aa] {ON} Anc_3...    31   2.6  
Ecym_5227 Chr5 complement(475496..476824) [1329 bp, 442 aa] {ON}...    30   3.5  
TDEL0A05440 Chr1 (953042..956908) [3867 bp, 1288 aa] {ON} Anc_8....    30   3.9  
TDEL0B03540 Chr2 complement(637464..638486) [1023 bp, 340 aa] {O...    30   4.2  

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  422 bits (1084), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV 60
           MATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV
Sbjct: 1   MATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV 60

Query: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
           NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR
Sbjct: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180
           KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180

Query: 181 LTIHINSVKDYLSFDLQVLTTLQDSSI 207
           LTIHINSVKDYLSFDLQVLTTLQDSSI
Sbjct: 181 LTIHINSVKDYLSFDLQVLTTLQDSSI 207

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  191 bits (484), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 98/202 (48%), Positives = 133/202 (65%), Gaps = 7/202 (3%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           A  P+   I FF+I SLGFHA LLHAC  P+  KMG ERFQ+AA+ ILE+Y LDL+I ++
Sbjct: 181 AALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD 240

Query: 62  KSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIRK 121
              R YAYFA+INT NLE TY PSP+SN LE  L+LLGYSS L R ELV+KIM+GY  + 
Sbjct: 241 GLRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKP 300

Query: 122 GDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME---KSKGRT 178
              + T+E   Y+++        +++++ + +S+ HKFEICCDG+LL+L++     K + 
Sbjct: 301 NGDLPTNEDMIYKSI---THDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKP 357

Query: 179 DNLTIHINSVKDYLSFDLQVLT 200
            N  I    + DY  F LQV +
Sbjct: 358 SN-EIRFQFLNDYSGFQLQVYS 378

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  169 bits (428), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 121/200 (60%), Gaps = 3/200 (1%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           A FP+   I FFIILS+GFHA L+HAC RPE  +MG E+FQLA   IL+ Y+LDL I VN
Sbjct: 178 AVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVN 237

Query: 62  KSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIRK 121
                Y+YFA+INT NLE  Y PSP+S+ L+  L LLGYSS LS+ + + K+MKGY +  
Sbjct: 238 SLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGP 297

Query: 122 GDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDNL 181
            D +  D  T Y        G D+ +D  +  S  +K EICCDG+LL+L +       + 
Sbjct: 298 SDKLPLDSDTIYVPF---TKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSN 354

Query: 182 TIHINSVKDYLSFDLQVLTT 201
              I  +  Y  F+++ +++
Sbjct: 355 KFSIEFLNHYSKFNIKAMSS 374

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  168 bits (426), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 127/205 (61%), Gaps = 16/205 (7%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           ATFP+   + FFIILS+GFHA LLH C +     +G ERF++A+ EIL+ Y L+  ++V+
Sbjct: 189 ATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVS 248

Query: 62  K-STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
              TR Y+YFA+INT NLE +Y PSP+SN L   L +LGYSSKL +A LV KIMKGY  R
Sbjct: 249 GLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNR 308

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM------EKS 174
            GD I  D   Y    +     ++++ D+   N +   FEICCDG LL+++      +K 
Sbjct: 309 AGDDISGDGVIY----EPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQDQKF 364

Query: 175 KGRTDNLTIHINSVKDYLSFDLQVL 199
            GR     I I  +K++ SF+L V+
Sbjct: 365 DGR-----IRIQFLKNFSSFELNVM 384

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  164 bits (414), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 129/202 (63%), Gaps = 8/202 (3%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV- 60
           A+FP+     FFIILS+GFHA LLH C+  +   MG ERF+ A+ +I + YDL   + + 
Sbjct: 186 ASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKYKVSIP 245

Query: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
           N+ +  YAYFAIINT NLE TY PSP S+ L ++L LLG+ S L  +EL+ +I +G   +
Sbjct: 246 NRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITRGRTAQ 305

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDL--MEKSKGRT 178
           KGD I  D    YE L   +   DI+V+   + S+  KFEICCDG LL+L  M+ ++G  
Sbjct: 306 KGDDI-MDTGVIYEKL---EKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGSF 361

Query: 179 DNLTIHINSVKDYLSFDLQVLT 200
           D  TI ++ ++DY  F+L+VL+
Sbjct: 362 DG-TIKVSFLQDYSPFNLKVLS 382

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  164 bits (414), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 115/178 (64%), Gaps = 12/178 (6%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
            T P+   I FFII S+GFHA LLHAC   E  KMGTERF  A++ I + YDL++ +   
Sbjct: 198 VTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTTK 257

Query: 62  KST----RRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGY 117
             +    R YAYFAIINT NLEL Y PSP S+V +N L LLGY + LS  +LV+KIM GY
Sbjct: 258 NGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAGY 317

Query: 118 IIRKGDVIKT-DEYTYYETLDLSQSGIDIIV----DEKMNNSNTHKFEICCDGLLLDL 170
             ++ + I   D  TYY  ++LS +G+ II+    D+K+     +K++ICCDGLLL+L
Sbjct: 318 SYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKL---EKYKYDICCDGLLLNL 372

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  160 bits (406), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 123/202 (60%), Gaps = 8/202 (3%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV- 60
           A FP+   I FFIILS+GFHA LLH C +P   K+G ERF+LA+KEI E Y LD  ++V 
Sbjct: 190 AIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQVT 249

Query: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
            +    Y+YFA+INT NLE  Y PSPKSN L + L LLGYSS L +  L+++IMKGY  +
Sbjct: 250 QRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYSNQ 309

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM--EKSKGRT 178
               I  +  TY        + +D++  +         F+ICCDG LL+++  + + G  
Sbjct: 310 PETDINEEGVTY----QAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQPAHGSF 365

Query: 179 DNLTIHINSVKDYLSFDLQVLT 200
           D   IH+  +K++ SF L+VL+
Sbjct: 366 DG-RIHVKFLKEHSSFHLKVLS 386

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  155 bits (392), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 8/203 (3%)

Query: 2   ATFPD-DSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV 60
           A  PD ++ + FFI+LSLGFHA LLHA    +   MG ERFQ A+ +IL+ Y L   I +
Sbjct: 184 AILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQITL 243

Query: 61  NKS--TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYI 118
           +K      YAYFA++N  NLE +Y PSP+S+  ++ L LL YSS L+R +L+++IM GY 
Sbjct: 244 DKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYK 303

Query: 119 IRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME-KSKGR 177
            R+GD +  D YT Y+ +     G +I +  K    N   FE+C DG L +L++ KS   
Sbjct: 304 NRRGDELTADPYTTYKRIS---EGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQH 360

Query: 178 TDNLTIHINSVKDYL-SFDLQVL 199
            + LTI +  +   L SFD+ V+
Sbjct: 361 QEELTIQVELIDSALGSFDILVM 383

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  154 bits (390), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 118/211 (55%), Gaps = 16/211 (7%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           A FP+ + I FF+ILSLGFHA LLH C  P   K+G ERF++A+++IL  YDLDLNI + 
Sbjct: 192 AIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIE 251

Query: 62  K--------STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKI 113
                     +R Y+YF ++NT  LE  Y PSP+SN L + L ++ YSS L + EL+ +I
Sbjct: 252 SPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARI 311

Query: 114 MKGYIIRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDL--- 170
           +KGY    GDV+     TY    D       I ++     S + KF++CCDGLL +L   
Sbjct: 312 LKGYENNIGDVVNNTGVTYLPIED----NFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDF 367

Query: 171 -MEKSKGRTDNLTIHINSVKDYLSFDLQVLT 200
             +   G   N  I I  +  Y  F L +++
Sbjct: 368 IHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  137 bits (346), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           A  P+ + + FFIILSLGFHA LLH    P+   MG ERFQ+A+K + E+YDL++ I VN
Sbjct: 185 AQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVN 244

Query: 62  K-STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
              ++ Y+YFA+I   NLE TY PSPKS+VL+  L +LGY + +   +L DKIM+GY  +
Sbjct: 245 GLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHNK 304

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180
            G+ I+ +  T Y+     Q  +++ + +  +N+  +++++C DG LL+L E    + + 
Sbjct: 305 DGEDIQ-EIGTIYQCF---QKNLELSI-KTGHNAPKYRYDMCIDGYLLNL-EDCNSKDNE 358

Query: 181 LTIHINSVKDY 191
             I I  + D+
Sbjct: 359 YKILIRFIDDH 369

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  131 bits (329), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 106/190 (55%), Gaps = 7/190 (3%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           ATF +   + FFIILSLGFHA LLH C   E  KMG ERF++A++ IL  Y L+  + + 
Sbjct: 188 ATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSIP 247

Query: 62  KSTR-RYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
                 ++YFA+INT+NLE TY PSP S+ LE+ L +L Y S L R E   ++  GY   
Sbjct: 248 DILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSNT 307

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180
           K   I  +  T+Y  L      ++++ D     S    FE+CCDG LL+L+E     T  
Sbjct: 308 KHSNILQNG-TFYRPLPFC-FNVEVLDDP----SQKSNFEVCCDGQLLNLLELEGKNTPP 361

Query: 181 LTIHINSVKD 190
            TI I +  +
Sbjct: 362 STIRIETCTE 371

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  127 bits (318), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 119/202 (58%), Gaps = 10/202 (4%)

Query: 4   FPDDSRIYFFIILSLGFHATLLHACSR-PELLKMGTERFQLAAKEILETYDLDLNIKVNK 62
           FP+   + FFIILSLG HA +LH C   P+  K G ERF+LA ++++ TYDL++ +++ +
Sbjct: 191 FPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPE 250

Query: 63  S--TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120
              +  ++YF +INT NLE +Y PSP S+     L +LGYSS L+  +L++ + +GY  +
Sbjct: 251 LDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNK 310

Query: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLL---DLMEKSKGR 177
            GD +       Y+ +      + I++ E    S  +K++ICCDGLL    D++ ++  +
Sbjct: 311 LGDELVESSNMVYKPI---SRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENPTK 366

Query: 178 TDNLTIHINSVKDYLSFDLQVL 199
            D +       +D L F++QVL
Sbjct: 367 EDYVLKTNFKSRDSLPFEVQVL 388

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  118 bits (295), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 113/201 (56%), Gaps = 17/201 (8%)

Query: 10  IYFFIILSLGFHATLLHACSRPELL-KMGTERFQLAAKEILETYDLDLNIKVNKSTRR-- 66
           IYFFI+LS+GFHA LLH CS  E    +G ERF+LA+ EIL  Y+L+LNI +     +  
Sbjct: 243 IYFFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSH 302

Query: 67  ------YAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSS-KLSRAELVDKIMKGYII 119
                 ++YF ++NT  LE  Y PSP S+ L+N+L +L Y S   ++ +L+  IMKGY  
Sbjct: 303 IILNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSN 362

Query: 120 RKGDV----IKTDEYTYYETLDLS-QSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM--E 172
             G      I  D   Y+   D   +  ++       + S +H +E+CCDG+L +L+  +
Sbjct: 363 ELGQKNIQNIDEDGIIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQ 422

Query: 173 KSKGRTDNLTIHINSVKDYLS 193
            ++G+ D ++  I +  + +S
Sbjct: 423 TNQGKQDKISFEIEANSNKIS 443

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  114 bits (286), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 110/205 (53%), Gaps = 15/205 (7%)

Query: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61
           A FP    I FFI+LS GFHA LLH C+     ++G ERF+ A+ EIL+ Y L  +++V 
Sbjct: 263 ARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVR 322

Query: 62  KS------TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMK 115
            +         YAYFA++NT +LE TY PSP S+ L   L +L + ++LSR +L + +M 
Sbjct: 323 AADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMA 382

Query: 116 GYIIRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME-KS 174
           GY   +G  +      Y    D     I+    +++ N      E+C DG LL+L++ ++
Sbjct: 383 GYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN------ELCVDGHLLNLVDLQA 436

Query: 175 KGRTDNLTIHINSVKDYLSFDLQVL 199
            G   + +I +  V    SF L+ L
Sbjct: 437 PGDVFDGSIEVGVVP--ASFGLKAL 459

>Kwal_34.15999 s34 (149856..150209) [354 bp, 117 aa] {OFF} [contig
           272] FULL
          Length = 117

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 10/67 (14%)

Query: 64  TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLG--YSSKL-----SRAELVDKI--- 113
           TRRYA  A++ T+  EL +C S ++N      QL G  YSS++     SR  +  KI   
Sbjct: 34  TRRYADVAMLMTAGAELCFCCSVQTNTNVMRFQLRGPVYSSQVLSLNPSRVTVSSKILQT 93

Query: 114 MKGYIIR 120
           +K Y+ R
Sbjct: 94  LKSYMSR 100

>TPHA0M01390 Chr13 (295610..299977) [4368 bp, 1455 aa] {ON}
           Anc_3.321 YBL034C
          Length = 1455

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 70  FAIINTSNLELTYCPSPKSNVLENSLQLL-----------GYSSKLSRAELVDKIMKGYI 118
           F I +T  +E  +  SP   +LENSL+ L           G S       +    M   I
Sbjct: 120 FWISSTRAIEAIFLVSPS--ILENSLKNLCLNDFSIFIDNGMSDDTINMLIKKNDMNKNI 177

Query: 119 IRKGDVIKTDEYTYYETL----DLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEK 173
           +  G+++KTDE      L    D +   I+I+ +   N+ N+H F      LL DL+ K
Sbjct: 178 LAIGELVKTDEKNNRNPLERIDDFNSVFINILNNIDYNDENSHAFANLAIELLKDLLTK 236

>Ecym_5227 Chr5 complement(475496..476824) [1329 bp, 442 aa] {ON}
           similar to Ashbya gossypii ADR324W
          Length = 442

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 110 VDKIMKGYIIRKGDVIKT-DEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLL 168
           ++KI K + +R    IK  DE     + +  +SG+  ++   + ++    FE+  +   +
Sbjct: 77  LEKINKFWHVRGSTQIKNWDEIKLTRSGERERSGL--VLSNGIGDNTIDDFEVVVE-FAI 133

Query: 169 DLMEKSKGRTDNLTIHINSVKDYLSFDLQ 197
           DL +++K   D + I I S+++Y++ DL 
Sbjct: 134 DLSDRTKLHGDGMAIVITSLQEYMTADLH 162

>TDEL0A05440 Chr1 (953042..956908) [3867 bp, 1288 aa] {ON} Anc_8.599
           YPL110C
          Length = 1288

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 12/44 (27%)

Query: 122 GDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDG 165
           GD+IKT+E    + +D SQ+ I  +  EK+NNS        CDG
Sbjct: 666 GDIIKTEE----KMIDESQNSIGSVTAEKINNS--------CDG 697

>TDEL0B03540 Chr2 complement(637464..638486) [1023 bp, 340 aa] {ON}
           Anc_8.755 YMR228W
          Length = 340

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 78  LELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIRKGDVIKTDEYTYYETLD 137
           L+L   PS +S +  N  +   Y    SRA+ + ++ K Y     DVI+ D Y +   +D
Sbjct: 51  LDLYPGPSQQSAIFYNRFKPQQYVLMESRADFLTQLKKEYSNSPIDVIEKDPYDWSSYVD 110

Query: 138 L 138
           L
Sbjct: 111 L 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,761,834
Number of extensions: 925290
Number of successful extensions: 3137
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3178
Number of HSP's successfully gapped: 46
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)