Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.95.475ON64264233450.0
TPHA0J027805.475ON63164917200.0
TDEL0A033905.475ON62264215320.0
YOR138C (RUP1)5.475ON67164714820.0
Skud_15.3025.475ON67864614400.0
Smik_15.3185.475ON67265414380.0
Suva_8.1905.475ON66652213780.0
KAFR0E025405.475ON65966613451e-178
SAKL0G03564g5.475ON60564712861e-170
NCAS0H022705.475ON69668112161e-158
TBLA0A025405.475ON67859211141e-143
ZYRO0D11264g5.475ON54764511001e-143
NDAI0C013905.475ON70969210751e-137
TBLA0B022305.475ON79069610701e-135
Kwal_55.212675.475ON60464310281e-131
KLTH0F15004g5.475ON59750110071e-128
KNAG0B040505.475ON67369410041e-127
CAGL0I07205g5.475ON6036539401e-118
KLLA0E03169g5.475ON5444995874e-67
KAFR0C004103.270ON76951930.013
YER143W (DDI1)8.185ON42836880.042
Skud_5.2808.185ON42836880.044
Smik_5.3088.185ON42840870.057
NDAI0C058908.185ON46236870.058
Suva_5.2718.185ON42836820.26
Kwal_56.230843.270ON76251800.51
SAKL0D03322g3.270ON76540800.55
NDAI0C066308.2ON433171770.91
NCAS0I016203.270ON79553771.3
KAFR0B023008.185ON41636732.8
Kpol_1028.897.488ON87736724.1
KAFR0I027801.480ON21451704.4
KNAG0G015808.185ON40637715.6
NCAS0A00530singletonON37163706.7
CAGL0H10186g3.270ON77867707.9
Skud_2.1773.270ON78241708.6
TBLA0E025703.270ON78551699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.9
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...  1293   0.0  
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   667   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   594   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   575   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   559   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   558   0.0  
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   535   0.0  
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   522   e-178
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   499   e-170
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   473   e-158
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   433   e-143
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   428   e-143
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   418   e-137
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   416   e-135
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   400   e-131
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   392   e-128
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   391   e-127
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   366   e-118
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   230   4e-67
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    40   0.013
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    39   0.042
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    39   0.044
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    38   0.057
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    38   0.058
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    36   0.26 
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   0.51 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   0.55 
NDAI0C06630 Chr3 (1527445..1528746) [1302 bp, 433 aa] {ON} Anc_8...    34   0.91 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    34   1.3  
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    33   2.8  
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    32   4.1  
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    32   4.4  
KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.1...    32   5.6  
NCAS0A00530 Chr1 complement(87374..88489) [1116 bp, 371 aa] {ON}       32   6.7  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    32   7.9  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    32   8.6  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    31   9.5  

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score = 1293 bits (3345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/642 (98%), Positives = 633/642 (98%)

Query: 1   MGELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYK 60
           MGELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYK
Sbjct: 1   MGELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYK 60

Query: 61  EKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXX 120
           EKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNM  
Sbjct: 61  EKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMDY 120

Query: 121 XXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCIT 180
                  ITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCIT
Sbjct: 121 YSSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCIT 180

Query: 181 NYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD 240
           NYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD
Sbjct: 181 NYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD 240

Query: 241 QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLV 300
           QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLV
Sbjct: 241 QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLV 300

Query: 301 VNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLY 360
           VNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLY
Sbjct: 301 VNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLY 360

Query: 361 PDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTK 420
           PDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTK
Sbjct: 361 PDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTK 420

Query: 421 DCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDNIT 480
           DCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDNIT
Sbjct: 421 DCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDNIT 480

Query: 481 EELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMA 540
           EELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMA
Sbjct: 481 EELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMA 540

Query: 541 VLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYC 600
           VLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYC
Sbjct: 541 VLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYC 600

Query: 601 RRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNNSDENI 642
           RRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNNSDENI
Sbjct: 601 RRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNNSDENI 642

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/649 (52%), Positives = 459/649 (70%), Gaps = 35/649 (5%)

Query: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKAN 64
           N+NS+ S+++MGIP D+AIDAL+R NG+LEAAVNFIFSNELP       +    Y   + 
Sbjct: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYT-TSE 62

Query: 65  HVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXXXXXX 124
           HV ISN  +FQ GDL+EV+           NY  DN    DS    SD++ D        
Sbjct: 63  HVNISNDNNFQAGDLSEVM--------NVSNYGYDNRFETDSGDLSSDEVSD-------- 106

Query: 125 XXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITNYLP 184
              + N +++NL  P+Y IVKH   K+ L DPTV++PLP NS+IE+YF L+S+ I+ YLP
Sbjct: 107 PEIVENDISNNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLP 166

Query: 185 HIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMK--ICPIEDMNQD-DDQ 241
           H++++PDFKDL++  +W+ G  F  PK  +K V +E + K  +   I P+  +++D DDQ
Sbjct: 167 HLLLKPDFKDLNYDNEWYNGLKFVAPKFGIK-VHNEESLKDDLHTSIEPLTCVDRDLDDQ 225

Query: 242 PELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVV 301
           P+LLWQLQKLS+I+NSTMSER+YV +K+FS+ LD+ ++++L +A+HL EVLPSFIKYL  
Sbjct: 226 PKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTS 285

Query: 302 NLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYP 361
           NLE CP F  DEIR   ISSA+Y PSDD+ P+ TLL+LFHFLPDEY+SNLYKMFN+LLY 
Sbjct: 286 NLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYA 345

Query: 362 DENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKD 421
           D+ D D       ++GNSL  ++P L+I+FDE +E SS   LPEGV +PLEF+PQ+YTK+
Sbjct: 346 DDEDGD----GAIDEGNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKE 401

Query: 422 CKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDN--- 478
           CK++LIKHII KR+DAQ +S++ L D+NS+KSFQGKDILKF+NS+L++L+RD +  N   
Sbjct: 402 CKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLT 461

Query: 479 -----ITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGE 533
                + E L  IK  +   KT+KMN Y+DL QKL   WN+SNPE  I+ T +KLGLI E
Sbjct: 462 EGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDE 521

Query: 534 PYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASET 593
           PY L MAV+SP  YYI++R G W LVQ +  G DFD+R+CSS +E++D ++Q TRH SET
Sbjct: 522 PYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSET 581

Query: 594 PLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNK--MNNSDE 640
           PLMF+Y +   IP++  ++K  E+N+GCL F K+DQ +LN+  MN SD+
Sbjct: 582 PLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNESDD 630

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/642 (46%), Positives = 433/642 (67%), Gaps = 52/642 (8%)

Query: 7   NSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHV 66
           +++ SL+EMGI +D+A DAL R NG++EAA NFIF N+ PA+       I    E+  H+
Sbjct: 5   DAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQ-------ISENVEQRAHI 57

Query: 67  EI--SNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXXXXXX 124
           E+   +   FQPGDL E I+N    + E    ++   +++++                  
Sbjct: 58  ELPAGSASGFQPGDLNEYISNAPDTESEDFEEIDVEEDSVETG----------------- 100

Query: 125 XXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITNYLP 184
                         PS +    S  K ++ DPTV+LPLPPN + E YFAL+ L + NY+P
Sbjct: 101 --------------PSLEC---SGRKGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMP 143

Query: 185 HIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD---- 240
           H++ RPDF DL++ ++W++G S++  +  LK ++   +    ++I P +++ Q+D     
Sbjct: 144 HLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYLSKNGSDDEQIEIVPKDELTQEDGDYTL 203

Query: 241 QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLV 300
           Q ELLWQLQKL+S+ NS MS+RAYV AK+F++ ++ Q Q  +AEA+HL+EVLPSFIK + 
Sbjct: 204 QSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVA 263

Query: 301 VNLESCPGFEEDEIRKLFISSAFYTPSD----DQAPITTLLSLFHFLPDEYDSNLYKMFN 356
           V+LE CP F+++E+R+ FISSAF+TPS+    +++ + T LSLFHFLP+EY++NLY+MFN
Sbjct: 264 VDLEMCPNFQDNEVRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFN 323

Query: 357 VLLYPDEN-DSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFP 415
            LL+ D++ +SD     + E  NSL +I+P+ +IVFDE EE +  + L EGVE+PLEF+P
Sbjct: 324 ALLFADDSVESDQSDSPDGEGENSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYP 383

Query: 416 QIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK 475
           Q+YTK+CK+KLIKHIIAKR+ +Q  S+ IL +I  +KSFQGKD+ KFINSSL+YL++D K
Sbjct: 384 QLYTKECKDKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKDEK 443

Query: 476 SDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPY 535
           S  + + LL +K+ +   KT+KMNEY+++A +LQ+EWN+S PE  IV+T ++LGLI + Y
Sbjct: 444 SPELIKGLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSY 503

Query: 536 LLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPL 595
           LL MAV+SPY YY R R G+W  VQ +     ++VR CSS LE++D IKQ TR  SE PL
Sbjct: 504 LLTMAVISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPL 563

Query: 596 MFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNN 637
           MF+YC++  IP++  + K+ E+N GC  F K+DQL LNKM +
Sbjct: 564 MFIYCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQD 605

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/647 (45%), Positives = 424/647 (65%), Gaps = 38/647 (5%)

Query: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKE-K 62
           ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +AE  +    S     
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61

Query: 63  ANHVEISNKESFQPG------DLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVD 116
            N +    K    P       D+ +V         +       +  N  S C V+ +  D
Sbjct: 62  ENKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQNYD 121

Query: 117 NMXXXXXXXXXITNSVTD-NLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALY 175
                         S+++ ++ PPSY IV+H++ KS + DPTV+LPLP NS+IE+YF L+
Sbjct: 122 RY------------SISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLF 169

Query: 176 SLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDE---TTSKSTMKICPI 232
           +L    Y PH+ ++PDFKDL++  DWFKGSSF++PK  L     E   TTS+  +   P 
Sbjct: 170 ALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPN 229

Query: 233 EDMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVL 292
           E +     QP LLWQLQKL S+VN+   ERA+V AK+F+  L+ Q + +LA+++HL EVL
Sbjct: 230 EGL-----QPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVL 284

Query: 293 PSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLY 352
           P+FIK L V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLY
Sbjct: 285 PAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLY 344

Query: 353 KMFNVLLYPDENDS--DYESGDESEQG------NSLGDISPILSIVFDEAEEGSSGISLP 404
           KMFNVLLYP+E +   D   G E E+       N+L +++P+L+I+F+E E  +  +SLP
Sbjct: 345 KMFNVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLP 404

Query: 405 EGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFIN 464
            GV++PLEF+PQ+YTK CK++LI+HII+KRK A+ +S+ +L +IN +KS+QGK+I   + 
Sbjct: 405 NGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILE 464

Query: 465 SSLEYLER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIV 522
           S+L YL+   D+ ++   +++  +K+ +   +  KM EY+DLA KL  EWN+S+PETHI+
Sbjct: 465 STLAYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHII 524

Query: 523 ETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDT 582
            T ++LGLI  PY+L MA LSPYSY+IR R G W+ +Q +T G +F V++CSS   V++ 
Sbjct: 525 NTAKQLGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEA 584

Query: 583 IKQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629
           IK  T++ASETPLMF+YC    IP E  + ++ +SNSGCL F ++DQ
Sbjct: 585 IKHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQ 631

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/646 (43%), Positives = 425/646 (65%), Gaps = 31/646 (4%)

Query: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSD--------IE 55
           ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +A+           I 
Sbjct: 2   MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRIS 61

Query: 56  IISYKEKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIV 115
                  +N  ++ N    +  D+ +V   +     E    + +N     S+        
Sbjct: 62  ENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAAR 121

Query: 116 DNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALY 175
           D           I+ +   ++ PPSY IV+ ++ K  + DPTV+LPLP NS+IE+YF L+
Sbjct: 122 D------YDHYSISET---SIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLF 172

Query: 176 SLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDM 235
           +L ++ Y PH+ ++PDF+DL+++ DWFKGSSF+ PK  L +  +     +T +I  +   
Sbjct: 173 ALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRL-AYREADDGSATSEIV-LASG 230

Query: 236 NQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSF 295
           + DD QP LLWQLQKL S++N+ M ERA+V A++F++ L+ Q + +LA+++HL EVLP+F
Sbjct: 231 SSDDLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTF 290

Query: 296 IKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMF 355
           IK L V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLYKMF
Sbjct: 291 IKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMF 350

Query: 356 NVLLYP----DENDSDYESG----DE--SEQGNSLGDISPILSIVFDEAEEGSSGISLPE 405
           NVLLYP    DE D+    G    DE  +E  N+L +++P+L+I+F+E E  +  ++LP 
Sbjct: 351 NVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPN 410

Query: 406 GVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINS 465
           GV++PLEF+PQ+YTK CK++LI+H+I+KRK A+ +S+ +L +IN++KS+QGK+I   + S
Sbjct: 411 GVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLES 470

Query: 466 SLEYLER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVE 523
           +L YL+   ++ ++    ++  +K+ +   ++ KM EY+DLA K+  EW++S+PETHI++
Sbjct: 471 TLAYLQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIK 530

Query: 524 TGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTI 583
           T ++L LI  PY+L +A LSPYSY++R R G W+ VQ +  G +F ++ C S   V++ I
Sbjct: 531 TAKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAI 590

Query: 584 KQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629
           K  T++ASETPLMF+YC    IP E E+ K+ ++N+GC  F K+D+
Sbjct: 591 KHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDE 636

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/654 (43%), Positives = 430/654 (65%), Gaps = 35/654 (5%)

Query: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENS---DIEIISYK 60
           ++  ++ SL+EMGIP ++A++AL R  GNLEAAVNFIFSNELP +   S   ++E+    
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRIS 61

Query: 61  E----KANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVD 116
           E      N  ++ N    Q  D+ +V         +     + +  N  +    + +  D
Sbjct: 62  ENRIMAGNSYDVPNNGE-QDVDMPDVGGVDVDYDDDEDITDDRSGSNSTNEYRRAAQEYD 120

Query: 117 NMXXXXXXXXXITNSVTDNLLP-PSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALY 175
           +             SV++  +P PSY IV+H++ KS + DPTV+LPLP NS+IE+YF L+
Sbjct: 121 HY------------SVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLF 168

Query: 176 SLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDM 235
           +L ++ Y PH+ ++PDF+DL+F  DWFKG+SF++PK   +    E    ST     +   
Sbjct: 169 ALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPK--YRIAYREADDGSTTSDIVLASG 226

Query: 236 NQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSF 295
             D+ QP LLWQLQKL S+VN+ M ERA+V AK+F++ L+ Q + +LA ++HL EVLP+F
Sbjct: 227 PSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAF 286

Query: 296 IKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMF 355
           IK L V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLYKMF
Sbjct: 287 IKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMF 346

Query: 356 NVLLYPDENDSDYE------SGDESEQ----GNSLGDISPILSIVFDEAEEGSSGISLPE 405
           NVLLYP+E + + E      +G E E+     N+L +++P+L+I+F+E E  +  ++LP 
Sbjct: 347 NVLLYPEEEEEEEEVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPN 406

Query: 406 GVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINS 465
           GV++PLEF+PQ+YTK CK++LI+HII+KRK A+ +S+ +L +I+++KS+QGK+    + S
Sbjct: 407 GVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILES 466

Query: 466 SLEYLER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVE 523
           +L YL+   D+ ++    ++  +K+ +  +++ KM EY+DLA KL  EWN+S+PETHI+ 
Sbjct: 467 TLAYLQESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIIN 526

Query: 524 TGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTI 583
           T ++LGLI  PY+L MA +SPYSY+IR R G W+ +Q +T G +F V +CSS   V++ I
Sbjct: 527 TAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAI 586

Query: 584 KQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNN 637
           +  T++ASE PLMF+YC    IP E  + K+ +SN+GC  F K+DQ  L  +++
Sbjct: 587 RHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHS 640

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/522 (49%), Positives = 377/522 (72%), Gaps = 19/522 (3%)

Query: 135 NLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKD 194
           +L PPSY IV+H+  KS + DPTV+LPLP NS+IE+YF L++L  + Y PH+ ++PDF+D
Sbjct: 122 SLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQD 181

Query: 195 LSFTEDWFKGSSFSKPKNVL---KSVTDETTSKSTMKICPIEDMNQDDDQPELLWQLQKL 251
           L++  DWFKGSSF++P+  L   +S    TTS+  +   P +D+     QP LLWQLQKL
Sbjct: 182 LNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDV-----QPHLLWQLQKL 236

Query: 252 SSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEE 311
            S+VN+ M ERA+V AK+F++ L+ Q + +LA+++HL EVLP+FIK L V+LE CPG  +
Sbjct: 237 ISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRD 296

Query: 312 DEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYE-- 369
            E R LFISSA +TP  ++ P+ T LSLFHFLP+EYDSNLYKMFNVLLYP+E + + E  
Sbjct: 297 RETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEGEVV 356

Query: 370 -SGDESEQ--GNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKL 426
             GD + Q   N+L +++P+L+I+F+E E  +  ++LP GV+VPLEF+PQ+YTK CK++L
Sbjct: 357 YGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQL 416

Query: 427 IKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK-SDN-ITEELL 484
           I+HII+KRK A+ KS+ +L +IN++KS+QGK+I   + S+L YL+ D K +DN  ++++ 
Sbjct: 417 IRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIA 476

Query: 485 KIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSP 544
            +K+ +   +  KM EY+DLA KL  EWN+S+PE HI+ T ++LGLI  PY+L MAVLSP
Sbjct: 477 SLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSP 536

Query: 545 YSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDV 604
           YSY+ R+R G+W+ +Q +T G +F + +CSS   V++ I+  T++ASE PLMF+YC    
Sbjct: 537 YSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGR 596

Query: 605 IPEEYEIRKSFESNSGCLNFFKEDQLVLNKM----NNSDENI 642
           IP + E+ K+ E+N+GC+ F K+DQ  LN +    N+S  NI
Sbjct: 597 IPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGNI 638

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 4  LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEI 56
          ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +       I
Sbjct: 2  MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRI 54

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  522 bits (1345), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 290/666 (43%), Positives = 428/666 (64%), Gaps = 52/666 (7%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANH 65
           E+S+NSL+EMGI +++AIDAL + +GNLEAA+N+IFSN++  E+      I ++ +  N+
Sbjct: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMES------IQTHPQPNNN 58

Query: 66  -------VEISNKESFQPGDLTEVIA------------------NQQPLQPEFQNYVNDN 100
                  VE+S+ + F+PGDL  VI                    +  LQ   Q    + 
Sbjct: 59  PFLEEHTVELSDSK-FKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGET 117

Query: 101 SE-NIDSNCYVSDKIVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVI 159
            + NI  +   S     +          ++ +  +N  PP Y  V+HS+ KS + DPT++
Sbjct: 118 EKVNIPIDSQSSSYSSFSTSLSNENELRMSENTYNN--PPEYSTVQHSERKSDIADPTIV 175

Query: 160 LPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLK-SVT 218
           LPLPPNS+IENY ALY+L I N+     ++PDFKDL++ ++W++ SS  +P   +K +  
Sbjct: 176 LPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKA 235

Query: 219 DETTSKSTMKICPIEDMNQDDD-QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQ 277
           DET ++    I P  ++ + D  QP+LLWQLQKL ++VNS +SERAYV AKIF+   +QQ
Sbjct: 236 DETENE----IVPAAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQ 291

Query: 278 SQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLL 337
            Q +L +A+HLNEVLP FIK L V+LESC G +  +I+KLFISSAFY PS ++    T L
Sbjct: 292 LQSKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYL 351

Query: 338 SLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEG 397
           S FHFLP+EYD+NLYKMFNVLL PDE+D +    DE +  NSL  ISP L+IVF+E +E 
Sbjct: 352 SFFHFLPEEYDTNLYKMFNVLLIPDEDDEESGESDEDQPDNSLNIISPFLTIVFNEMDES 411

Query: 398 S----SGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKS 453
           +    +  +  +GV++P EF+PQ+YTK CK++LIKHI++KRK+++ K K IL +IN++KS
Sbjct: 412 TDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKS 471

Query: 454 FQGKDILKFINSSLEYLERDNKSDN-----ITEELLKIKNDMAIVKTQKMNEYRDLAQKL 508
           + GKDIL F+NS++++L++D+ +++     + +EL  ++  +   K    +EY++L+QKL
Sbjct: 472 YHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKL 531

Query: 509 QNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRER--TGKWNLVQCSTTGG 566
            NEWN+S P+ HI++T + LGLI  PYLL   V+SPY Y++R+R    +W LVQ +  G 
Sbjct: 532 HNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGT 591

Query: 567 DFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFK 626
           DF +     +  V  TIKQ T+  +E+PLMF+YC+ + I  + +I K  E N GC +F K
Sbjct: 592 DFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIK 651

Query: 627 EDQLVL 632
            DQL L
Sbjct: 652 ADQLHL 657

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  499 bits (1286), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/647 (43%), Positives = 398/647 (61%), Gaps = 76/647 (11%)

Query: 8   SINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHVE 67
           SI  L++MGI  ++A+DALSR NG+LEA+VN+IFS EL A  E+ D+            +
Sbjct: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDL---------TQDD 57

Query: 68  ISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXXXXXXXXX 127
             ++   +PG L +VI N             DN   +++                     
Sbjct: 58  SDSENGIKPGMLNDVIPN------------TDNVTTVETR-------------------E 86

Query: 128 ITNSVTDNLLPPS------YQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITN 181
           + N++ D++L PS       Q++K S     L DPTV+LPLPPN+++ENYFAL+ L +  
Sbjct: 87  VENTIPDDVLAPSGIMDSTTQLLKDS-----LNDPTVVLPLPPNALLENYFALFCLSVGI 141

Query: 182 YLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD- 240
             PH  ++PDF+DL++  +WFKG  +SKP+  L     + +S + + I P   +   D  
Sbjct: 142 SFPHHFLKPDFQDLNYNRNWFKGY-YSKPEYRL-----QFSSNNNVSIVPKAQLTIQDSL 195

Query: 241 --QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKY 298
             QPELLWQ QK  +++NS++S+R +V AKIF  +L+     +L   DHL EVLPSFIK 
Sbjct: 196 TLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKS 255

Query: 299 LVVNLESCPGFEED--EIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFN 356
           L  ++E C   +ED  +IR LFIS+A++ PS D+  I TL+SL HFLP+EYD+NLY+MFN
Sbjct: 256 LANDVEMC-LLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFN 314

Query: 357 VLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQ 416
            LLYP+E++         E  NSLG+++P+L++VFDE +E +  +SL +GV+VPL+F+PQ
Sbjct: 315 TLLYPEEDED------GEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQ 368

Query: 417 IYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDN-- 474
           IYTK  K+ LI H+IAKRK+AQ  S  IL D+N +KSFQGK I  F+NS++++  +D   
Sbjct: 369 IYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLF 428

Query: 475 KSDNITEELLK----IKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGL 530
           ++D  TEELLK    IK  +   KT KM EY++++  + N+WN+S+P+ ++V+  +K+GL
Sbjct: 429 QNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGL 488

Query: 531 IGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHA 590
           I EPYLL  A+LSPY YYIR+R G W  V     G D +    +   EV ++IK ATRHA
Sbjct: 489 IDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEA-SITEPHEVSESIKLATRHA 547

Query: 591 SETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNN 637
           SETPLMF YC+   I  E  IRKS E N G   F K DQ  L  + N
Sbjct: 548 SETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQN 594

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  473 bits (1216), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/681 (39%), Positives = 411/681 (60%), Gaps = 48/681 (7%)

Query: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEK-- 62
           N  ++ +L+EMGIPR++A+DAL R  GNLE AV FIFSNELP   +      I+  ++  
Sbjct: 3   NNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQDP 62

Query: 63  -ANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVND--------NSENIDSNCYVSDK 113
             +  +++N++       + V  +  P + E  NY+ D          E ID +    + 
Sbjct: 63  LPSEQDLANQDYRSSNTPSSVPGSNNPFR-ESNNYLGDEYVEGQEVQRELIDVDSSDDED 121

Query: 114 IVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSR--------------LRD---- 155
             ++           + S  +  +P S+ I   ++  S+              L+D    
Sbjct: 122 EDEDDGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELDQ 181

Query: 156 PTVILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLK 215
           PT+ILPLP NSMIENY +L++L     +P   ++ DFKDL++ ++W+KG+SF  PK +L+
Sbjct: 182 PTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFILE 241

Query: 216 --SVTDETT----------SKSTMKICPIEDMNQ-DDDQPELLWQLQKLSSIVNSTMSER 262
             S  D TT           +  + I PI   ++ +  QP LLWQLQKL++I + +MSER
Sbjct: 242 FDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSER 301

Query: 263 AYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEI-RKLFISS 321
           AY  A+IFS++ + Q +  L+++D+L +VLP FIK +  +L+ CP   +DE  + LFI+S
Sbjct: 302 AYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFITS 361

Query: 322 AFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQ--GNS 379
           AF+ P   Q+ + T L+ FHF+P+EY+ NLYKMFNVLLYPD+   + E   E E+   NS
Sbjct: 362 AFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNNS 421

Query: 380 LGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQF 439
           L   + I++++F+EA+  +  ++   GVE+PL F+PQ+Y K CK++LIKHI+ KR+ A  
Sbjct: 422 LNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQALA 481

Query: 440 KSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK--SDNITEELLKIKNDMAIVKTQK 497
           +SK++L++I  +KSF+GKDI   + S+ EYL+++      N+ E + KI+  +A  K  K
Sbjct: 482 RSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNSK 541

Query: 498 MNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWN 557
           M EY+ L+ +L  +WN+S+PE  I+ET + LGLI EPYLL   ++SPY YYIR++ G W 
Sbjct: 542 MEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGIWY 601

Query: 558 LVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYEIRKSFES 617
            VQC+T G DF V +  S   V++ IK  T   +ETPLMF++CR  +IP+E  +RK+ E 
Sbjct: 602 SVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAMEE 661

Query: 618 NSGCLNFFKEDQLVLNKMNNS 638
           N GCL F K+DQL L + +++
Sbjct: 662 NLGCLQFAKQDQLSLEEQSST 682

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  433 bits (1114), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 230/592 (38%), Positives = 353/592 (59%), Gaps = 52/592 (8%)

Query: 61  EKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXX 120
           E ++   I +KE +QP  LT+    Q P   +F    NDNS+ I                
Sbjct: 117 ENSSDSSIDSKEEYQPLYLTDT---QPPTYQDFTMTSNDNSQQI---------------- 157

Query: 121 XXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCIT 180
                           +PP Y    +   KS   DPTV+L L P+ ++ NYF L+S+ + 
Sbjct: 158 ---------------FVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLA 202

Query: 181 NYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTD-ETTSKSTMKICPIEDMNQDD 239
            + P + M PDF +L+F ++W KG     P+  +K   + E   +  ++I    ++++ +
Sbjct: 203 LFAPDLFMGPDFVNLNFNDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKE 262

Query: 240 D----QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSF 295
                QP +LWQLQK+ SI+NS +S RAY+ + I+S+ LD  +Q +L E  HL ++LP+F
Sbjct: 263 RELTYQPYILWQLQKVISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTF 322

Query: 296 IKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMF 355
           I+ L+ + +  P  +++ ++ +F+S AF+     + P    L LFHFLP+EYDSNLYKMF
Sbjct: 323 IRSLMNDCKHVPDLDQNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMF 382

Query: 356 NVLLYPDENDSDYESGDES-------------EQGNSLGDISPILSIVFDEAEEGSSGIS 402
           N LLY   ++  Y   +++             E+ +SL +IS IL+++FDE ++ +  I+
Sbjct: 383 NSLLYRSYDEPIYPRTNQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELIT 442

Query: 403 LPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKF 462
            P+GVE+P EF+P++YTK CK KLI  I+  R   + K KE+LND+NS+KSF+GKDIL+F
Sbjct: 443 QPDGVEIPFEFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRF 502

Query: 463 INSSLEYLERDNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIV 522
           +NS+LEYL+RD K   +  +L  +K  ++  KT+KM EY+ +++ LQNEWNI  PE  I+
Sbjct: 503 LNSTLEYLQRDGKEGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSII 562

Query: 523 ETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDT 582
           E  + LGLIG+P+LLVMAVLSPY Y+ R+R  +W   Q S  G DF++ +  S+  V+D 
Sbjct: 563 EQAQDLGLIGDPHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDE 622

Query: 583 IKQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNK 634
           IK  T+ ASETP+MF+YC++D IP +  + + F  N GC  F + D++ L K
Sbjct: 623 IKLNTKSASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLKK 674

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  428 bits (1100), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/645 (38%), Positives = 367/645 (56%), Gaps = 117/645 (18%)

Query: 7   NSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHV 66
           N+  SLIEMGI  ++A  AL + +GNLEAAVN+IFS E            +S  +  N  
Sbjct: 2   NAQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGE------------VSDDQPVNQP 49

Query: 67  EISNKESFQPGDLTEVIANQ-----------------QPLQPEFQNYVNDNSENIDSNCY 109
           + +    F PG L+ V+ NQ                  PL P      +  SE ++    
Sbjct: 50  QSAPMPGFAPGSLSGVMTNQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSEGVE---- 105

Query: 110 VSDKIVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIE 169
                                            I   S  KS + DPTV++PL P+S+ E
Sbjct: 106 ---------------------------------IEIQSPKKSLVTDPTVVIPL-PHSLFE 131

Query: 170 NYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKI 229
           NYFAL+SL +  YLPH++ +P+  DL +   W +GSS            D +TS      
Sbjct: 132 NYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGSS------------DPSTS------ 173

Query: 230 CPIEDMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLN 289
                          + QLQ+L S+VN++ S+R YV AK+F+ +LD   + +LAEA+HL+
Sbjct: 174 --------------FIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHLH 219

Query: 290 EVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDS 349
           EVLPSFI+ L+  LE C  + ED+IR LF+SSA        +   +LLS+  F+P+EY+S
Sbjct: 220 EVLPSFIRSLIHALEECGCYAEDQIRSLFVSSAL------SSECKSLLSVLQFMPEEYES 273

Query: 350 NLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEV 409
           +LY MFN LLYP     + E G+ES  GNSL D++P+L+IVFDE  +  + ++   GV+V
Sbjct: 274 SLYAMFNALLYP-----ELEEGEES--GNSLLDLAPVLTIVFDEM-DADTEVTSNRGVDV 325

Query: 410 PLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEY 469
           PLEF+PQ+YTK  K+ +++ +  +RK AQ +S+++L ++N +KS+QGKD LKFINS+L+Y
Sbjct: 326 PLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINSTLDY 385

Query: 470 LERDNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLG 529
           L+RDN+S  I ++L  +KN +A  KTQ+ NEY++L+QKL  EWN+S+P T+++    + G
Sbjct: 386 LQRDNQSKEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHP-TYLINEAMERG 444

Query: 530 LIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRH 589
           LI EPYLL M VLSP  Y  R R+G+W +++  T      + +C+   +V+ TI+Q T  
Sbjct: 445 LIDEPYLLAMVVLSPGHYLQRSRSGQWKMIR--TDSNMIRISDCAPS-QVQATIRQHTTF 501

Query: 590 ASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNK 634
            S+TPLM +Y +   +  +  + KS ESN G  NF + DQ  LNK
Sbjct: 502 PSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQEELNK 546

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  418 bits (1075), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 261/692 (37%), Positives = 383/692 (55%), Gaps = 72/692 (10%)

Query: 7   NSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHV 66
           +S++SL+EMGIPR++A++AL RANGNLEAAV FIFSNE+P   EN++   ++        
Sbjct: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPP--ENNETSTVANDNDTGQQ 62

Query: 67  EIS-------------------NKESFQPGDLTEVIANQQPLQPEF------QNYVNDNS 101
           E S                     E +   D     ++Q   Q E+      +N  + + 
Sbjct: 63  EPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQHG 122

Query: 102 ENIDSNCYVSDKIVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILP 161
           E+ D +    D I +N           T+S +    PP+Y +V ++  K+R+ DPT+ILP
Sbjct: 123 EDRDDD---GDNIQEN--DESTFSSSSTSSQSPAPSPPNYNVVTYTQLKARVTDPTIILP 177

Query: 162 LPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLK-----S 216
           +P NS++ENY AL  L I   +P   +RPDFKDL++  DW+KG+S S P   LK      
Sbjct: 178 VPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHD 237

Query: 217 VTDETTSK-STMKICPIE----DMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFS 271
             DE  S+ S   I   E    +   DD QP+LLWQLQKL S+VNST+SER+Y+  K+FS
Sbjct: 238 ADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFS 297

Query: 272 VILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPG-FEED------------------ 312
           + L    +  LA  ++L +VLP F K L   +E C   F  D                  
Sbjct: 298 LGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNGN 357

Query: 313 -------EIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPD-EN 364
                  E+  LF+S+A Y  +     + T ++   F P+EY+SNLYKMFN LL+P+ +N
Sbjct: 358 SEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDN 417

Query: 365 DSDYESGDESEQGNSLGD-ISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCK 423
            S     +    G    D I+PI ++VF   +  +  + LP GV++P+EF+PQ+YT  C+
Sbjct: 418 PSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCR 477

Query: 424 NKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDNITEEL 483
           + L++ +  +RK+A   SKE+L   N ++SFQGKDI  F+ S+++YL +D  S+    E 
Sbjct: 478 DALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEE 537

Query: 484 LKIKNDMA-IVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLI-GEPYLLVMAV 541
           +KI   +    K   M +Y+ L+  LQ   N+S+PE  I++  +   LI  EPYLL MAV
Sbjct: 538 MKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAV 597

Query: 542 LSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCR 601
           +SP +Y+IR R GKW LV+ +    +F + EC S   V+  IKQ T HA+E PLMF+YCR
Sbjct: 598 ISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYCR 657

Query: 602 RDVIPEEYEIRKSFESNSGCLNFFKEDQLVLN 633
           +  I ++  I+K  E N GCL F K+DQ+ L+
Sbjct: 658 KSAILDDLIIQKYLEDNKGCLQFSKDDQIALD 689

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  416 bits (1070), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 257/696 (36%), Positives = 389/696 (55%), Gaps = 110/696 (15%)

Query: 9   INSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEA-----------ENSDIEI- 56
           I +LI+MGIP D+A +AL  ANGN+EAAVN+IFSNELP +A           ENSD    
Sbjct: 7   IQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDENSDNNTN 66

Query: 57  --ISYKEKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNS------------- 101
             +      N + IS    FQPGDL + + ++     +  +  + N+             
Sbjct: 67  TNVYNDNTGNTIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHNATINTSFINNTTTT 126

Query: 102 ------ENIDSNCYVSDKIVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRD 155
                  +  +  Y+S+  +D +         ++  +      P  Q    S HK ++ D
Sbjct: 127 TSNSNSNSNPNTNYMSESDID-IDMMTSSTRELSTDIRSQSFKP--QASYTSTHKLQISD 183

Query: 156 PTVILPLPPNSMIENYFAL--YSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNV 213
           PTV+LPL  N ++ENY +L  YSLC+   L  I     F DL + + W+           
Sbjct: 184 PTVLLPLSQNCLLENYLSLFLYSLCMLCPL-QIFETQQFNDLMYNKKWYS---------- 232

Query: 214 LKSVTDETTSKSTMKICPIEDMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVI 273
                             I + N++     L  QLQ+++SI+NS MSERA++  K+FS  
Sbjct: 233 ------------------ISNNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMFSFA 274

Query: 274 LDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPI 333
            ++     L+++DHLNE+   FI+ LV  +   P F     + + +++A    S      
Sbjct: 275 FNKDLNYLLSQSDHLNEIFNPFIESLVTTVLP-PIF-----KDILVTTAINKDSQTNEIF 328

Query: 334 TTLLSLFHFLPDEYDSNLYKMFNVLLYPDE-NDSDYESGDESEQG----------NSLGD 382
            + +S+ +FLP+EY+SNLYKMFN L+YP+E   +D E  DES Q           ++L +
Sbjct: 329 RSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDESLQTDDDDNDDANDSALEE 388

Query: 383 ISPILSIVFDEAEEG-SSGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKS 441
           ISPI +I+F+E +E  SS  +LPEGVE+PL+F+PQ+Y+K   ++LIKHII+KRK+AQ KS
Sbjct: 389 ISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKS 448

Query: 442 KEILNDINSIKSFQGKDILKFINSSLEYLERDNK-----SDNITEELLKIKNDMAIVKTQ 496
           + +LN+INS+KSFQGKDI+K + S+++Y+E+D++     ++N+T  L ++KN     K  
Sbjct: 449 RSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRETKSANNLTNILTEMKN----CKNL 504

Query: 497 KMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKW 556
           KM++Y++L +KL +EWN+S+PE  I+ET ++L LI  PY L M + SP  Y I++    W
Sbjct: 505 KMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDW 564

Query: 557 NLVQCSTTGGD----------------FDVRECSSELEVKDTIKQATRHASETPLMFMYC 600
            L+ C +                    F +R+C+SE+E++D IKQ TR+ SETPLMF+YC
Sbjct: 565 YLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYC 624

Query: 601 RRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMN 636
           +   +P E ++ KSFESN  C  F KEDQL LN+ N
Sbjct: 625 KESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESN 660

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  400 bits (1028), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/643 (37%), Positives = 360/643 (55%), Gaps = 73/643 (11%)

Query: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKA 63
           ++E++I SL++MGI RD+AI+ALS+ N                 + ENS   I S     
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTN----------------GDVENSVNYIFS----- 39

Query: 64  NHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMXXXXX 123
                        G+L +     +PLQP   +      +  D          D+      
Sbjct: 40  -------------GELPQQGPESKPLQPLHADAEQGPQKEEDRE--------DSALLEHT 78

Query: 124 XXXXITNSVTDNLLPPSYQIVKHSDH-------KSRLRDPTVILPLPPNSMIENYFALYS 176
               ++N   +   P  Y+    S         K+   DP V+ P   N++ ENYFAL+ 
Sbjct: 79  EYASVSNGPLEE--PERYRDYTLSTQEEAANEVKNDQEDPLVVKPESSNALFENYFALFC 136

Query: 177 LCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMN 236
           L +    PH  + PDFKDL++  DW +G  F KP+  +K  T+E  +     I P E + 
Sbjct: 137 LAVGLGFPHYFLGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVT-----IVPRETLT 190

Query: 237 QDDD---QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLP 293
             D+   QPELLWQ QK  ++ +S  S R  V A+  +  L+ Q   +L  A+HL++VLP
Sbjct: 191 SQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLP 250

Query: 294 SFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYK 353
           SFI+ L  ++E CPG +   I++LFIS+A+Y P+ +  PI TL+SL HF+P+EYDSN+YK
Sbjct: 251 SFIRSLANDVELCPGSQS--IKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYK 308

Query: 354 MFNVLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEF 413
           MFN LLYP++ D D +     E  NSLG+++ +++IVFDE +E +  I LP GVEVP++F
Sbjct: 309 MFNALLYPNDADDDDDV---EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKF 365

Query: 414 FPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERD 473
           +PQ+YT+D K  LIK +     + Q ++  IL  +N +KSFQGK I  F+NS+L+++ RD
Sbjct: 366 YPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARD 425

Query: 474 NKS-------DNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGR 526
           + +       +++ + L  IK D++  KT  M EY+ ++ KL N+WN+S+PE  I+E G 
Sbjct: 426 SSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGE 485

Query: 527 KLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQA 586
           KLGLI EPY+L  AV+SP++Y+IR+R  +W  V         +V +  +E  V +TI+  
Sbjct: 486 KLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAET-VTNTIRLN 544

Query: 587 TRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629
           TR ASETPLMF Y +   I     + ++ E N+G  +F ++DQ
Sbjct: 545 TRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQ 587

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  392 bits (1007), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/501 (40%), Positives = 309/501 (61%), Gaps = 23/501 (4%)

Query: 150 KSRLRDPTVILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSK 209
           K+R  DP V+ P   N++ ENYFAL+ L +    PH  + PDF+DL++ +DW+KG  F K
Sbjct: 104 KNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQ-FLK 162

Query: 210 PKNVLKSVTDETTSKSTMKICPIEDMNQDDD---QPELLWQLQKLSSIVNSTMSERAYVC 266
           P   +K   ++  S     I P E +   D+   QPELLWQ QK  ++ NS    R YV 
Sbjct: 163 PAYRVKFENNDDVS-----IVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVT 217

Query: 267 AKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTP 326
           A+  + +L+ Q   +L  +DHL+E LPSFIK L  ++E CPG     +++LFIS+A+Y P
Sbjct: 218 ARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPG--AHSVKELFISTAYYKP 275

Query: 327 SDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPI 386
             +  PI TL+SL HF+P+EYD+N+YKMFN LLYPD N    E  +  +  NSLG+++P+
Sbjct: 276 VSEPEPIETLVSLLHFMPEEYDTNIYKMFNALLYPDSN----EDAEMDDIQNSLGNLAPM 331

Query: 387 LSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILN 446
           ++IVFDE +E +   +LP GV+VPLEF+PQ+YT++ KN LIK +     D+Q +++ IL 
Sbjct: 332 ITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILR 391

Query: 447 DINSIKSFQGKDILKFINSSLEYLERD-------NKSDNITEELLKIKNDMAIVKTQKMN 499
           ++N +KSFQGK I  F+NS+L+++ +D       +    + + L ++K  +   KT+KM 
Sbjct: 392 NLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEKMA 451

Query: 500 EYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLV 559
           +Y+ ++ +L NE N+S+PE  I++  + LGLI EPYLL  AV+S  +Y+IR+  G+W  V
Sbjct: 452 QYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNGQWFHV 511

Query: 560 QCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNS 619
              +     DV +  +   V   I+  TR ASE+PLMF Y +   I  E +++++   N 
Sbjct: 512 VGRSNSEHMDVTKTDAST-VSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNK 570

Query: 620 GCLNFFKEDQLVLNKMNNSDE 640
           G   F ++DQ  +N ++  DE
Sbjct: 571 GAKLFAEQDQKHINTLSAPDE 591

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  391 bits (1004), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 243/694 (35%), Positives = 382/694 (55%), Gaps = 92/694 (13%)

Query: 1   MGELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYK 60
           MGE  ++++ SL EMGIP D+A+DAL RANGNL AAVN+IFSN++PA             
Sbjct: 1   MGE-EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPA------------- 46

Query: 61  EKANHVEISN-KES--FQPGDLTEVIANQQPLQPEFQNYV--------NDNSENIDSNCY 109
               HVE+   +ES   +PGDL +V+   Q   P+    V        + N E+   N Y
Sbjct: 47  --GEHVELPQPRESSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIY 104

Query: 110 VSDKIVDNMXXXXXXXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILP------LP 163
           + +   DN+            SV  N + P+  I  +SD  S   D T   P      +P
Sbjct: 105 LDED--DNIE---------VGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVP 153

Query: 164 --------PNS--------MIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSF 207
                   P+S           NY  L++  +  Y P   ++ DFK+L++  +W+ G + 
Sbjct: 154 AAEEGAERPDSGAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAI 213

Query: 208 SKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD-QPELLWQLQKLSSIVNSTMSERAYVC 266
            +P   L  V+D      + +I P E++  D   QPE+LWQLQ++ S+ +S +SER+YV 
Sbjct: 214 QQP---LCIVSDVGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVS 270

Query: 267 AKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEED-EIRKLFISSAFYT 325
           AK+F+ + D + +  + ++DHL E LPSFIK ++ + E CP    + +++ +F+SSA   
Sbjct: 271 AKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQD 330

Query: 326 PSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDEN-------DSDYESGDESEQGN 378
                 P  T L LFHF P+EY++NLYKMFN LLYP+++       D+D  +  + +   
Sbjct: 331 AEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEG 390

Query: 379 SLGDISPILSIVFDEAEEG--SSG-----ISLPEGVEVPLEFFPQIYTKDCKNKLIKHII 431
           SL +++P+L+I+F+EA+ G  S+G     I+ P+GVEVP  F+PQ+YT++ K +++K I+
Sbjct: 391 SLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPIL 450

Query: 432 AKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYL-----------ERDNKSDNIT 480
            +RK A+ + ++ L  +N +KS++GK    F+    E L              N+   + 
Sbjct: 451 RQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVI 510

Query: 481 EELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMA 540
           +++  IK  +   + +   +Y DL+ KLQNEWNISNPE  ++   ++LGL+ +P+LL M 
Sbjct: 511 QKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMV 570

Query: 541 VLSPYSYYIRERTGK--WNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFM 598
           VLSPY Y +R+ +G   W LVQ ++ G D  + +  +E +V+  I+  T+ A++ PLMF+
Sbjct: 571 VLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFI 630

Query: 599 YCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVL 632
           YCR D    + E   + E N GC  F K DQL L
Sbjct: 631 YCREDFFVSQEETWSAIEKNMGCSEFNKADQLYL 664

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  366 bits (940), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 245/653 (37%), Positives = 366/653 (56%), Gaps = 81/653 (12%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANH 65
           E ++ SL+EMGI RD+A  AL   NG++EAA+N+IF+   P E +N  +      ++   
Sbjct: 4   EGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNT--PNEIDNDAMA----GQQMGS 57

Query: 66  VEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDN--SENIDSNCYVSDKIVDNMXXXXX 123
           V +  +  F   D    I    P  P+ Q+Y       EN+  N + SD   ++      
Sbjct: 58  VPVGTQGIFD--DSAFKIQENNP--PQSQSYSEQQLVQENLPDNTFRSDSDTNSDSDSSS 113

Query: 124 XXXXITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLP--PNSMIENYFALYSLCITN 181
                  +  D+L+P  +        K+ +  PTV++P P  PN +   Y AL++L I+ 
Sbjct: 114 SLEQSQYTSIDDLIPQQF--------KNTMDYPTVVIPAPAVPNHIY--YCALFALFISI 163

Query: 182 YLPHIIMRPDFKD--LSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQD- 238
           +LPH  ++ D  D  L F+ DWF                               D++++ 
Sbjct: 164 HLPHYFVKADHDDMPLLFSPDWFN------------------------------DIDREP 193

Query: 239 DDQPELLW--QLQKLSSIVNST-MSERAYVCAKIFSVILDQQSQIRLAEAD-------HL 288
           +D+P L+   QL KL ++ NS   S RA+V +K+F V  D QS I+  E         HL
Sbjct: 194 EDEPLLVLRDQLHKLIAVQNSNDHSARAFVTSKMFDV--DLQSVIQSNEPMLTNPNYFHL 251

Query: 289 NEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYD 348
            ++LPSFIK  + NL           + LFISSA     +  +   +LLSLFHFLP+EY+
Sbjct: 252 YQILPSFIK-TIANLSYTE-------KNLFISSAIQGGEEASSSKESLLSLFHFLPEEYE 303

Query: 349 SNLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVE 408
           SNLYKMFNVLLYPD++    E  DE  + NSL +++P+++I+F+EAE       +  GVE
Sbjct: 304 SNLYKMFNVLLYPDDDHDIGEDEDEVSE-NSLKELAPVMTIIFNEAENIDENAPVTNGVE 362

Query: 409 VPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLE 468
           VPL+F+PQ+YTK CK++LI H+++KRKD + + K+IL DI ++KS+QGKDIL FINSSL+
Sbjct: 363 VPLKFYPQLYTKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLD 422

Query: 469 YLERDNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKL 528
           YL +D     I EEL K+K+++   KT+KMN Y+ +++K+  EWNI NPE  IVET  KL
Sbjct: 423 YLTKDKDDSGIAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKL 482

Query: 529 GLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQ---CSTTGGDFDVRECSSELEVKDTIKQ 585
           GLI EPY L +AV+SP+ Y++R R  +W  V+    +T      V +C    EV   +K 
Sbjct: 483 GLIDEPYFLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKN 542

Query: 586 ATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNNS 638
           +T   + TPLMF+Y +   + ++ E+++    N   L+FFK+DQ+ L    N+
Sbjct: 543 STTVPNSTPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFENA 595

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  230 bits (587), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 155/499 (31%), Positives = 262/499 (52%), Gaps = 36/499 (7%)

Query: 154 RDPTV---ILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSF-SK 209
           +DP+    ILP   ++++E+YF L++LC+   +P   +  DFK+L +   WFKG    S 
Sbjct: 49  KDPSQLVGILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGELVQSD 108

Query: 210 PKNVLKSVTDETTSKSTMKICPIEDMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKI 269
            + V ++       K  +      +M     QPEL+ ++Q L  I N   S R +V +++
Sbjct: 109 YRLVHRNAGPLLIHKRELTGSEYLEM-----QPELIPRMQLLIGIANDPESMRRFVASEL 163

Query: 270 FSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDD 329
            +   D      L+E DHL+EV P FIK L  +++ C   ++    KLF+S A + P+  
Sbjct: 164 INKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLCLK-DDKSTSKLFLSKALHRPNVL 222

Query: 330 QAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPILSI 389
           +    T LS+ +F P+ Y   LY+MFN +L P++      SG   E  N+   ++P+ +I
Sbjct: 223 EPFQPTSLSVLNFSPENYAYTLYEMFNPMLLPED------SGRGYEIENAFDFLAPVFTI 276

Query: 390 VFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDIN 449
           +FD+ ++ +  ++L  GV++P+EF+PQ+YTK+   K++  ++ +    +  +K  ++ ++
Sbjct: 277 IFDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMS 336

Query: 450 SIKSFQGKDILKFINSSLEYLER-----DNKSDNITEELLKIKNDMAIVKTQKMNEYRDL 504
           S++SFQGK I  F+NSS+ YLE      ++KS  + + L KIK  ++  K + M +Y + 
Sbjct: 337 SLQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTE- 395

Query: 505 AQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRE-----------RT 553
            Q+  +  +   P   I++  +++G+I EPYLL + V SP  Y I              T
Sbjct: 396 TQRQIDLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMET 455

Query: 554 GKWNLVQCSTT---GGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYE 610
           G  NL         G     +E  +  E +D  K  TRHASETP++F+Y ++D I    +
Sbjct: 456 GNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQD 515

Query: 611 IRKSFESNSGCLNFFKEDQ 629
           I  S   N    NF KE+ 
Sbjct: 516 ILASISENETLTNFLKEEH 534

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (68%), Gaps = 5/51 (9%)

Query: 3   ELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSN-----ELPAE 48
           ++NE S+NS+I MG+ ++++  AL   NG++ A++ ++F+N     ELP E
Sbjct: 639 QINEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEE 689

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           E +I  L+++G PRD  + AL + NGN E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           E +I  L+++G PRD  + AL + NGN E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 2   GELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           G   E +I  L+++G PRD  + AL +  GN E A + +F
Sbjct: 388 GTFPEQTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           EN+I  L+++G PR+  I AL+R  GN E A   +F
Sbjct: 426 ENTIKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           E +I  L+++G PRD  + AL + NGN + A + +F
Sbjct: 392 EKTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 3   ELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSD 53
           E+N  ++ S++ MG+  D+   AL    GN+ A+V ++F+N     A+N+D
Sbjct: 628 EVNPQALESMVSMGLNPDLCHKALVLHKGNVSASVEWVFNN-----ADNTD 673

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 1/40 (2%)

Query: 5   NENSINSLIEMGIPRDIAIDAL-SRANGNLEAAVNFIFSN 43
           NE+S+N LIEMG  ++ A  +L +  NG  E A++++F +
Sbjct: 572 NESSVNQLIEMGFTKNAATRSLFNTGNGQAETAMDWLFQH 611

>NDAI0C06630 Chr3 (1527445..1528746) [1302 bp, 433 aa] {ON} Anc_8.2
           YFL048C
          Length = 433

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 81/171 (47%), Gaps = 25/171 (14%)

Query: 412 EFFPQIY-TKDCKNKLIKHIIAKRKDAQFKSKEIL------------NDINSIKSFQG-- 456
           +F  QI  T+  K KLI+  +  + D +  + EIL            NDINS++S     
Sbjct: 265 KFVTQIVDTETGKTKLIEKEVQDKLDDKVTNYEILKKLDRVEGKILANDINSLESKLDDI 324

Query: 457 ----KDILKFIN---SSLEYLERDNKSDNITEELLKIK-NDMAIVKTQKMNEYRDLAQKL 508
               ++++K+IN   S +E    +N   +   + LK +  D+     +KM + ++  ++ 
Sbjct: 325 IKVQENLIKYINHLSSIVETSNGNNGGSSKGVDALKAEFKDLIGASFEKMLDDQEKIREQ 384

Query: 509 QNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLV 559
                +S P  HI +   KL +   P +++MA+++ Y+  IR+   K  L+
Sbjct: 385 TKRTTVSGP--HIDDIATKLAVWISPLIIIMAIMAYYTVQIRKDISKTKLL 433

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 35/53 (66%), Gaps = 5/53 (9%)

Query: 2   GELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSN-----ELPAEA 49
            ++++ S++++I+MG+   ++I AL    G++ A++ ++F+N     ELP+E 
Sbjct: 663 AKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSET 715

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           EN+I  L+++G  R+  I AL    GN + A +F+F
Sbjct: 380 ENTIKQLMDLGFSRNEVIKALDATGGNADFAASFLF 415

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 8   SINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSN 43
           +I  L  MG   D A+ AL + N +L+AA NF+  N
Sbjct: 841 AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLLDN 876

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
           YEL037C
          Length = 214

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIE 55
           N+  I  L+E+G  RD  IDAL   N N E A+      EL    E+  IE
Sbjct: 84  NDKKIRRLVELGFQRDSVIDALEAHNYNTEDAL-----TELTTVTESHTIE 129

>KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.185
           YER143W
          Length = 406

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIF 41
           +E +IN L+++G  R   I AL    GN E A +++F
Sbjct: 369 SEAAINQLMDLGFTRTEVIKALDMTGGNAELAASYLF 405

>NCAS0A00530 Chr1 complement(87374..88489) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 308 GFEEDEIRKLFI---------SSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVL 358
           G   D IR L +         SSA Y P+         LSL +FL D    NL+  +N L
Sbjct: 135 GLSTDTIRNLILQEIGEPGSTSSATYKPTSSTLAGFKNLSLHNFLYDNVQENLHDPWNEL 194

Query: 359 LYP 361
            YP
Sbjct: 195 KYP 197

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 3   ELNENSINSLIEMGIPRDIAIDALSR-ANGNLEAAVNFIFSNELPAEAENSDI--EIISY 59
           E+NE  +N L+EMG   +  + AL    N + E A+N++F        E++D+  E I  
Sbjct: 589 EVNETFVNQLMEMGFTENACVRALYHTGNKDPELAMNWLF-----GHIEDADVNAEFIPP 643

Query: 60  KEKANHV 66
           K+  N V
Sbjct: 644 KKAKNDV 650

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%)

Query: 3   ELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSN 43
           E++E S+ S++ MG+  ++   AL   NG++  +V +IF+N
Sbjct: 649 EVDETSLTSILSMGLNPNLCRKALILNNGDVNRSVEWIFNN 689

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 3   ELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSN-----ELPAE 48
           +++ NS+NS++ MG+   +   AL   +G++  +V ++F+N     ELP E
Sbjct: 651 DIDPNSLNSMLSMGLDPKLCRKALILNSGDVNRSVEWVFNNMDDDGELPKE 701

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,785,228
Number of extensions: 3537169
Number of successful extensions: 11913
Number of sequences better than 10.0: 130
Number of HSP's gapped: 12366
Number of HSP's successfully gapped: 137
Length of query: 642
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 526
Effective length of database: 40,180,143
Effective search space: 21134755218
Effective search space used: 21134755218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)