Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_YGOB_1043.725.705ON88884483e-59
KAFR0H001905.705ON82823233e-40
TBLA0G010305.705ON89863182e-39
YKR095W-A (PCC1)5.705ON88883182e-39
NCAS0A031805.705ON88873164e-39
TDEL0B021505.705ON91823095e-38
Smik_11.3595.705ON88883086e-38
Suva_11.3325.705ON1111113072e-37
Skud_11.3355.705ON94943044e-37
SAKL0E14982g5.705ON89883001e-36
KLTH0E00990g5.705ON89882992e-36
Kwal_YGOB_Anc_5.7055.705ON88882913e-35
KNAG0C066205.705ON101862899e-35
ZYRO0B16368g5.705ON85802852e-34
KLLA0A00539g5.705ON87802713e-32
NDAI0E050605.705ON86832704e-32
TPHA0E002005.705ON85712601e-30
Ecym_40165.705ON125742352e-26
AFR289W5.705ON81792262e-25
CAGL0G02535g5.705ON140541816e-18
Kwal_55.197737.498ON67237641.2
ZYRO0F02596g8.18ON76943621.8
KAFR0E031308.526ON77043622.4
ABL113W8.463ON64563595.1
Smik_4.6365.437ON44632586.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_YGOB_1043.72
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   177   3e-59
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   129   3e-40
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   127   2e-39
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   127   2e-39
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   126   4e-39
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   123   5e-38
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   123   6e-38
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   122   2e-37
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   121   4e-37
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   120   1e-36
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   119   2e-36
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   116   3e-35
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   115   9e-35
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   114   2e-34
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   108   3e-32
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   108   4e-32
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   104   1e-30
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    95   2e-26
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    92   2e-25
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    74   6e-18
Kwal_55.19773 s55 (114569..116587) [2019 bp, 672 aa] {ON} YJR106...    29   1.2  
ZYRO0F02596g Chr6 (206502..208811) [2310 bp, 769 aa] {ON} highly...    28   1.8  
KAFR0E03130 Chr5 complement(624633..626945) [2313 bp, 770 aa] {O...    28   2.4  
ABL113W Chr2 (186707..188644) [1938 bp, 645 aa] {ON} Syntenic ho...    27   5.1  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...    27   6.1  

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  177 bits (448), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          IDDRVLRVGVSSVIDSVKTIIETMDELS
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  129 bits (323), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (87%)

Query: 7  IEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVL 66
          + +DHTL  EIPFE A+QA IAV VLKPDPIL+PQDFQVSY + DN+ + +F+SIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 67 RVGVSSVIDSVKTIIETMDELS 88
          RVGVS+VIDS+KTIIETMDELS
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 72/86 (83%)

Query: 2  KTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSI 61
          K    ++M+HTL   IPF T++QA+IA QVL+PDPIL+PQDFQV Y+S  N L+M+F+SI
Sbjct: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62

Query: 62 DDRVLRVGVSSVIDSVKTIIETMDEL 87
          DDRVLRVGVSSVIDSVKTIIET DEL
Sbjct: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          M ++R   +DHTL+ +IPFET RQA IA +VL PDPILKPQDFQV YSS  N+++++F+S
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          IDDRVLRVGVSS+IDS+KTI+E MD LS
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 72/87 (82%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          MK  R + +D+ L+ EIPF T+RQA+IA +VL PDPILKPQDFQV Y S DN+L + F+ 
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDEL 87
          IDDRVLRVGVSSVIDS+KTIIET+DEL
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  123 bits (309), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 57/82 (69%), Positives = 71/82 (86%)

Query: 7  IEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVL 66
          + ++H+L  EIPF+TA QA IA QVL PDPILKPQDFQV Y++ DN+L++ F+SIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 67 RVGVSSVIDSVKTIIETMDELS 88
          RVGVSSVIDS+KTI+ET+DEL 
Sbjct: 61 RVGVSSVIDSIKTIVETIDELG 82

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  123 bits (308), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 75/88 (85%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          M ++R + + HTL+ ++PF+T +QA IA +VL PDPILKPQDFQ+ YSS  N+++++F+S
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          IDDRVLRVGVSSVIDS+KT++E MDELS
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  122 bits (307), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 77/111 (69%), Gaps = 23/111 (20%)

Query: 1   MKTQRTIEMDHTL-----------------------DFEIPFETARQAEIAVQVLKPDPI 37
           MK+QR + +DHTL                       + +IPFET +QA IA +VL PDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 38  LKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVIDSVKTIIETMDELS 88
           LKPQDFQ  YSS +N+++ +F+SIDDRVLRVGVSSVIDS+KTIIETMDELS
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  121 bits (304), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 76/94 (80%), Gaps = 6/94 (6%)

Query: 1  MKTQRTIEMDHTL------DFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLL 54
          M ++R + +D+TL      + +IPFET  QA IA +VL PDPILKPQDFQV YSS  N++
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 IMKFKSIDDRVLRVGVSSVIDSVKTIIETMDELS 88
          +++F+SIDDRVLRVGVSSVIDS+KTI+ET+DELS
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          MK  R + +DH L  EIP ET  QA IA++ LKPDP+LKP+DFQV YS+ D  L + FKS
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          IDDRVLRVGVSSVI+SVKTIIETMDE  
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 57/88 (64%), Positives = 71/88 (80%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          MK  R  ++ +TL  E+PF+TA+QAE AV+VLKPDPILKPQDF V YSS  + L + F+ 
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          +DDRVLRVGVSSVI+S+KTIIET+DE S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (79%)

Query: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60
          MK+ R + + +TL  E+PF+  +QA  AVQVLKPDPILKPQDF V Y+S+ N L + F+ 
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88
          +DDRVLRVGVSSVI+S+KTI+ET+DE S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  115 bits (289), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (75%)

Query: 2  KTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSI 61
          KT R   +DHTL   +PFET RQA IA QVL+PDPILKPQDF VSY++    L  +F   
Sbjct: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63

Query: 62 DDRVLRVGVSSVIDSVKTIIETMDEL 87
          D RVLRVGVSSVIDS+KTIIE++DEL
Sbjct: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 8  EMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLR 67
           +DH L   IPF   R +E+AV+VL+PDPIL+P+DFQV Y S  NLL + FKS+DDRVLR
Sbjct: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62

Query: 68 VGVSSVIDSVKTIIETMDEL 87
          VGVSSVIDSVKTI+ET+DEL
Sbjct: 63 VGVSSVIDSVKTIVETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%)

Query: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRV 68
           +H+L  EIPFE+ +QA++A +VL PDPI+KP+DFQV+YS+ D  LI  F+S+D+R+LRV
Sbjct: 8  FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67

Query: 69 GVSSVIDSVKTIIETMDELS 88
          GV+SVI+S+KTI+ET+DEL 
Sbjct: 68 GVNSVIESIKTIVETIDELC 87

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 68/83 (81%), Gaps = 4/83 (4%)

Query: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSY----SSNDNLLIMKFKSIDDR 64
          +D+TL+  IPF   R A IA QVL PDPILKP+DFQV Y    + ++N+L++KF+SID+R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 65 VLRVGVSSVIDSVKTIIETMDEL 87
          VLRVGVSSV+DS+KTI+ETMDEL
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  104 bits (260), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 63/71 (88%)

Query: 17 IPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVIDS 76
          IPFET++QA IA QVLKPDP L+P++F+V YSS  + L++ F+S+DDRVLRVGVS+VIDS
Sbjct: 12 IPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVIDS 71

Query: 77 VKTIIETMDEL 87
          +KTIIET+DEL
Sbjct: 72 IKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.1 bits (235), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%)

Query: 15  FEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVI 74
            E+PFE  +QAEIA +VL  DP+L+P+DF+V Y+     L++ F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  DSVKTIIETMDELS 88
           +S+KT++ETMDE S
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 91.7 bits (226), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 59/79 (74%)

Query: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRV 68
          MDHTL   +PFE+AR A+IA + L PDP+L+P++  VS++S+   L +K  +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 69 GVSSVIDSVKTIIETMDEL 87
            +S+ +++KT++ET DEL
Sbjct: 61 ATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 74.3 bits (181), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (77%)

Query: 14 DFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLR 67
          D  +PFETAR A IA +VL+PDPIL+P+DFQV Y +   +L + FK+IDDRVLR
Sbjct: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>Kwal_55.19773 s55 (114569..116587) [2019 bp, 672 aa] {ON} YJR106W
           (ECM27) - (putative) involved in cell wall biogenesis
           [contig 159] FULL
          Length = 672

 Score = 29.3 bits (64), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 18/37 (48%)

Query: 17  IPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNL 53
           I   T      A Q+++P P  +P D+   Y+ +D L
Sbjct: 245 ITLRTFHSNSPATQIVQPRPFTEPNDYTSQYTDDDRL 281

>ZYRO0F02596g Chr6 (206502..208811) [2310 bp, 769 aa] {ON} highly
          similar to uniprot|P25039 Saccharomyces cerevisiae
          YLR069C MEF1 mitochondrial elongation factor G- like
          protein
          Length = 769

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 16/43 (37%)

Query: 37 ILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVIDSVKT 79
          ++KPQDFQV+                D++  +G+S+ IDS KT
Sbjct: 60 LMKPQDFQVA----------------DKIRNIGISAHIDSGKT 86

>KAFR0E03130 Chr5 complement(624633..626945) [2313 bp, 770 aa] {ON}
           Anc_8.526 YBR203W
          Length = 770

 Score = 28.5 bits (62), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 2   KTQRTIEMDHTLDFEIPF--ETARQAEIAV--QVLKPDPILKP 40
           K + T  ++ +  FEI +  E   Q  I+V  ++LK DP+LKP
Sbjct: 650 KEKNTATIEKSAFFEISYDIENGSQKTISVSLEILKNDPLLKP 692

>ABL113W Chr2 (186707..188644) [1938 bp, 645 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR239C
          Length = 645

 Score = 27.3 bits (59), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 7   IEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVL 66
           I++DHT +F       R A+       P  +L+P D +V Y  ND L+      +DD  L
Sbjct: 498 IKVDHTKEFRALLGRERSADA------PGAVLEPPDDEV-YGVND-LMAPLHDPMDDSFL 549

Query: 67  RVG 69
           R G
Sbjct: 550 RSG 552

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score = 26.9 bits (58), Expect = 6.1,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 40  PQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVS 71
           P+ F++S  SN+ + I K K+I   V   G S
Sbjct: 412 PESFEISIDSNNTIAITKLKNIPKHVELFGTS 443

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,453,589
Number of extensions: 299153
Number of successful extensions: 995
Number of sequences better than 10.0: 25
Number of HSP's gapped: 992
Number of HSP's successfully gapped: 25
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)