Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.448.272ON64364331770.0
TDEL0F039908.272ON63164618760.0
ZYRO0C01430g8.272ON59059717780.0
SAKL0H16808g8.272ON65765117680.0
TPHA0A017508.272ON63660217610.0
KLLA0A04631g8.272ON57958715800.0
KLTH0G13464g8.272ON59360215600.0
Kwal_56.237548.272ON58959915540.0
AGR076C8.272ON68667715390.0
TBLA0F030408.272ON90659114680.0
Kwal_26.6669singletonON59052712951e-171
Ecym_42988.272ON67867310961e-140
SAKL0E04246gna 1ON5655548112e-99
SAKL0C02178gsingletonON5655507902e-96
KLLA0F17776gna 1ON5535287874e-96
Smik_4.3638.272ON7655004456e-46
Kwal_26.6697singletonON5775404352e-45
SAKL0A07480gsingletonON5735414211e-43
KLTH0E16720gsingletonON5745394016e-41
Suva_2.2798.272ON7756344068e-41
YDR119W (VBA4)8.272ON7685334032e-40
TDEL0C00120singletonON5695223883e-39
Skud_2.423na 2ON5605323831e-38
KLTH0H05456gna 3ON5684633761e-37
Skud_4.3798.272ON7595003783e-37
ZYRO0A00330gsingletonON5765223513e-34
TDEL0A024902.473ON5544703485e-34
Suva_4.553na 2ON5625163486e-34
ZYRO0G03234g2.473ON5625173461e-33
Skud_13.2442.473ON5625543352e-32
SAKL0E02992g2.473ON5705163327e-32
Kwal_14.1585na 3ON5705633301e-31
CAGL0J01375g2.473ON5645103291e-31
KNAG0E025602.473ON5784723292e-31
Smik_2.434na 2ON4744583182e-30
KLTH0D05434g2.473ON5764813185e-30
TPHA0G031502.473ON6005623177e-30
NCAS0A078102.473ON5684713158e-30
Smik_13.2722.473ON5615753141e-29
Suva_13.2652.473ON5615503141e-29
Kpol_467.242.473ON3703392972e-28
NDAI0H022002.473ON5714643033e-28
Kwal_26.77552.473ON5594993033e-28
YBR293W (VBA2)na 2ON4744812978e-28
YMR088C (VBA1)2.473ON5625562999e-28
ZYRO0G21868gna 3ON6205692921e-26
KLLA0F13684g2.473ON5715472911e-26
KLTH0B00132gsingletonON5684582776e-25
ABL040W2.473ON5675562661e-23
NDAI0J012808.272ON6947172643e-23
KLTH0B10142gsingletonON5684602553e-22
Ecym_73992.473ON5633352393e-20
Kwal_14.728singletonON5684742295e-19
TDEL0G03260singletonON6125622233e-18
CAGL0B02079gna 4ON6245312073e-16
Skud_7.560na 4ON6424682055e-16
YPR198W (SGE1)singletonON5435282011e-15
Smik_11.368singletonON5805332011e-15
Skud_16.503singletonON5435571974e-15
Smik_16.81na 4ON6251871966e-15
SAKL0A00726gsingletonON5984851957e-15
YKR105C (VBA5)singletonON5825311958e-15
ZYRO0G07414gsingletonON7075271894e-14
KLTH0D16962gsingletonON5713401877e-14
KLTH0C10120gsingletonON6511621842e-13
KNAG0K01020singletonON5995201832e-13
KLLA0E09879gsingletonON6305391832e-13
KLTH0C10142gsingletonON5734691823e-13
YKR106W (GEX2)singletonON6154701771e-12
YCL073C (GEX1)singletonON6154701771e-12
Skud_18.3singletonON5905341752e-12
SAKL0B12716gsingletonON6325591733e-12
NCAS0C03460na 4ON6305521716e-12
SAKL0C05588gsingletonON6775591717e-12
KLTH0D18150gsingletonON6074651709e-12
Skud_18.6singletonON6105531662e-11
KNAG0J02980singletonON6364561662e-11
Smik_6.22singletonON6364981653e-11
YHL040C (ARN1)na 5ON6274591653e-11
Kwal_26.9616singletonON5625621601e-10
SAKL0F00198gsingletonON5375071591e-10
SAKL0A08228gsingletonON5691501582e-10
Suva_8.12na 5ON6334891573e-10
KLLA0D19941gsingletonON6114701564e-10
KLTH0B00594gsingletonON6184741555e-10
Smik_17.11singletonON5444651547e-10
CAGL0E04092gna 5ON6455531539e-10
SAKL0F00792gsingletonON6174661531e-09
Skud_6.14singletonON6364971521e-09
YGR224W (AZR1)na 4ON6131501511e-09
Kwal_56.22298singletonON6104641502e-09
TBLA0C01040singletonON6695381502e-09
Skud_8.3na 5ON6314751502e-09
Smik_8.1na 5ON6274581493e-09
KLTH0B00110gsingletonON6274461474e-09
Kwal_14.722singletonON6115551466e-09
YHL047C (ARN2)singletonON6204781431e-08
KAFR0I01560singletonON6325391432e-08
TDEL0H01600singletonON6044791412e-08
TDEL0H00130singletonON6214921394e-08
TBLA0F00470singletonON7322961394e-08
KAFR0B054508.272ON625991342e-07
YOL158C (ENB1)singletonON6064751333e-07
Suva_10.9singletonON6374881323e-07
TPHA0B00180singletonON6335571305e-07
SAKL0G06600gsingletonON6294491306e-07
Suva_26.1singletonON5344931296e-07
SAKL0G03300gsingletonON6162931297e-07
Smik_11.370singletonON4403391279e-07
KLLA0C19272gsingletonON6232931261e-06
KLLA0C00220gsingletonON6244871262e-06
SAKL0E00132gsingletonON6204811225e-06
NDAI0H00140na 5ON6325571216e-06
KLTH0D00110gsingletonON6204811208e-06
KLTH0B10450gsingletonON6204811208e-06
SAKL0F00110gsingletonON6204811209e-06
Smik_21.4singletonON6054841191e-05
KLTH0D00506gsingletonON6164911181e-05
NCAS0I00110na 5ON4523141135e-05
Kpol_541.168.843ON5282401135e-05
Kwal_23.5241na 6ON5913151127e-05
Kwal_34.15711na 5ON6184811128e-05
KNAG0H031808.272ON677881119e-05
KLLA0D19945gsingletonON6444651092e-04
KLLA0A10439gsingletonON6344721082e-04
Kwal_23.2794singletonON6194621073e-04
TDEL0G05000singletonON1861401033e-04
TDEL0G04740singletonON6015811064e-04
KLLA0C18931gna 7ON553921055e-04
NCAS0A11500singletonON6145751055e-04
KNAG0C046205.469ON5461821055e-04
CAGL0I07447g3.84ON5701051020.001
NDAI0I02650na 8ON6385571010.002
KLTH0G00198gna 5ON4582451000.002
NDAI0A02050singletonON6174891000.002
Skud_5.24na 8ON6274631000.002
Suva_13.4678.843ON54392990.002
KLTH0G11154gna 9ON572213980.003
NCAS0B037808.272ON58979970.004
KAFR0B039408.843ON54752970.004
Kwal_26.7984na 10ON612102970.005
TBLA0A079705.469ON500143960.005
SAKL0D01386g8.843ON521247960.005
TDEL0B005508.843ON537257960.006
TDEL0H04480na 9ON570126960.006
TPHA0A006203.84ON634150960.007
KAFR0C02660singletonON591310950.009
TBLA0D03280singletonON580111940.009
Suva_5.2na 8ON627464940.010
TPHA0K02330singletonON631302940.010
Kpol_513.33singletonON626294940.011
TDEL0D06610singletonON497104930.011
Smik_5.22na 8ON628460930.016
Skud_13.258.843ON537150920.018
KLTH0C10560gna 11ON515424920.018
Kpol_1053.243.84ON620104920.018
KAFR0G00160singletonON63644920.020
KLTH0D06710gna 10ON61189910.021
NCAS0B002908.843ON542241910.025
KLLA0E09021gna 9ON566126910.026
Suva_13.278.843ON55348900.028
Kwal_27.102458.843ON515242890.034
YEL065W (SIT1)na 8ON628466890.044
Suva_10.11singletonON540182880.050
TBLA0B083103.84ON63842880.051
Smik_11.369singletonON168112840.054
KLTH0A07964gsingletonON619294880.055
KNAG0K006303.84ON618180880.058
Kpol_358.4na 8ON61781880.060
TDEL0A033305.469ON549100870.065
CAGL0B02343g8.843ON53748870.066
Smik_15.560na 11ON51650860.078
NCAS0D02350na 8ON634298870.080
YOR378Wna 11ON51550860.083
Suva_4.2singletonON570182860.090
Skud_15.545na 11ON51650860.090
SAKL0C12122gna 6ON61182860.10
TPHA0J027405.469ON57494850.11
Ecym_7258na 10ON638102850.12
SAKL0C11066gsingletonON58042850.12
Smik_6.24na 12ON54493850.13
Kpol_543.55.469ON566121850.13
ABL210CsingletonON478105850.13
Skud_6.16na 12ON54984850.13
AFR343C3.84ON571104840.14
SAKL0C06116gsingletonON18540810.14
TDEL0D054003.84ON58542840.15
KLTH0A06336g6.323ON50971840.15
TPHA0M00120singletonON619544840.16
KAFR0B03930singletonON55586840.16
NDAI0A071103.84ON60292830.19
TDEL0B00140singletonON632558830.19
TPHA0O009501.432ON559144830.21
SAKL0E06864gna 9ON573182830.21
AAR192Cna 13ON500105830.22
SAKL0F00440gsingletonON54456830.23
KLTH0C03806g8.843ON52548820.24
AFR333WsingletonON500105820.24
Smik_13.188.843ON54548820.24
YML116W (ATR1)8.843ON54248820.24
KNAG0J002608.843ON55060820.25
KAFR0F02800singletonON551102820.27
KAFR0E02030singletonON548102820.28
KLLA0C12309g3.84ON56991820.28
TBLA0C01160singletonON60079820.30
KLTH0A01562gna 6ON61580820.30
NCAS0I025203.84ON58742820.31
Suva_8.435na 11ON51550810.31
Kpol_416.6singletonON597340810.32
KAFR0F04080singletonON549102810.34
TBLA0D032708.843ON55050810.34
YOL103W (ITR2)3.84ON60942810.34
TPHA0B039001.432ON55475810.34
Kpol_416.5singletonON60781810.34
Kwal_23.6547na 11ON51150810.38
Smik_15.543.84ON61142810.38
Skud_15.513.84ON58742810.41
KAFR0J009302.242ON566118800.42
ZYRO0D11088g5.469ON538182800.42
TPHA0C047908.843ON55679800.43
NCAS0C047603.84ON60792800.44
Smik_4.7743.84ON584103800.45
KAFR0A028408.843ON52048800.45
YMR279C8.843ON54060800.48
CAGL0L02519gna 11ON52991800.48
Ecym_23175.469ON557125800.52
Suva_15.623.84ON60942800.52
KNAG0B007303.503ON62285790.56
KNAG0G034308.843ON54248790.59
KLTH0F15136g5.469ON53739790.61
TPHA0G03780singletonON61281790.62
Kpol_281.2na 14ON55978790.66
ZYRO0C00374gna 9ON564185790.69
NCAS0C004008.843ON51784790.70
NDAI0D010202.242ON59279790.71
Ecym_6024na 13ON489105780.73
TDEL0B019008.446ON687180790.73
KLTH0G09504gna 15ON624226780.81
KLTH0C09372g3.84ON60878780.92
NCAS0A02540singletonON53967780.93
NDAI0E002808.843ON54954771.0
NDAI0I027703.503ON62670771.1
ZYRO0A09878g8.446ON682180771.1
NDAI0K004008.843ON55348761.2
Kwal_23.62336.323ON34271761.3
YCL069W (VBA3)singletonON458439761.3
ZYRO0D00286gsingletonON50892761.3
SAKL0G03432g5.469ON53795761.5
Kpol_495.213.109ON108565761.6
Ecym_13451.432ON55571761.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.44
         (643 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...  1228   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   727   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   689   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   685   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   682   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   613   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   605   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   603   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   597   0.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   570   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   503   e-171
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   426   e-140
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   317   2e-99
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   308   2e-96
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   307   4e-96
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   176   6e-46
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   172   2e-45
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   166   1e-43
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   159   6e-41
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   160   8e-41
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   159   2e-40
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        154   3e-39
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   152   1e-38
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   149   1e-37
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   150   3e-37
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   139   3e-34
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   138   5e-34
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   138   6e-34
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   137   1e-33
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   133   2e-32
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   132   7e-32
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   131   1e-31
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   131   1e-31
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   131   2e-31
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   127   2e-30
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   127   5e-30
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   126   7e-30
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   125   8e-30
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   125   1e-29
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   125   1e-29
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   119   2e-28
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   121   3e-28
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   121   3e-28
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   119   8e-28
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   119   9e-28
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   117   1e-26
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   116   1e-26
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...   111   6e-25
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   107   1e-23
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....   106   3e-23
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...   102   3e-22
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    97   3e-20
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    93   5e-19
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               91   3e-18
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    84   3e-16
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    84   5e-16
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    82   1e-15
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    82   1e-15
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    80   4e-15
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    80   6e-15
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    80   7e-15
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    80   8e-15
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    77   4e-14
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    77   7e-14
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    75   2e-13
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    75   2e-13
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    75   2e-13
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    75   3e-13
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    73   1e-12
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    73   1e-12
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    72   2e-12
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    71   3e-12
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    70   6e-12
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    70   7e-12
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    70   9e-12
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    69   2e-11
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              69   2e-11
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    68   3e-11
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    68   3e-11
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    66   1e-10
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    66   1e-10
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    65   2e-10
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    65   3e-10
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    65   4e-10
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    64   5e-10
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    64   7e-10
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    64   9e-10
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    64   1e-09
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    63   1e-09
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    63   1e-09
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    62   2e-09
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               62   2e-09
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    62   2e-09
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    62   3e-09
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    61   4e-09
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    61   6e-09
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    60   1e-08
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      60   2e-08
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    59   2e-08
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       58   4e-08
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               58   4e-08
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    56   2e-07
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    56   3e-07
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    55   3e-07
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       55   5e-07
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    55   6e-07
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        54   6e-07
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    54   7e-07
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    54   9e-07
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    53   1e-06
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    53   2e-06
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    52   5e-06
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       51   6e-06
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    51   8e-06
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    51   8e-06
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    51   9e-06
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     50   1e-05
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    50   1e-05
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         48   5e-05
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    48   5e-05
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    48   7e-05
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    48   8e-05
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    47   9e-05
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    47   2e-04
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    46   2e-04
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    46   3e-04
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                44   3e-04
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    45   4e-04
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    45   5e-04
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    45   5e-04
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    45   5e-04
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    44   0.001
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               44   0.002
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    43   0.002
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    43   0.002
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    43   0.002
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    43   0.002
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    42   0.003
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    42   0.004
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    42   0.004
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    42   0.005
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    42   0.005
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    42   0.005
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    42   0.006
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    42   0.006
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    42   0.007
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               41   0.009
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    41   0.009
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       41   0.010
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              41   0.010
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    41   0.011
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    40   0.011
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    40   0.016
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    40   0.018
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    40   0.018
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    40   0.018
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 40   0.020
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    40   0.021
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       40   0.025
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    40   0.026
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    39   0.028
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    39   0.034
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    39   0.044
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    39   0.050
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    39   0.051
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    37   0.054
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    39   0.055
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    39   0.058
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    39   0.060
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    38   0.065
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...    38   0.066
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    38   0.078
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               38   0.080
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    38   0.083
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       38   0.090
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    38   0.090
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    38   0.10 
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...    37   0.11 
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    37   0.12 
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    37   0.12 
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    37   0.13 
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    37   0.13 
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    37   0.13 
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    37   0.13 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    37   0.14 
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    36   0.14 
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    37   0.15 
KLTH0A06336g Chr1 (528991..530520) [1530 bp, 509 aa] {ON} highly...    37   0.15 
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                37   0.16 
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    37   0.16 
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    37   0.19 
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                 37   0.19 
TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {...    37   0.21 
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    37   0.21 
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    37   0.22 
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    37   0.23 
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    36   0.24 
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    36   0.24 
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    36   0.24 
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    36   0.24 
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    36   0.25 
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               36   0.27 
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               36   0.28 
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    36   0.28 
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    36   0.30 
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    36   0.30 
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    36   0.31 
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    36   0.31 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    36   0.32 
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    36   0.34 
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    36   0.34 
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    36   0.34 
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     36   0.34 
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    36   0.34 
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    36   0.38 
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    36   0.38 
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    36   0.41 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    35   0.42 
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    35   0.42 
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    35   0.43 
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      35   0.44 
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    35   0.45 
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    35   0.45 
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    35   0.48 
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    35   0.48 
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...    35   0.52 
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    35   0.52 
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    35   0.56 
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    35   0.59 
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    35   0.61 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    35   0.62 
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...    35   0.66 
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    35   0.69 
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       35   0.70 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    35   0.71 
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    35   0.73 
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    35   0.73 
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    35   0.81 
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    35   0.92 
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    35   0.93 
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       34   1.0  
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     34   1.1  
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    34   1.1  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                34   1.2  
Kwal_23.6233 s23 (1500534..1501562) [1029 bp, 342 aa] {ON} YCR05...    34   1.3  
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    34   1.3  
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    34   1.3  
SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {...    34   1.5  
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    34   1.6  
Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar t...    34   1.6  
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    34   1.6  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    33   1.7  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    33   1.7  
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...    34   1.7  
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               33   2.0  
ZYRO0D01672g Chr4 (134493..135791) [1299 bp, 432 aa] {ON} simila...    33   2.4  
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    33   2.5  
KLLA0E03037g Chr5 complement(278965..280587) [1623 bp, 540 aa] {...    33   2.7  
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    33   3.1  
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    33   3.2  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    32   4.2  
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    32   4.8  
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    32   5.5  
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...    32   5.7  
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    32   5.9  
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                   32   5.9  
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    32   6.0  
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    32   6.3  
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...    32   6.5  
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    32   6.5  
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    32   6.5  
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    32   6.6  
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469     32   6.6  
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    32   6.7  
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    32   6.9  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    32   7.6  
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    32   8.1  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    31   8.5  
SAKL0F10362g Chr6 complement(796504..798711) [2208 bp, 735 aa] {...    32   8.6  
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    31   8.8  
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    31   8.9  
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    32   9.0  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    31   9.3  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    31   9.5  
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    31   9.7  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    31   9.8  

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 1228 bits (3177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/643 (93%), Positives = 604/643 (93%)

Query: 1   MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS 60
           MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS
Sbjct: 1   MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS 60

Query: 61  VLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYGAIESRRISSKGTELSTARL 120
           VLLPIRDELLQDPSTELPGFIAA           TRSGHYGAIESRRISSKGTELSTARL
Sbjct: 61  VLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGHYGAIESRRISSKGTELSTARL 120

Query: 121 KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS 180
           KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS
Sbjct: 121 KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS 180

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPL 240
           DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIA                DIVPL
Sbjct: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPL 240

Query: 241 RNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLP 300
           RNRALYQGICNFYF            WFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLP
Sbjct: 241 RNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLP 300

Query: 301 KESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIG 360
           KESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIG
Sbjct: 301 KESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIG 360

Query: 361 LCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYF 420
           LCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYF
Sbjct: 361 LCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYF 420

Query: 421 AGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWI 480
           AGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWI
Sbjct: 421 AGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWI 480

Query: 481 QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVS 540
           QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVS
Sbjct: 481 QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVS 540

Query: 541 IGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDC 600
           IGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDC
Sbjct: 541 IGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDC 600

Query: 601 YHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENEE 643
           YHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENEE
Sbjct: 601 YHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENEE 643

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/646 (56%), Positives = 462/646 (71%), Gaps = 22/646 (3%)

Query: 1   MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS 60
           MGKKDKQR KLR FT+ K  Q+Q+ ++            +   +T    +  + E  E S
Sbjct: 1   MGKKDKQRNKLREFTRQK--QLQQAKK-----------NDMLEETRPLVAPSSAEPIEAS 47

Query: 61  VLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRS---GHYGAIESRRISSKGTELST 117
           +LLPI+ E+LQDPST+LPGF+A              S    H G  +S R  S   E+S 
Sbjct: 48  LLLPIKPEILQDPSTDLPGFVAEEIGQQEEVANGYGSITDPHDGDNKSERPVSTAEEISG 107

Query: 118 ARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYG 177
           ARL++IMLSMYLGIFLAA+DNTIVST  AH+ASEFN+L ++SW+AT+YLLSSATFQP+YG
Sbjct: 108 ARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYG 167

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           K+SDIFGRK +L+F N+ F +G L+CGLS SF WLV  RF+A                D+
Sbjct: 168 KVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDL 227

Query: 238 VPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFL 297
           VPLR RA+YQGICN ++            WFSD   GWRM+FLIQ+P++  S ++IIL L
Sbjct: 228 VPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLLVIILHL 287

Query: 298 RLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
           +LP +   R      N  ++IK +L A+DW+GA+TLV+FL  F++TASLGGKEI Y S  
Sbjct: 288 KLPSKRATR------NQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGKEIAYGSRT 341

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLP 417
           F  + + +++  L+F Y EL++A DPILPLRFL  RSVLGSSLSNWFCMMA MT SYYLP
Sbjct: 342 FALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLP 401

Query: 418 IYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQI 477
           IYF+GVLNM PTD+GKR++PNFFS AFGSLGAGYYMKKT KYYWF + FC +A +G LQI
Sbjct: 402 IYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQI 461

Query: 478 VWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTL 537
           + I P I  ++QY L+ +PG+G SVLITVALLAMIAAVPH HQA TTSISYAFRS GCTL
Sbjct: 462 LLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTL 521

Query: 538 GVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTL 597
           GVSIGGAIFRESL  L    VL++ S EH ++EL++IIDKAS+S+EWV +S+P FI+QTL
Sbjct: 522 GVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAPDFIRQTL 581

Query: 598 IDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENEE 643
           ++CYH ACKN F+FC +C+I    S +IIKE +LH++LDR  + E+
Sbjct: 582 LECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDRKEDQED 627

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/597 (57%), Positives = 433/597 (72%), Gaps = 13/597 (2%)

Query: 48  ETSQLTKED--DENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYGAIES 105
           ET+  +K D     + L P+RD++LQD ST++PGF+A             +   YG+I++
Sbjct: 2   ETNN-SKNDLTSRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDN 60

Query: 106 RRISSKGTELSTA---RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVA 162
              S  G   S     +L +I LSMYLGIFLAA D T+VST++AHIASEFNELPRISW+A
Sbjct: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120

Query: 163 TAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXX 222
           TAYLLSSATFQP+YGK+SDIFGRK +L+  NI F VG L+CGL+PSF  LV  RFI+   
Sbjct: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISGIG 180

Query: 223 XXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQ 282
                        DIVPLR+RALYQG+CNF+F            WFSD   GWRM+FLIQ
Sbjct: 181 GGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQ 240

Query: 283 LPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMI 342
           +P++  S++LI +F++LP  SK        N  ++IK +L +VDWIGA+ LV+FL  F++
Sbjct: 241 VPLSALSSLLIAVFMKLPPRSK------RVNSPASIKNKLLSVDWIGASALVVFLSLFLV 294

Query: 343 TASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSN 402
           TASLGGKEI + S  F+ LC+ + +    F   EL  AKDPILPL FL++RSVLGSS SN
Sbjct: 295 TASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSN 354

Query: 403 WFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWF 462
           WFCMMA+MT SYYLPIY++GVLNM PT +GKR++PNFFSTA GSLGAGYYMK+TGKYYW 
Sbjct: 355 WFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWL 414

Query: 463 VISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV 522
            + FC L+ +G LQI  ++PDI+ ++Q+ L+ IPG G SVLITVALLAMIAAVPHNH A 
Sbjct: 415 TVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAA 474

Query: 523 TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQST 582
           TTSISYAFRSTG TLGVSIGGAIFR+SL+ LL  KVLKF + +H   EL+ II+KAS+S+
Sbjct: 475 TTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSS 533

Query: 583 EWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
           EWV +S+P FI+ TLI CYHFACK+ F+FC LC+I    S++IIKE++LH +LDR N
Sbjct: 534 EWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/651 (54%), Positives = 449/651 (68%), Gaps = 30/651 (4%)

Query: 4   KDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENSVLL 63
           K+KQRKKL+ F K K +Q Q     ++ D P+    ++   ++  T       +    L 
Sbjct: 8   KNKQRKKLQAFVKLKERQRQ-----LLNDEPKVVIQQNPAHSIEPT-------ETTPFLQ 55

Query: 64  PIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYG---------------AIESRRI 108
           PIR EL+ DP+++LPGF+A             ++   G                +E+  I
Sbjct: 56  PIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTVATAKTIDLETSSI 115

Query: 109 SSKG-TELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLL 167
            +K  T LS AR+KIIM SMYLGIFLA+LDNTIVSTLLAHIASEFNE+P ISW+ATAYLL
Sbjct: 116 EAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLL 175

Query: 168 SSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXX 227
           SSATFQP+YGKISDIFGRK +LIF N+ F +G LICGLSP    LVAGRFIA        
Sbjct: 176 SSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGGGLT 235

Query: 228 XXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAF 287
                   DIVPLRNRALYQGICNF+F            WFS+   GWR++FLIQ+P+  
Sbjct: 236 SMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWRVAFLIQIPLCA 295

Query: 288 FSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLG 347
            S  LI+ +L LPK  KG G+Q D +  + I  +L  +DW GA +LV+FL  FM+ +SLG
Sbjct: 296 ISCSLIVAYLELPKGCKGSGIQSDED--NQISEKLRRIDWFGALSLVVFLLLFMLASSLG 353

Query: 348 GKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMM 407
           GKE+P+ S+ F  LCV  V+G   F Y E  ++KDPILP+ FLK+R++LGSSL+NWF MM
Sbjct: 354 GKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMM 413

Query: 408 ALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFC 467
            +MT SY+LP+Y+AGVLNMKPTD+GKR IP+FFSTA GSLGAGYYMKKTGKY W +++FC
Sbjct: 414 GMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFC 473

Query: 468 VLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSIS 527
            LA +G LQI  I+P+I+V++QY L+ IPG G SVLITV LLAMIAAVPH HQA TTSIS
Sbjct: 474 ALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSIS 533

Query: 528 YAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQN 587
           YAFRSTGCTLGVSIGGAIFR+SL +LL+  V+K  S +H  +EL +IID A+ S++++ +
Sbjct: 534 YAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD 593

Query: 588 SSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRD 638
           S+P F++Q LI+ YHFAC+N + FCL     A  S   +KE++LH ++DR 
Sbjct: 594 SAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/602 (55%), Positives = 433/602 (71%), Gaps = 15/602 (2%)

Query: 55  EDDENSVLLPIRDELLQDPSTELPGFIAAXX-----XXXXXXXXXTRSGHYGAIESRRI- 108
           ++D++ +L  IR ELLQD S  LPGF+AA                 +   YG++ +  I 
Sbjct: 23  QEDKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVANSIIL 82

Query: 109 SSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLS 168
            +    LS  RL++ M SMYLGIFL+ALDNTIVSTLLA I SEFNELPRISW+ATAYLLS
Sbjct: 83  DNDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLLS 142

Query: 169 SATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXX 228
           SATFQP+YGKISDIFGRK+VL FCN+ FF+G LICG + SF  LV GRFI+         
Sbjct: 143 SATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITS 202

Query: 229 XXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFF 288
                  DI+PLRNRALYQG+CNFY+            WF+++   WR +FL Q+P++  
Sbjct: 203 MSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGSWRGAFLFQVPLSVI 262

Query: 289 STILIILFLRLPKESKGRGLQV-------DGNYFSTIKVRLSAVDWIGATTLVLFLFSFM 341
           ST+ ++++L+LPK+SK  GL++       +    S I  +L  +DW GA +LV+FL SFM
Sbjct: 263 STVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSFM 322

Query: 342 ITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS 401
           I +S GG +I   S+ F+ L +++V   + F Y ELK AKDPILPL FLKDRSVLGSSLS
Sbjct: 323 ILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPILPLVFLKDRSVLGSSLS 382

Query: 402 NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW 461
           NWF MM LMT+SYYLPIYF  V+ +   D+GKR +PNFFS AFGSLGAGYYMKKTGKYYW
Sbjct: 383 NWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGKYYW 442

Query: 462 FVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQA 521
           FV  FC++  IGCLQI  I   ISV++QY L F+PGLGA+VLIT+ALL+MI AVPH +QA
Sbjct: 443 FVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLITIALLSMIVAVPHEYQA 502

Query: 522 VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP--EHSEDELMRIIDKAS 579
           VTTSISYAFRSTGCTLGVSIG A+FR+SL+  L++K+L+  S    +SE EL++IID AS
Sbjct: 503 VTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGNYSEKELLQIIDHAS 562

Query: 580 QSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
           +S +WV N +P F K+T+++CYH+ACK VF+FCL+C++ A  S+++IKEH+LH++LDR  
Sbjct: 563 KSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSISMIKEHKLHSSLDRKE 622

Query: 640 EN 641
           ++
Sbjct: 623 DD 624

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/587 (53%), Positives = 413/587 (70%), Gaps = 15/587 (2%)

Query: 55  EDDENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYGAIESRRISSKG-- 112
           E D  S+L P+R+ L  + S  LP ++ A             + H   +ES   + +G  
Sbjct: 3   ESDRTSLLQPVRNALNPELSEGLPAYVGAEV---------AETEHL--LESEDEAREGLQ 51

Query: 113 -TELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSAT 171
            +E+S ARL II+ SM LG FLAALDNTIV+TLL+HIASEFNEL  ISW+ATAYLLSSAT
Sbjct: 52  VSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSAT 111

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXX 231
           FQP+YGKISDIFGR+ ++I  N+ F +G LICGLS +   LVAGRFIA            
Sbjct: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGS 171

Query: 232 XXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTI 291
               DIVPLR+RALYQGI NF+F            WFS+   GWRM+FL+Q+P+   S +
Sbjct: 172 ITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAFLVQVPLCAISLV 231

Query: 292 LIILFLRLPKESKGRGL-QVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKE 350
           LII+FL+LP   KG GL   D +    IK +L  +DW+G+ +LV FLF+FM+ +SLGGKE
Sbjct: 232 LIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKE 291

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALM 410
           IPY S+ F  L V T++    F Y EL I+ DPILP+RFL +RS+LG+S +NWFCMM+ +
Sbjct: 292 IPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGV 351

Query: 411 TVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLA 470
           T+++Y+P+Y++ V N+KPTD+GKRI PNFFSTAFGS+GAGYYMKKTG+YY F++ F  L 
Sbjct: 352 TLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTGLM 411

Query: 471 SIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAF 530
            +G LQ++ ++PDIS ++QY L+ +P  G+SVLITV LLAMIAAVPH HQA TTSISYAF
Sbjct: 412 VLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAF 471

Query: 531 RSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSP 590
           RSTG TLGVS+G A+FR  L   L   V+KF+S ++S++ L+ II +AS+S+E+V  ++P
Sbjct: 472 RSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAP 531

Query: 591 SFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDR 637
            FI+ TLI CY  ACK+ F FC L +I A  S  +IKE++LH +++R
Sbjct: 532 KFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMER 578

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/602 (49%), Positives = 402/602 (66%), Gaps = 28/602 (4%)

Query: 55  EDDENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYGAIESRRISSKGTE 114
           + + + +L P+  + +QDPST+LPGF+A             +   YG+     ISS+   
Sbjct: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENER 62

Query: 115 -----------------LSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPR 157
                            L ++R+ IIM SM+LGIFLAALD TIVSTLL HI SEFN L +
Sbjct: 63  EDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDK 122

Query: 158 ISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRF 217
            SW+AT+YLLSS+T QP+YGK+SD  GRK +L+F N  F +G LICGLS S   +VAGRF
Sbjct: 123 ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRF 182

Query: 218 IAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRM 277
           I+                D+VPLR+RA+YQG+CNF F            +F D    WR+
Sbjct: 183 ISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRL 238

Query: 278 SFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFL 337
           +F++Q PI+  S ILI+++L LP     R    + + +S    RL  +DW GAT+L+ FL
Sbjct: 239 AFILQCPISVLSGILIVVYLELPP----RASASNKDCWSA---RLRRLDWAGATSLIAFL 291

Query: 338 FSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLG 397
           F FM+T+S+GG  + Y S  F  +C  T++   +F Y EL++A DP+LP+ FL+DRSVLG
Sbjct: 292 FLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG 351

Query: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG 457
           SSL+NWFCMM++MT ++YLP+Y++ VL MK TD+GKR +P+FFS AFGSLGAG YMK+TG
Sbjct: 352 SSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG 411

Query: 458 KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPH 517
           KYY+F+++FCVLA  G +QIV I P + V++QY L  +PG G SVLITV LLAMIAAVPH
Sbjct: 412 KYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPH 471

Query: 518 NHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDK 577
            H A TTSISYAFRSTG TLGVS+G A+FR SL +LL +KV++F S  HSE EL  II  
Sbjct: 472 EHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIAS 531

Query: 578 ASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDR 637
           A++S++WV  S+P F++ TL++CYHFA +  F FCL   + A  S +IIKEH+LH ++ R
Sbjct: 532 AARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591

Query: 638 DN 639
            +
Sbjct: 592 GS 593

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/599 (51%), Positives = 401/599 (66%), Gaps = 30/599 (5%)

Query: 57  DENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGH--YGA--IESRRISSKG 112
           +  S L PI  +++QDPST L GF+A            +R+GH  YGA  ++ R  +S  
Sbjct: 5   ERTSFLAPIDKDVIQDPSTGLAGFVA---NEVEQQDYNSRTGHDSYGATAVDDRTATSAR 61

Query: 113 TEL------------STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISW 160
            +L            S++R++IIM+SM+LGIFLAALD TIVSTLL  I SEFN L ++SW
Sbjct: 62  CDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSW 121

Query: 161 VATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAX 220
           +AT+YLLSS+T QP+YGK+SD  GRK +L+F N+ F +G LICG+S S  W+V GRF++ 
Sbjct: 122 IATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSG 181

Query: 221 XXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFL 280
                          D+VPLR RA+YQG+CNF F             F D    WRM+F 
Sbjct: 182 IGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAFT 237

Query: 281 IQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSF 340
           IQ PI+  S  LI+ +L LP   +      D +   T K+R   +DW G  TLV FLF F
Sbjct: 238 IQCPISLASCALIVSYLELPPRHED-----DKDRHWTSKLR--DLDWAGVVTLVCFLFLF 290

Query: 341 MITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSL 400
           M+ +SLGGKEI Y S  F  LCV T++   IF Y EL +A DP+LP+ FLK RSVLGSSL
Sbjct: 291 MLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSL 350

Query: 401 SNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYY 460
           +NWF MM+++T +YYLP+Y+A VLNMKPTDIGKR IP+FFS AFGSLGAG YMK+TGKYY
Sbjct: 351 ANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYY 410

Query: 461 WFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQ 520
           WF+++FC +  +G L+I  + P   V++QY L+ +P  G SVLITV LLAMI+AVPH H 
Sbjct: 411 WFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHH 470

Query: 521 AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQ 580
           A TTSISYAFRSTG TLGVSIG AIFR +L+ LL++KVL+F S EH  +EL+RII+ A+ 
Sbjct: 471 AATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAH 530

Query: 581 STEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
           S  WV   +P F++ TL++CYH+A K+ F FCL+  I A  S +II+EH LH TL RD 
Sbjct: 531 SANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/677 (47%), Positives = 416/677 (61%), Gaps = 62/677 (9%)

Query: 2   GKKDKQRKKLRNFTKAKVKQ----------VQEDQEPMVPDPPEFDGTESFVQTLAETSQ 51
           G K KQR +LR F K K +Q          V +D +P                  A    
Sbjct: 7   GLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDAQP------------------ARRQH 48

Query: 52  LTKEDDENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYG---------- 101
             +  +++ +L   R  L+ DPS+ L G +A+                            
Sbjct: 49  RPRAGEQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATSGSGSSY 108

Query: 102 --------------AIESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAH 147
                         A+E+ +  + G  L   R +++M SM LG+FLAALD TIV+TLL H
Sbjct: 109 GSTQKPTEVYLTATAVEAAKEDAGG--LGATRRRVVMASMCLGVFLAALDGTIVTTLLDH 166

Query: 148 IASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSP 207
           IASEFNELPRISW+ATAYLLSSATFQP+YGK+SDIFGR+ +L+F N+ F +G+LICG+S 
Sbjct: 167 IASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226

Query: 208 SFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXW 267
           +   LV GRF+A                DIVPLR+RALYQGICN +F             
Sbjct: 227 NLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGL 286

Query: 268 FSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDW 327
           F+DR+VGWRM+FL+Q+P+   ST  I LFL LPK           +   T K+R+  VDW
Sbjct: 287 FADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRM--VDW 344

Query: 328 IGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPL 387
            G  TLV+FLF F +  SL G+++P+    F    VV ++    F Y EL +A DPILP+
Sbjct: 345 TGTVTLVVFLFCFTLVCSLYGEDLPHLYLIF----VVILLSGSYFIYHELYVATDPILPI 400

Query: 388 RFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSL 447
           RFL++RSVL +SLSNWFCMM +MT  +Y+P+Y+A VLNM PTDIGKRI+P+FFSTAFGSL
Sbjct: 401 RFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSL 460

Query: 448 GAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVA 507
           GAGYYMK+TGKYYWF+++FC++  +G +QI ++ P IS ++QY L  IPG G++VL+TV 
Sbjct: 461 GAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSAVLLTVT 520

Query: 508 LLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHS 567
           LLA+I AVP  HQA TTSISYAFRSTG TLGVSIGGAIFR  L N L SK++  +SPEH 
Sbjct: 521 LLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHP 580

Query: 568 EDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIK 627
             EL+RII+KA+ STEWV   +P F +  LIDCYH+A +  F FCL C + AT +   I 
Sbjct: 581 ASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIV 640

Query: 628 EHRLH--NTLDRDNENE 642
           E++LH  NT  R     
Sbjct: 641 EYKLHAGNTAPRPQRER 657

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/591 (49%), Positives = 389/591 (65%), Gaps = 25/591 (4%)

Query: 57  DENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXX-----------TRSGHYGAIES 105
           D + +L PIRDE +QD ST++ GF+A                       T +  YG +  
Sbjct: 326 DSSQILKPIRDEFIQDASTDIAGFVAGELEEIEEEAREAREGEEGEALITSTASYGTLPI 385

Query: 106 RRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAY 165
                   E+S  ++ IIM SMYLG+FLAALDNT+VSTL+AHI SEFN++P++ WVAT+Y
Sbjct: 386 E----PSVEMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSY 441

Query: 166 LLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXX 225
           LLSSA FQP+YGK+SDIFGRK +LIF N+ FF G +ICG+S S   LV GRF+A      
Sbjct: 442 LLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGG 501

Query: 226 XXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPI 285
                     DIVPLR+RA+YQGICNF+F             F D   GWRM F  Q+P+
Sbjct: 502 ITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQVPV 561

Query: 286 AFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFM-ITA 344
           +  ST+LI  FL +P+           NY  ++  +L  VDW+G+ +++L+L SF+ IT 
Sbjct: 562 SGLSTLLICSFLVVPRIK---------NYEVSLGRKLMRVDWLGSISMILWLTSFLLITT 612

Query: 345 SLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404
            +GG  +   S +F  L + + + A+IF  TEL +A DP+LPLRFL +RSVLG+SL N+F
Sbjct: 613 MMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFF 672

Query: 405 CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVI 464
           C+M  MT+ +YLPIYFA VL++ PT IGKR+ PNF  TA GSLGAG YMK+TGKYYWFV+
Sbjct: 673 CVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVV 732

Query: 465 SFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524
            F +++++G   +  I   +S+  QY L+ +PG+G+S++I VALLAMIAAVPH HQA TT
Sbjct: 733 LFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATT 792

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEW 584
           SISYAFRSTG TLGV++G ++F  +L   L + VL++ SPEH   EL+RII KAS STEW
Sbjct: 793 SISYAFRSTGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEW 852

Query: 585 VQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTL 635
           V   +P+FI+ TLI CY  AC +VF+FC  C + A  S+A+I+E RL   L
Sbjct: 853 VHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGL 903

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/527 (48%), Positives = 346/527 (65%), Gaps = 7/527 (1%)

Query: 109 SSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLS 168
           S+  ++L + R+ +I  SM+LGIFLAALDNTIVSTLL HI SE N++P +S VAT+Y+ S
Sbjct: 69  SNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFS 128

Query: 169 SATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXX 228
            A FQP++GK SD+FGRK +LI  N+ FF G L CGLS +  WL+ GR +          
Sbjct: 129 CAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTS 188

Query: 229 XXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFF 288
                  DIVPLRNRA+YQG  N ++             FS+   GWRM+F+IQLP  F 
Sbjct: 189 MCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWRMAFMIQLPFCFL 248

Query: 289 STILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGG 348
           STI II++L L  + +  G        S++  +L  +DW+GA TLV FL  F++T ++GG
Sbjct: 249 STISIIVYLDLSDDKQDLGR-------SSLYCKLRLIDWLGALTLVTFLLLFLVTMTIGG 301

Query: 349 KEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMA 408
           + +PY S +F  LCV      L   Y E+ +A DPILP+ FL++++VLGSSL+NWFCMM 
Sbjct: 302 QHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGSSLANWFCMMG 361

Query: 409 LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCV 468
           +MT++YYLPIY++ V N  P  +GK+ IP+FFS A GS G  YY++K G YY  +++ C+
Sbjct: 362 MMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYYRLLMTSCL 421

Query: 469 LASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISY 528
           +   G LQIV+I P++  ++QY L+ +PG G S+LITV LLAMIAAVPH HQA TTS+SY
Sbjct: 422 IIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAATTSLSY 481

Query: 529 AFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNS 588
           AFR+TGC +G S+ GAIF+ +L   + + V+KF   EHS+ EL  +I+KA +S++WV N 
Sbjct: 482 AFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALRSSDWVNNG 541

Query: 589 SPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTL 635
           SP F+ + L+ CY  AC   F FCLLC +    S + I E  L  TL
Sbjct: 542 SPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINLPTTL 588

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  426 bits (1096), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 250/673 (37%), Positives = 371/673 (55%), Gaps = 43/673 (6%)

Query: 2   GKKDKQRKKLRNFTKAKVKQ--VQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDEN 59
           G K K+R +L+ F K K +Q  ++ D+         + G +S   +    S+ + E    
Sbjct: 7   GIKTKERNRLKEFAKLKGRQRTLKSDEAG-----ETYLGDKSNTISFGPYSRSSDESQGE 61

Query: 60  SV--LLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRS-------GHYGAIESR---- 106
           ++  L  I   ++QD S+  PGF+               S         YG+  +     
Sbjct: 62  TIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTPD 121

Query: 107 ---------RISS-------KGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIAS 150
                    R SS           +S  R   I+ S+ +G+FL +LD TI+STLL +IAS
Sbjct: 122 SNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIAS 181

Query: 151 EFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE 210
           EF  LP ISW+A +YLLS+  FQP+YGK+SDIFGRK +L+F N+ F +G L+CG +P+  
Sbjct: 182 EFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVW 241

Query: 211 WLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSD 270
           WL+AGRF+A                DIVPLR+RA YQ + N  +            W ++
Sbjct: 242 WLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE 301

Query: 271 RSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGA 330
              GWR+ FL+Q+  A  S   I  FL LPK   G G+ +      ++K +L  +DW+G 
Sbjct: 302 YG-GWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANK--ESLKTKLYMMDWLGT 358

Query: 331 TTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFL 390
             LV+FL S  +T SL    +    +  + L ++  +    F Y EL IA DPIL +  L
Sbjct: 359 FCLVIFLASLTLTCSL----VDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLL 414

Query: 391 KDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAG 450
            DR+VL SSL+N+FCM+  +   +Y+P+YFA VL M P +IGKR I +F  T+ GS G G
Sbjct: 415 TDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTG 474

Query: 451 YYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLA 510
           YY+K+ GKY  F+   C++  +G LQI  I+P IS ++QY L+ IP L  + + T  L++
Sbjct: 475 YYIKRRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLIS 534

Query: 511 MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDE 570
           +IAAVP+ +Q    SISY FRSTG  LG S+GG IFR SL +LL + ++  +S  H + +
Sbjct: 535 LIAAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQ 594

Query: 571 LMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHR 630
           L+ IIDKA+ ST+WV   SP +    LI CYH+ CK +F F ++C +  + S   +KE+ 
Sbjct: 595 LLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYP 654

Query: 631 LHNTLDRDNENEE 643
           +H +  ++  +++
Sbjct: 655 VHASQPQEYISQD 667

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  317 bits (811), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 207/554 (37%), Positives = 306/554 (55%), Gaps = 37/554 (6%)

Query: 104 ESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVAT 163
            S   ++  + L+  + +II+++++LG FL+ALD TIVSTLL  IAS+ +   ++SW+AT
Sbjct: 24  SSYDAAANHSVLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQMSWIAT 83

Query: 164 AYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSP--SFEWLV-AGRFIAX 220
           +YLLS + FQP+YGK+SDIFGRK++L++ N+ F +G  +CG SP  +  W++ AGRFIA 
Sbjct: 84  SYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNIWILSAGRFIAG 142

Query: 221 XXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFL 280
                          DI+PLR R +YQG+ N  F                + +GWR +FL
Sbjct: 143 IGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGA-VLQQGIGWRWAFL 201

Query: 281 IQLPIAFFSTILIILFLRLPKESKGRGL----QVDGNYFSTIKVRLSAVDWIGATTLVLF 336
           IQ+PIA  S +LI+  L LP +S GRGL       GN F   KV    +D++G+ TLV+ 
Sbjct: 202 IQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVT-KMIDFVGSITLVMS 260

Query: 337 LFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFL-KDRSV 395
           +   MIT S        + + ++ L ++       F +TE  I  +P++PLR L ++R+V
Sbjct: 261 MLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFVHTECTI-HNPMVPLRLLWENRTV 319

Query: 396 LGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKK 455
             SS +NWF  M+   V YY+P+++  V    P DIG R I NF   A GS+ AG YMK 
Sbjct: 320 FASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGFRSISNFVGIATGSMLAGVYMKC 379

Query: 456 TGKYYWFVISFCVLASIGCLQIVWIQPDISVFK-------QYTLMFIPGLGASVLITVAL 508
           TGKY+ F +   +L   G L +         F+       +Y LMF+PG G + ++TV L
Sbjct: 380 TGKYWNFSLVTNILYFTGILSLF-----ACTFRNTPQGVLEYLLMFLPGFGYATMLTVTL 434

Query: 509 LAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKS--PEH 566
           LA+IA+V   HQA  TSI YAFR+TG TLGVS+ G I++ SL   L   +L  ++   ++
Sbjct: 435 LALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQYKLYRDILGDQTLLGKY 494

Query: 567 SEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYH----FACKNVFIFCL-LCTIAATF 621
            +D+L +   +  Q      NS  +   Q L    H    F+ +    F L  CT+    
Sbjct: 495 GQDQLRKWCKEILQ-----DNSFDTSFDQRLAKEVHRGFQFSSECALGFALAACTLGVVL 549

Query: 622 SMAIIKEHRLHNTL 635
           S   ++EH L  T+
Sbjct: 550 S-CFMREHVLGKTV 562

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  308 bits (790), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 197/550 (35%), Positives = 302/550 (54%), Gaps = 35/550 (6%)

Query: 109 SSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLS 168
           ++  +EL   +++I +L++ +G FL+ALD TIV+TLL  IAS+ +   ++SW+ATAYLLS
Sbjct: 29  TTSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQMSWIATAYLLS 88

Query: 169 SATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSP--SFEWLVA-GRFIAXXXXXX 225
            + FQP+YGK+SDIFGRK++LI  N+TF +G  ICG SP  +  W+++ GRF+A      
Sbjct: 89  CSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIGGGG 147

Query: 226 XXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPI 285
                     DI+PLR R +YQG+ N  F                + +GWR +FL+Q+P+
Sbjct: 148 QATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVL-QQGIGWRWAFLVQVPM 206

Query: 286 AFFSTILIILFLRLPKESKGRGL----QVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFM 341
           A    ++I + L LP +S GRGL       G       V    VD++G+ TL+  +   M
Sbjct: 207 ALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVT-EMVDFVGSFTLIASMILLM 265

Query: 342 ITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFL-KDRSVLGSSL 400
              SL       ++  ++ L V+    +L F YTE    ++P++PLR L ++R+V  SS 
Sbjct: 266 TAISLLSDPTQLSTSLWLLLGVLLTASSLQFAYTECT-TRNPMVPLRLLWENRTVCASSF 324

Query: 401 SNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYY 460
           +NWF  M   TV YY+P+++  V    P DIG R + NF   A GS+ AG YMK+TGKY+
Sbjct: 325 TNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIASGSMLAGMYMKRTGKYW 384

Query: 461 WFVISFCVLASIGCLQIVWI----QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVP 516
            F ++   L ++G L +        P   V  +Y LMF+PG G + ++TV LLA+IA+V 
Sbjct: 385 SFSVATNSLFAVGVLSLFAFSFKGSPQGVV--EYLLMFLPGFGYATMLTVTLLALIASVS 442

Query: 517 HNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIID 576
             HQA  TSI YAFR+TG TLGV++   I++  L + L + VL    P  ++    R++D
Sbjct: 443 VEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQSRLYNNVLT-DGPLLAQYGSRRLMD 501

Query: 577 KASQSTEWVQN--SSPSF-------IKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIK 627
                  W Q+     SF       + + +   + F+ +    F  +  +    S   ++
Sbjct: 502 -------WCQSILQDNSFDISFDHRLAELVRQGFQFSNQCALGFAFVVCVLGVLSSCFMR 554

Query: 628 EHRLHNTLDR 637
           EH LH ++ R
Sbjct: 555 EHVLHTSVSR 564

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  307 bits (787), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 190/528 (35%), Positives = 295/528 (55%), Gaps = 22/528 (4%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ ++++G +LAALD TIV+TLL  IASE +   ++SW+AT+YLLS + FQP+YGK+SD+
Sbjct: 34  IVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 183 FGRKVVLIFCNITFFVGSLICG--LSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPL 240
           FGRK +LI+ N+ F  G ++CG   + S   L  GRFIA                DI+PL
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPL 153

Query: 241 RNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLP 300
           R R +YQG+ N  F            +   R +GWR +FL Q+P++  S  LI+ FL LP
Sbjct: 154 RQRGVYQGMGNIVFALGCASGSLIGAFLQQR-IGWRWAFLCQVPLSLLSCSLIMKFLNLP 212

Query: 301 KESKGRGL-QVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFI 359
             S GRGL  +     +T  VR   VD+ G+ TL+  +   MI  S+    +   SH   
Sbjct: 213 AGSPGRGLINLSNKKITTADVR-EHVDFTGSFTLITTMLLLMIILSV----LDNPSHLTY 267

Query: 360 GLCVVTVIGALIFGY----TELKIAKDPILPLRFL-KDRSVLGSSLSNWFCMMALMTVSY 414
           G   + ++G  + GY    TEL +  +P++P+R L  +R+VL SSL+NWF  M+   ++Y
Sbjct: 268 GTWALFIVGLALAGYTFVSTELSV-HNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAY 326

Query: 415 YLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGC 474
           Y+P+++  V ++KP +IG R + NFF  A GS+  G YMK+TGKY     +   +   G 
Sbjct: 327 YVPVFWQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGT 386

Query: 475 LQIVWI---QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFR 531
           L IV++     +     +Y ++F+PGLG + ++T+ LL++IA+V  +HQA  TSI YAFR
Sbjct: 387 L-IVYLSTYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFR 445

Query: 532 STGCTLGVSIGGAIFRESLDNLLKSKVLKFKS--PEHSEDELMRIIDKASQSTEWVQNSS 589
           + G TLGVS  G I++  L   L   +++ K+   ++S  +L +      ++  +  +  
Sbjct: 446 AIGSTLGVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSFDVSFD 505

Query: 590 PSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDR 637
           P  ++      +    + V  F +L +I    S   I+EH LH  + R
Sbjct: 506 P-LLESLAKISFQGGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQR 552

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  176 bits (445), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 134/500 (26%), Positives = 237/500 (47%), Gaps = 15/500 (3%)

Query: 118 ARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYG 177
            R +I    M   +F  A+D++I+  + + IASEF+EL R+S V + YLL +A  Q ++ 
Sbjct: 252 TRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFL 311

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           K+S + G K++L     +F +GS +   S  F   +  R +                   
Sbjct: 312 KLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLIALKSTIMNRF 371

Query: 238 VPLRNRALYQGICNFYFXXXXXXXXXXXXWF-SDRSVGWRMSFLIQLPIAFFSTILIILF 296
                           F            +F S    GW+ +FLI +P    +  +++  
Sbjct: 372 SQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLAD 431

Query: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDW----IGATTLVLFLFSFMITASLGGKEIP 352
           +   K +    +  +G   +T++ R   V W        TL LFL  F+   SL    + 
Sbjct: 432 IYSVKNT----IHHEGPT-TTLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLE 486

Query: 353 YTSH-KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMT 411
           +++  + I   V+ + G L F   +  +  + +  L    D+ ++ + +  +FC  ALM 
Sbjct: 487 HSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFFCFAALMC 546

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLAS 471
           +  +   YF  VLN+   +I +R++P FFS   G     Y+     + Y F      +  
Sbjct: 547 IIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKFVLSGVTL 606

Query: 472 IGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQA--VTTSISYA 529
           +  + ++ +   +SV+KQYT + +P LG+S+++T  LL+ +    H  +   ++ SI+Y 
Sbjct: 607 LLYVALMGMNLSLSVWKQYTCLSLPLLGSSMILT--LLSTLYHEYHVQRKSPISGSIAYC 664

Query: 530 FRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSS 589
           F + G T+GVS  G +F ++L   +  +V+KF    + + +L +II  A+QS+ WV  S+
Sbjct: 665 FAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSA 724

Query: 590 PSFIKQTLIDCYHFACKNVF 609
           P FI +TLI+CY  AC+NVF
Sbjct: 725 PKFIFRTLIECYLQACRNVF 744

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQ 21
          MGKKD+QRKKLR F K K +Q
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQ 21

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  172 bits (435), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 135/540 (25%), Positives = 242/540 (44%), Gaps = 34/540 (6%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           R+ +I  +++  +FL+ LD+TI +++   I +EF ++   SW+ TAYL++  +FQP+YG 
Sbjct: 44  RILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYGS 103

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SD  GR+  L F N  F +G L CGL+ +   L+  R +                 DI+
Sbjct: 104 FSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDII 163

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P + R +YQ   N                 +  S+GWR  FL+Q+PI+    ++  LF++
Sbjct: 164 PAKKRGMYQSFQNILVGTGAVVGASCGGEIAS-SMGWRWCFLLQVPISIGGAVMAYLFVQ 222

Query: 299 ----LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFS----FMITASLGGKE 350
               + K  +   L  + +       ++  +D++GA  L+  L S      I +S    +
Sbjct: 223 DQDVVDKNPRSGALPSNVS-------KIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGK 275

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALM 410
             + S + + L +VT +  ++F Y E     +PI+P        +LG   S    ++ ++
Sbjct: 276 STWLSGRSLALGLVTAVSLILFAYVEKTTTANPIIP------HDLLGQWYSTTVLIVGVL 329

Query: 411 T--VSY----YLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVI 464
              VSY     LP+YF  V+     + G R+    F T  G +  G  MK   +    +I
Sbjct: 330 VGFVSYAYIFTLPLYFQVVVGDTAAEAGLRLTVPSFCTPIGGVIMGISMKDPKRLPGLLI 389

Query: 465 SFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524
               L   G L  + I+P    +    L+    +G  +     L + + A P   QA  T
Sbjct: 390 VGISLMLFGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPSTLFSFLFAFPPYKQATAT 449

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEW 584
           +  Y FRS GC  GV+   ++    + ++++ +  K      +++E+  ++ K S  T  
Sbjct: 450 ATLYLFRSVGCVWGVAGTSSL----IQSVVRKQATKRLQGILTDEEIKSLLVKLSHKTSL 505

Query: 585 VQNSSPSFIKQTLIDCYHFACKNVFIF-CLLCTIAATFSMAIIKEHRLHNTLDRDNENEE 643
           ++   P  ++  ++  Y  + K+ + F  +LC IA   ++      +   T DRD E  E
Sbjct: 506 IEK-LPDNVRAAVLTSYEISIKSTYFFSVILCLIAIILALMRRVFKKFDGTNDRDLEERE 564

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  166 bits (421), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 146/541 (26%), Positives = 243/541 (44%), Gaps = 31/541 (5%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           R+  I  +++  +FL+ LD TI ++    I +EF+     +W+ TAYL+++ +FQP+YG 
Sbjct: 43  RIVFIETALFANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGS 102

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SD  GR+  L F N  F +G L CGL+P    L+  R +                 DI+
Sbjct: 103 FSDTLGRRHCLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDII 162

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P  +R +YQ   N                 +   +GWR  FL+Q+P++   TI+  +FL 
Sbjct: 163 PPESRGIYQAFQNVLLGIGAVIGASTGGAVASY-LGWRWCFLLQVPVSVGGTIMAYMFLE 221

Query: 299 LPK----ESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYT 354
             K    ES+  G Q+  N FS I ++ S +  +G  + +++L    + +S+      + 
Sbjct: 222 NQKGFVSESESSG-QLLKNRFSKIDLKGSLLLIVGLASQLMYL---TVNSSMASSGSQWL 277

Query: 355 SHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS---VLGSSLSNWFCMMALMT 411
           S + IGL ++TV+  ++F +TE     +PI+P + L       VL  S+   F   A + 
Sbjct: 278 SKESIGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYL- 336

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISF-CVLA 470
             + LP++F  V+       G R+    F T  G L  G  M +  K   F++SF  VL 
Sbjct: 337 --FTLPLFFQIVVGDSAARAGFRLAIPSFCTPIGGLITGLSM-RIPKTLPFLLSFGMVLM 393

Query: 471 SIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAF 530
            IG    + ++     +    L+    +G  V     L + + +    +QA  TS  Y F
Sbjct: 394 MIGNAFFLLLKTTTPEWLVCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLYLF 453

Query: 531 RSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSP 590
           RS G   GV+    + +  +   ++ K+    SPE    E+ R+  K    T +++   P
Sbjct: 454 RSIGSLWGVAGTSGLIQLLVGRKIREKLHGILSPE----EIARLRSKIGHKTSYIEK-LP 508

Query: 591 SFIKQTLIDCYHFACKNVFIFCL-LCTIAATFSMAI--------IKEHRLHNTLDRDNEN 641
           S IK+ +++ Y  A K   I  +  C IA   S+          +KEH   +    D  N
Sbjct: 509 SEIKEAVVESYESAIKFAHILSVSFCVIAIGISIVRHFSKGYRNLKEHNDPDLESPDRRN 568

Query: 642 E 642
            
Sbjct: 569 S 569

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  159 bits (401), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 140/539 (25%), Positives = 243/539 (45%), Gaps = 25/539 (4%)

Query: 117 TARLKIIML--SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQP 174
           + R K++++  +++  +FL+ LD+TI ++    I +EF ++   SW+ TAYL++  +FQP
Sbjct: 37  SERHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQP 96

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           +YG  SD  GR+  L F N  F +G   CG + +   L+  R +                
Sbjct: 97  LYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIIN 156

Query: 235 XDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
            DI+P + R +YQ   N                 +  ++GWR  FL+Q+PI+   T++  
Sbjct: 157 SDIIPAKKRGIYQAFQNVLLGTGAVVGASCGGLIAT-TMGWRWCFLLQVPISVGGTLVAF 215

Query: 295 LFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLF----LFSFMITASLGGKE 350
            F+   +     G+       +T   +L  +D+ GA  LVL     LF   + ++    E
Sbjct: 216 FFVHDQRPDINGGVSA---VRTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSE 272

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALM 410
             + S + I L + T +  ++F Y E     +PI+P   L  R   G+++     ++  +
Sbjct: 273 SYWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLL--RQAHGATVLIISVLVGFV 330

Query: 411 TVSYY--LPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCV 468
             +Y   LP+YF  V+       G R+    F T  G L  G  MK        +IS   
Sbjct: 331 AYAYIFTLPLYFQVVIGDTAAKAGLRLTVPSFCTPIGGLITGLSMKNPNHLPVLLISGIT 390

Query: 469 LASIGCLQIVWIQPDISVFKQYTLMFIPG-LGASVLITVALLAMIAAVPHNHQAVTTSIS 527
              +G L  ++I+P  + + Q +L+ +P  +G  +     L   + A P   QA  TS  
Sbjct: 391 CMLLGNLCFLFIKP-WTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTL 449

Query: 528 YAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQN 587
           Y FRS GC  GV+   ++ + ++ N  K  +        +E E+ +++ + S +T  ++ 
Sbjct: 450 YLFRSVGCVWGVAGTSSLIQYAVRNQAKKSLNGLL----TEKEIRKLLLQLSHTTSQIKK 505

Query: 588 SSPSFIKQTLIDCYHFACKNV-FIFCLLCTIAA--TFSMAIIKEHRLHNTLDRDNENEE 643
             P  ++  +I  Y  A +   F+   LCTIA   +F   + K+   H   D  NE E 
Sbjct: 506 LPPD-VRSAVISSYDNAIRQAYFLSVFLCTIAILLSFLKRVFKKRDEHEGQD-SNETEN 562

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  160 bits (406), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 161/634 (25%), Positives = 284/634 (44%), Gaps = 43/634 (6%)

Query: 2   GKKDKQRKKLRNFTKAKVKQVQE---DQEPM-VPDPPEFDGTESFVQTLAETSQLTKEDD 57
           GKK   +  + +F+   V  +Q    D  PM V + PE     S    L     +     
Sbjct: 138 GKKSPSQNSVSDFSDRSVSPLQSITSDNTPMSVHEVPE-----SLANALEGNGDIVVAQL 192

Query: 58  ENSVLLPIRDELLQDPSTELPGFIAAXXXXXXXXXXXTRSGHYGAIESRRIS--SKGTEL 115
           ++ V  P  + L   P+++L    A             R+  YG+I SR +     GT  
Sbjct: 193 DSCV--PAINAL---PTSDLSPTSATSAPEVLVDRPQMRAYEYGSI-SRTVKDVENGTTS 246

Query: 116 STARL-------------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVA 162
           S AR+             +I    M   +F  A+D+TI+ ++++ IASEF+EL R+S + 
Sbjct: 247 SYARVASSDKFVHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELWRLSLII 306

Query: 163 TAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXX 222
           + YLLS+A  Q ++ K+S +   K++L     +F +GS +   +  F   V  R I    
Sbjct: 307 SIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFARSITGFG 366

Query: 223 XXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSD-RSVGWRMSFLI 281
                             +            F             F + R  GW+ +FLI
Sbjct: 367 SGALMALKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGWKNAFLI 426

Query: 282 QLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFM 341
            +P    +  +++  +   K++   G     ++   IK  L + D     TL L L  F+
Sbjct: 427 PVPFCLVNASIMLADIYSIKDNLHHGGSAPISW-KRIKKILMSPDLYEILTLALLLLCFV 485

Query: 342 ITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTEL-KIAKDPILPLRFLKDRSVLGSSL 400
              SL    + +++     L  V +   ++F + E  +   + I+ +    D+ ++ + +
Sbjct: 486 QVTSLDITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTIM 545

Query: 401 SNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYY 460
              FC  ALM +  +   YF  VLN+    I +R++P   +   G     Y+ K   K Y
Sbjct: 546 GISFCFAALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMKNY 605

Query: 461 WFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHN-H 519
              +    +  I  + ++     + V+KQY  + +P LG+++++T     +++++ H  H
Sbjct: 606 LLEVVLGGVTLILYIALMGASLSLPVWKQYVCLSLPLLGSAMILT-----LLSSLYHEYH 660

Query: 520 QA----VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRII 575
           Q     ++ SI Y F + G T+G+S+GG +F ++L   +   V+KF    + E +L++II
Sbjct: 661 QPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKII 720

Query: 576 DKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVF 609
           + A+QS++WV  S+P FI QTLI+CY  AC+NVF
Sbjct: 721 EHATQSSDWVHESAPKFIFQTLIECYLQACRNVF 754

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAET--SQLTKED-D 57
          MGKKD+QRKKLR F K K +Q Q  ++ +     E        + L       L +E+  
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQ-QNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKREEAS 59

Query: 58 ENSVLLPIRDE 68
          ENS LLP   E
Sbjct: 60 ENSPLLPAPSE 70

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  159 bits (403), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 141/533 (26%), Positives = 241/533 (45%), Gaps = 40/533 (7%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           R +I    M   +F  A+D++I+  + + IASEF+EL R+S V +AYLLS+A  Q ++ K
Sbjct: 247 RRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLK 306

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           +S I   K++L     +F +G  +   S  F   +  R +                    
Sbjct: 307 LSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFS 366

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWF-SDRSVGWRMSFLIQLPIAFFSTILIILFL 297
              +           F             F S    GWR +FLI +P    +  +++  +
Sbjct: 367 QKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADM 426

Query: 298 RLPKESKGRGLQVDGNYFSTIKVRLSAVDW--IGATTLVLFLFSFMITASLGGKEIPYTS 355
              K              ST+  R +   W     T L   L+  +         +  TS
Sbjct: 427 YSVK--------------STLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTS 472

Query: 356 HKFIGL-----------CVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404
               GL            V+ V G L F         + ++ +    D+ ++ + +   F
Sbjct: 473 LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISF 532

Query: 405 CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW--F 462
           C  ALM +  +   YF  VLN+    + +R+ P FFS   G     Y+ K  G+ +   F
Sbjct: 533 CFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKF 592

Query: 463 VISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQA- 521
           V+S   L  +  + ++ +  ++ V+KQY  + +P LG+S+++T  LL+ +    H  +  
Sbjct: 593 VLSGATL--LLYVALMGVSLNLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKS 648

Query: 522 -VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQ 580
            ++ SI Y F + G T+G+S+GG +F ++L  L+  KV+ F    + + +L++II  A++
Sbjct: 649 PISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATE 708

Query: 581 STEWVQNSSPSFIKQTLIDCYHFACKNVF-IFCLLCTIAATFSMAIIKEHRLH 632
           S++WV  S+P F+ QTLI+CY  AC+NVF +  L  TI     +AI   +R+H
Sbjct: 709 SSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLFFTITV---VAIFIFNRIH 758

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQ 21
          MGKKD+QRKKLR F K K +Q
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQ 21

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 140/522 (26%), Positives = 238/522 (45%), Gaps = 33/522 (6%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
            L II  +++  +FL+  D T+ ++    I +EFN +   SW+ TAYL++S +FQP+YG 
Sbjct: 53  NLWIIEAALFTNVFLSGFDGTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGS 112

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SD  GR+  L F N +F +G L CGLSP+   L   R +                 D++
Sbjct: 113 FSDALGRRNCLFFANTSFTIGCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMI 172

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R ++Q   N                 +  S+GWR  F +Q+PI   +++++  ++ 
Sbjct: 173 PSSKRGIFQAFQNLLLGLGAICGASFGGSIAS-SIGWRWCFFVQVPICITNSLIMSSYVP 231

Query: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKE--IPYTSH 356
             KE + R +   G  F   K+ L  +D  G+  +++ L   ++  SLG  +  + +TS 
Sbjct: 232 NQKEYEDREI---GFLFHPKKI-LKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSP 287

Query: 357 KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR---SVLGSSLSNWFCMMALMTVS 413
             + L   + I  ++F Y E K +   I+PL  ++      VL  S+   F   A +   
Sbjct: 288 SVLPLLFASGIILVLFVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYAYL--- 344

Query: 414 YYLPIYFAGVLNMKPTDIGKRI-IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASI 472
           + LP++F  VL       G R+ IP+ F T  G L  G  M +       + +   L ++
Sbjct: 345 FTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGGLITGICMSRYNCLQILLYAGVFLMAL 403

Query: 473 GCLQIVWIQ---PDISVFKQYTLMFIPG-LGASVLITVALLAMIAAVPHNHQAVTTSISY 528
           G    ++I+   P+  V     L  IP  LG  +     L   I A P + QA  TS  Y
Sbjct: 404 GNFLFLFIEKGSPNWLV----GLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLY 459

Query: 529 AFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNS 588
            FRS G   GV++   + +      L+S +         ED++  ++ K + ++ +++  
Sbjct: 460 LFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLL----DEDKINELVTKITSNSSYIEKL 515

Query: 589 SPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMA--IIKE 628
               +K  +IDC+  + K      LL TI +  ++A  +IKE
Sbjct: 516 HGE-LKDVVIDCFDSSTKKAH---LLSTILSLLALAFCVIKE 553

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 141/532 (26%), Positives = 234/532 (43%), Gaps = 36/532 (6%)

Query: 96  RSGHYGAIESRRIS-----------SKGTELSTAR---LKIIMLSMYLGIFLAALDNTIV 141
           + G YG+IE    S            K  +++ +R   L II  +++  +FL+  D T+ 
Sbjct: 14  KDGIYGSIEVTETSLVEDNADIEDVDKDEDMALSRIPNLWIIEATLFSNVFLSGFDGTVT 73

Query: 142 STLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSL 201
           ++    I +EFN++   +W+ TAYL++S +FQP+YG  SD  GR+  L F N  F +G L
Sbjct: 74  ASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAAFTIGCL 133

Query: 202 ICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXX 261
            C LS +   L   R +A                D++P   R ++Q   N          
Sbjct: 134 ACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG 193

Query: 262 XXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVR 321
                  +  ++GWR  FLIQ+PI+  S++L+  ++   KE        + N F   K  
Sbjct: 194 ASFGGTIAS-TIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHE----NSNIFRNSKRI 248

Query: 322 LSAVDWIGATTLVLFLFSFMITASLG--GKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
           L+ +D  G+  ++  L   ++  SLG  G ++ +TS   + L V ++   L+F   E K 
Sbjct: 249 LTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFISHEKKT 308

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI-IPN 438
               I+P+  +         L +     A     + LP++F  VL       G R+ IP+
Sbjct: 309 TARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLAIPS 368

Query: 439 FFSTAFGSLGAGYYMKKTG---KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFI 495
            F T  GSL  G+ M K        +  +S   L +   L I    P+  +    +L  I
Sbjct: 369 LF-TPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKTSPNWLI----SLFLI 423

Query: 496 PG-LGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLL 554
           P  LG  +     L   I   P + QA  TS  Y FRS G   GV+I   + + S    L
Sbjct: 424 PANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAKYL 483

Query: 555 KSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACK 606
           +S +         E+ + ++I K + ++ +++ S    +K T+I+ +  A K
Sbjct: 484 RSNL----KDMLDENTIAKLITKLNANSSYIE-SLHGEVKNTVIESFDAATK 530

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  149 bits (376), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 128/463 (27%), Positives = 209/463 (45%), Gaps = 50/463 (10%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+LS++L   + A+D TI+ST +  IAS F E  +++WVATAY+L++   QP+YGK SD+
Sbjct: 50  ILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDL 109

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+F  + F VG ++CG + + E L+  R I                 D+ PL  
Sbjct: 110 LGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQ 169

Query: 243 RALYQG----ICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           R++Y G    I  F              WF  R +     F++Q+P   FS  L + ++ 
Sbjct: 170 RSIYWGWGSVIWGFSQSVGGPLGGLLLNWFGVRGL-----FVVQIPFCLFSLSLTVKYIH 224

Query: 299 -LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
            L  +++G                   +D+ G+  L+  + +F+   S  G     ++  
Sbjct: 225 DLSNQTQG---------------TWRDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVS 269

Query: 358 F--IGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYY 415
              +G  ++TV+    F Y E  +A   ILP   LK    + S +     M++ + + + 
Sbjct: 270 LFKVGCFLITVLSVSGFIYVEKNVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGL-FV 328

Query: 416 LPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG---------KYYWFVISF 466
           +P+Y   V  +     G  I+    ST+ GS G+G+ ++K G              +I  
Sbjct: 329 VPLYLQLVWGVSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIGS 388

Query: 467 CVLASIGCL----QIVWIQPDISVFKQ--------YTLMF-IPGLGASVLITVALLAMIA 513
            ++ ++G       I+ I+P     K         + L F I GL A       +L  +A
Sbjct: 389 TLINTLGFFVMFKNILEIKPAFEGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSVMLYTVA 448

Query: 514 AVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKS 556
            V    QA +TS+++ FRS G  L VSI  ++F  SL   LKS
Sbjct: 449 KVGRKGQASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKLKS 491

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  150 bits (378), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 242/500 (48%), Gaps = 15/500 (3%)

Query: 118 ARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYG 177
            R +I    M   +F  A+D++I+  +++ IASEF+EL R+S + + YLLS+A  Q ++ 
Sbjct: 246 TRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQLLFL 305

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           K+S I   K++L     +F +GS +   S  F   +  RF+A                + 
Sbjct: 306 KLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIM-NR 364

Query: 238 VPLRNRALYQ-GICNFYFXXXXXXXXXXXXWF-SDRSVGWRMSFLIQLPIAFFSTILIIL 295
              +N + Y        F             F S    GW+ +FLI +P    +  +++ 
Sbjct: 365 FSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLA 424

Query: 296 FLRLPKESKGRGLQVDGNYFS---TIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIP 352
            +   K++    L  +G+ F+    +K  L + D     TL LFL  F+   +L   E+ 
Sbjct: 425 DIYSVKDN----LHHEGSTFTLWKRVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTELE 480

Query: 353 Y-TSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMT 411
           + T  +++   V+ + G L +         + ++ +    D+ ++ +     FC  ALM 
Sbjct: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW--FVISFCVL 469
           +  +   YF  VLN+    I +R++P FFS   G     Y+ K   + Y   FV+S   L
Sbjct: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600

Query: 470 ASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYA 529
             I  + ++ +   + V+KQY  + +P LG+S+L+T+                + SI Y 
Sbjct: 601 --ILYITLMGVGLSLPVWKQYVCLSLPFLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYC 658

Query: 530 FRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSS 589
           F + G T+G+S+GG +F ++L   L  +V+KF    + + +L++II  A++S++WV  S+
Sbjct: 659 FGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESA 718

Query: 590 PSFIKQTLIDCYHFACKNVF 609
           P FI +TLI+CY  AC+NVF
Sbjct: 719 PKFIFKTLIECYLQACRNVF 738

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQ--VQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDE 58
          MGKKD+QRKKLR F K K +Q  +Q   + +  +     G       +A  +  ++E+ E
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60

Query: 59 NSVLLPIRDELLQDPSTE 76
          N+ LL    E  +D  ++
Sbjct: 61 NTPLLLTSSERREDDGSK 78

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  139 bits (351), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 226/522 (43%), Gaps = 36/522 (6%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
            L +I  ++Y  +FL+  D+T+ ++    I +EFN +   SW+  +YL++S +FQP+YG 
Sbjct: 65  HLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYGS 124

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SD+ GR+  L F ++ F +G L CG+S +  WL   R                   D++
Sbjct: 125 FSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDMI 184

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R ++Q   N                 +  S+GWR  FL+Q+PI+    ++  L++R
Sbjct: 185 PTSKRGIFQAFQNLLLGLGAICGASFGGVITS-SIGWRWCFLLQVPISLAGALIGHLYVR 243

Query: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIP----YT 354
              E + R  +      S  K  L  +D+ GA  +++ L   ++  SLG         ++
Sbjct: 244 NQDEYERRKSKES----SQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTWS 299

Query: 355 SHKFIGLCVVTVIGALIFGYTELKIAKDPILP---LRFLKDRSVLGSSLSNWFCMMALMT 411
           S     + V + I  ++F  TE + +   I+P   +R L    VL  S+   F   A + 
Sbjct: 300 SPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFASYAYL- 358

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRI-IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLA 470
             + LP++F  +L       G R+ IP+ F T  G L AG  M K       +       
Sbjct: 359 --FTLPLFFQVILGDSTAKAGLRLAIPSVF-TPVGGLIAGICMSKFNCLQTLLYVGIAFM 415

Query: 471 SIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAF 530
            +G    ++I  D +       +    LG  +    +L   I A     QA  TS  Y F
Sbjct: 416 CLGNFLFLYIGADATDSLIGFFLIPANLGQGITFPSSLFTFIFAFSKIDQATATSTLYLF 475

Query: 531 RSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDE--LMRIIDKASQSTEWVQN- 587
           RS G   GV+    I +    + L+      K+ E   DE  + ++I K + +T +++  
Sbjct: 476 RSIGSVWGVTGSAGIVQFCFSHHLE------KALEGLLDERKIRKLIKKITSNTSYIKEL 529

Query: 588 SSPSFIKQTLIDCYHFACKNVFI----FCL----LCTIAATF 621
             P  +K  +I+ +  A K V +    FCL    LC I   F
Sbjct: 530 EGP--VKVAVIESFDTATKKVHLISTSFCLVALILCVIKDVF 569

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  138 bits (348), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 122/470 (25%), Positives = 208/470 (44%), Gaps = 53/470 (11%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG F+++LD TIV+ ++  +A EF+E  +  W+AT++LL++  FQP+YGK+SD+
Sbjct: 37  ILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDV 96

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+       +G L+  L+ +       R I                 DI   + 
Sbjct: 97  TGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKE 156

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R +YQG  N  F             F D ++GWR  F IQ+P+   S  L          
Sbjct: 157 RGIYQGYANIVFGMGQMLGAPLGGLFID-TIGWRAIFGIQVPVVMVSAFL---------- 205

Query: 303 SKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
              R + +  ++   I  R     LS +D++G+ TL   +   ++  S        T   
Sbjct: 206 -AYRNVNIKLSHVPPISERFTRKNLSRIDFLGSVTLASTICGVLVLCS--------TDLN 256

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLP 417
            + + + T    ++F + EL  A + ILP   LK    L S ++     +    + +  P
Sbjct: 257 KLVVSLATAASFVLFLWVELFYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDI-FRSP 315

Query: 418 IYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK-----YYWFVISFCVLASI 472
           IY   + ++  T+ G  +I    S A GSL  G  +++T K      Y FV++   L   
Sbjct: 316 IYLQLIHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLT 375

Query: 473 GCLQIVW----IQPDISVFKQYTLMF------------------IPGLGASVLITVALLA 510
           G +   +    ++P +S     TL F                  + G G + L+   L++
Sbjct: 376 GLVISYYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVS 435

Query: 511 MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLK 560
           ++ ++  + QA  T I Y +RS G  LG S+   +F+ SL   L+  +L+
Sbjct: 436 IVFSIDKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLE 485

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 130/516 (25%), Positives = 225/516 (43%), Gaps = 22/516 (4%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
            L II  +++  +FLA  D TI ++    I +EFN++   SW+ TAYL++S +FQP+YG 
Sbjct: 56  NLWIIEATLFSNVFLAGFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGS 115

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SD  GR+  L F N  F +G L C  S +   L   R +A                D++
Sbjct: 116 FSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVI 175

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R ++Q   N                 +  ++GWR  FLIQ+PI+  +++L+  ++ 
Sbjct: 176 PSSKRGIFQAFQNLLLGFGAICGASFGGTITS-TIGWRWCFLIQVPISMIASLLMNYYVP 234

Query: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKF 358
             KE   + + +     S+ K+ L  +D I  + L++   +  +     G    +T+   
Sbjct: 235 NQKEYDDQKINI---LLSSKKI-LKDID-ITGSILIIAGLTLQLLYLSLGASFSWTNPPV 289

Query: 359 IGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR---SVLGSSLSNWFCMMALMTVSYY 415
           + L + +++  ++F   E K     I+P+  +       VL  S+   F   A +   + 
Sbjct: 290 LMLLLASIVIIILFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASYAYL---FT 346

Query: 416 LPIYFAGVLNMKPTDIGKRI-IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGC 474
           LP++F  VL       G R+ IP+ F T  GSL  G  M K       +     L  +G 
Sbjct: 347 LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGISMSKYDCLQSLLYIGIFLMFLGN 405

Query: 475 LQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTG 534
              ++I+     +     +    LG  +     L   I A P   QA  TS  Y FRS G
Sbjct: 406 FLFLFIEKTSPNWLIGVFLIPANLGQGITFPTTLFTFIFAFPKRDQATATSTLYLFRSIG 465

Query: 535 CTLGVSIGGAIFRESLDNLLKSKVLKFKSPE-HSEDELMRIIDKASQSTEWVQNSSPSFI 593
              GV+I   + +     L  ++ L+F   +   E  + +II + + ++ ++  S    +
Sbjct: 466 SVWGVAISAGVIQ-----LYFARYLRFNLKDLLDEHTINKIITRINANSSYI-GSLHGEV 519

Query: 594 KQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEH 629
           K T+I  +  A K   +   L ++ A     I+K++
Sbjct: 520 KNTVIKSFDSATKKAHLMSTLLSLLALI-FCIVKDN 554

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  137 bits (346), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 135/517 (26%), Positives = 224/517 (43%), Gaps = 62/517 (11%)

Query: 104 ESRRISSKGTELSTARLKI----IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRIS 159
           ESR   S   E     L +    I+ S++LG F+ +LD TIV+ ++  +A EF E  +  
Sbjct: 12  ESRDEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQ 71

Query: 160 WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIA 219
           W+AT++LL++  FQP+YGK+SDI GR+  L+  +  F +G L+   + S E     R I 
Sbjct: 72  WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALARAIC 131

Query: 220 XXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSF 279
                           DI   + R  YQG  N  F               D ++GWR  F
Sbjct: 132 GIGGGGINACSSIAVSDICTAKERGSYQGYANIVFGTGQMLGGPIGGLLID-TIGWRAIF 190

Query: 280 LIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTLV 334
            +Q+PI  F + L             + + +  ++   +  R     LS +D +G+++LV
Sbjct: 191 AVQVPIIMFCSFLTY-----------KNITIKLSHIPPVSERFTWMNLSRIDIMGSSSLV 239

Query: 335 LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS 394
           + +   +   S        T+   + L   T++G L F  TE   AK+ ILPL+ LK  S
Sbjct: 240 VVICGILFICS--------TNWNKVILSTFTIVGFLFFIVTETYFAKECILPLKLLKGAS 291

Query: 395 VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMK 454
            L S ++     +    + +  PIY+  V +M  T  G  ++    S A GS+  G  ++
Sbjct: 292 GLCSLVTVLSSFITFGEI-FRAPIYYQVVQDMSVTKTGLFVLFPAVSVAVGSVVTGTALR 350

Query: 455 KT----GKYYWFVISFCVLASIGCLQIVWI-----QPDI----SVFKQYTLMF------- 494
            T    G Y + +I   +   +  L + ++     +P I    S F  +   F       
Sbjct: 351 HTKLDLGHYCYLIILRSIFTQLIGLLLAYVVINGTEPTIGASSSTFAVHWFQFSSDSIWW 410

Query: 495 ---------IPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI 545
                    +   G S L+   L++++ +V  + QA  T I Y +RS G  LG S+   I
Sbjct: 411 KILLVSAGCMVSYGYSGLLVATLVSIVCSVEKSEQATLTGIFYLWRSIGSVLGTSLTLVI 470

Query: 546 FRESLDNLLKSKVLKFK---SPEHSEDELMRIIDKAS 579
           +  SL   L   +   +   S  +++ E   +I  +S
Sbjct: 471 YENSLTKSLWGAMFGSRNDDSYHYTKKEYYNLIGDSS 507

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 139/554 (25%), Positives = 243/554 (43%), Gaps = 66/554 (11%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG FL++LD+TIV+ ++  +A +F+E  R  W+AT++LL++  FQP+YGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+     F +G L+   + +       R I                 DI   R 
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII------LF 296
           R +YQG  N  F             F + ++GWR  F +Q+P+    TIL I      LF
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIE-TIGWRALFGVQVPMIMLCTILAIKNINIKLF 216

Query: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
              P + +            T+K  LS +D  G+ +LV         A++ G     +SH
Sbjct: 217 HVPPMKER-----------YTLK-NLSRIDLFGSLSLV---------ATISGVLFLCSSH 255

Query: 357 -KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYY 415
              + L + T+   ++F   E   A + ILP   L     L S+++     +    + + 
Sbjct: 256 LNKLYLSLFTIGSFIVFVLVERYYATERILPFELLTPSFCLSSAVTVISSFVVFGEI-FR 314

Query: 416 LPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG---KYYWFVISFCVLAS- 471
            PIY   + N+  T  G  +I    S A GSL  G+ ++ T     +  + I F  + + 
Sbjct: 315 SPIYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKINLAHCAYQIIFGGMVTQ 374

Query: 472 -----IGCLQIVWIQPDISVFKQ------------YTLMFI-----PGLGASVLITVALL 509
                +G L +  + PD +V+              + L+++        G + L+   L+
Sbjct: 375 LLGLGLGYLLLAHLNPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLVATLV 434

Query: 510 AMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEH--- 566
           +++  V  + Q   T + Y +RS G  LG S+    +  SL ++L + + K K  +    
Sbjct: 435 SIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDEYHF 494

Query: 567 SEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAII 626
           S+ +   +ID +S       N+ P ++   ++D Y    K  F+   +  IA      ++
Sbjct: 495 SKKQYYSLIDDSSYLR---GNNFPKYVFVRILDVY----KKAFLISYIPNIALAVIGMVL 547

Query: 627 KEHRLHNTLDRDNE 640
             + + +TL R + 
Sbjct: 548 SLYLVKHTLKRSSS 561

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  132 bits (332), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 126/516 (24%), Positives = 223/516 (43%), Gaps = 65/516 (12%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S+++G FL ALD TIV+ ++  +A EF E  +  W+AT++LL++  FQP+YGK+SDI
Sbjct: 53  IVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+  +  F +G L+   + +       R I                 DI   R 
Sbjct: 113 TGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARE 172

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R  YQG  N  F            +  DR +GWR  F +Q+P+     +L          
Sbjct: 173 RGAYQGYANVVFSTGQLLGAPLGGFALDR-IGWRAIFGLQVPMLLICMVL---------- 221

Query: 303 SKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
              R + +   +   ++ R     LS +D  G+ TLV  +   +   S        TS  
Sbjct: 222 -GYRNVNIKLAHVPPLEERFTWKNLSRIDIGGSITLVCTISGVLFLCS--------TSLN 272

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLP 417
              L V T +  ++F Y EL +A++ ILP   L     L S L+     +    V +  P
Sbjct: 273 KAILSVFTGLSFMLFMYNELYLARERILPFELLGGSFGLASILTVGSSFVIFGDV-FRSP 331

Query: 418 IYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKT----GKYYWFVISFCVLASIG 473
           I+   V N+  T  G  ++ +  +TA  SL  G+ ++ T     K  + ++ F +   + 
Sbjct: 332 IFLQLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQLC 391

Query: 474 CLQIV-----WIQPDIS-------------VFKQYTLMF---------IPGLGASVLITV 506
            L I      +++P+ +             +FK  +L +           G G + L+  
Sbjct: 392 GLVIAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLLVS 451

Query: 507 ALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEH 566
            L++++  +  + QA  T + Y +RS G  LG S+  +++  +L   L S +        
Sbjct: 452 TLVSIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLSKKLWSYL-------- 503

Query: 567 SEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYH 602
           S +++    +  S+ + +++ +    +   L+D Y+
Sbjct: 504 SANDITEQYNNLSRDSSYLRKNFSGELLSGLLDVYN 539

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  131 bits (330), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 138/563 (24%), Positives = 236/563 (41%), Gaps = 93/563 (16%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +++LS++L   + A+D TI+ST +  +AS F E   ++WVATAY+L++ + QP+YGK SD
Sbjct: 52  LVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSD 111

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           + GRK  L+F  + F +G ++CG++ + + L   R I                 D+ PL 
Sbjct: 112 LLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLS 171

Query: 242 NRALYQG----ICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFL 297
            R++Y G    I  F              WF    +     F+IQ+P   FS  L + ++
Sbjct: 172 QRSIYWGLGSLIWGFSQSIGGPLGGLLLNWFGVSGL-----FVIQVPFCLFSLFLTVRYI 226

Query: 298 RLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
               + + +G   D             +D+ G+  L++ + +F+ + S G          
Sbjct: 227 HDLTDQR-QGTWRD-------------IDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGP 272

Query: 358 FIGLCVVTVIGALI-FGYTELKIAKDPILPLRFLKDR-SVLG--SSLSNWFCMMALMTVS 413
           F  +C++  I A+  F   E ++A   ILP   LK    V+G    LS+    + L  V 
Sbjct: 273 FKVVCLIVTIAAVAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGLFIV- 331

Query: 414 YYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG---------KYYWFVI 464
              P+Y   V        G  II    ST+ GS  +G+ +++ G              ++
Sbjct: 332 ---PLYLQVVWGTSVAGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLV 388

Query: 465 SFCVLASIGCL----QIVWIQPDI------SVFKQYTLMF---IPGLGASVLITVALLAM 511
           S  ++  +G       I+ I P+       S  +++  +    I G          +L  
Sbjct: 389 SSTLINVLGFAILFRNILSISPNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSVMLYT 448

Query: 512 IAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKS-----------KVLK 560
           +A V    QA +TS+++ FRS G  L VSI  +++  SL + L             K+LK
Sbjct: 449 VAKVGRKGQAASTSVTFLFRSLGNVLSVSIALSVYVASLKHDLTIYFEGQKTDLYFKLLK 508

Query: 561 FKS-------PEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCL 613
             +       PE    +L+++   A     W     PS      + C           C 
Sbjct: 509 ENAFLRSGSVPEDQLKDLLQLFKAAITDAFW-----PS------VGC-----------CF 546

Query: 614 LCTIAATFSMAIIKEHRLHNTLD 636
           L  I+AT    +++  R   +L+
Sbjct: 547 LSVISATVLFKLVQRSRYSESLN 569

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  131 bits (329), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 222/510 (43%), Gaps = 72/510 (14%)

Query: 114 ELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQ 173
            LS  +L I+ LS++LG FL++LD TIV+ ++  +A EF E  +  W+AT+YLL++  FQ
Sbjct: 31  NLSLPKLPIV-LSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQ 89

Query: 174 PIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXX 233
           P+YGK+SD+ GRK  ++  +  F +G L+   + S       R I               
Sbjct: 90  PLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSIT 149

Query: 234 XXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILI 293
             DI   R R +YQG  N  F             F D ++GWR+ F +Q+P     + L+
Sbjct: 150 VSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFID-TLGWRILFGLQVPTILLCSSLV 208

Query: 294 ILFLRLPKESKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTL------VLFLFSFMI 342
                       + + +  ++   ++ R     LS +D +G++TL      VLFL S  +
Sbjct: 209 -----------HKNVNIKLSHLLPVEERFKWSNLSRIDILGSSTLVFTISGVLFLCSTEL 257

Query: 343 TASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSN 402
             +L              L + TVI  + F   EL  +K+ I+P   LK    L S+ + 
Sbjct: 258 NKAL--------------LSIFTVISFIAFILIELYYSKERIMPFELLKGSFGLASAATV 303

Query: 403 WFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK---- 458
               +    + +  PIY   +  +  T  G  ++    S A GSL  G+ ++ T      
Sbjct: 304 ISSFIIFGDI-FRSPIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGWILRHTKMKLSH 362

Query: 459 -YYWFVISFCVLASIGCLQIVW----IQPDIS---VF------------KQYTLMFIPGL 498
             YW V     +  +G +   +    ++P +S   +F            + YT + I  L
Sbjct: 363 CAYWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSAIFGAFVQIGQNISSQSYTWVVIYAL 422

Query: 499 -------GASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLD 551
                  G + L+   L+ ++  +P + Q   T I Y +RS G  LG S+    + + + 
Sbjct: 423 ALILVSFGYACLLVATLVNIVFTIPKSQQGTVTGIFYLWRSIGNVLGASLTLVFYEKGVS 482

Query: 552 NLLKSKVLKFKSPEH--SEDELMRIIDKAS 579
           + L + +   +  ++  S+ E  +++   S
Sbjct: 483 SFLWNYMFNKQHDDYNFSKKEYRKLLSDTS 512

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 125/472 (26%), Positives = 206/472 (43%), Gaps = 64/472 (13%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+LS++LG F++ALD T+V+ ++  IA+EF E  +  W+AT+YLL++  FQP+YGK+SDI
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRKV +I  +  F +G L+   + +       R I                 DI   R 
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARE 163

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILI-----ILFL 297
           R +YQG  N  F            +  D S+GWR  F IQ+P+    ++L      I  +
Sbjct: 164 RGVYQGYANVVFGTGQLLGAPIGGFLLD-SIGWRSIFGIQVPMLMLCSVLALKNVNIKLV 222

Query: 298 RLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFM-ITASLGGKEIPYTSH 356
            +P  ++    +            LS +D  G+ +LV  +   + +T+S   K +     
Sbjct: 223 HIPPRNERFTWK-----------NLSRIDIFGSISLVATISGILFLTSSNWNKSL----- 266

Query: 357 KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYL 416
               L + TV+   +F Y EL +AK+ I+P   LK    L SS++       +    +  
Sbjct: 267 ----LGIFTVLSFSLFIYIELYVAKERIMPFELLKGSFGL-SSIATVITSFIIYGEIFRS 321

Query: 417 PIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG-----------------KY 459
           PIY   + N+  T  G  +I    + A GS+  G  ++ T                  + 
Sbjct: 322 PIYLQLIQNVSVTVTGLYLIFPSVAIALGSIVTGSILRNTKMDLAHCAAAIIFGGMIMQL 381

Query: 460 YWFVISFCVLASIG-CLQIVWIQPDISVFKQYTLMF----------------IPGLGASV 502
               +S+ +L+ +   L +  +  ++  F   T+ F                I   G + 
Sbjct: 382 AGLALSYYLLSHVNPALDLADLPANL--FSAATIYFVSDSIWWKIVYVGALVIGSSGYAS 439

Query: 503 LITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLL 554
           L+   L++++  V  + Q   T I Y +RS G  LG SI   +F  SL  +L
Sbjct: 440 LLVATLVSIVFTVDRSKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRML 491

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 126/458 (27%), Positives = 200/458 (43%), Gaps = 28/458 (6%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           +W+ TAYL++S +FQP+YG  SD  GR+  L F N TF +G L CG S +   L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS 278
                            D++P   R ++Q   N                 +  ++GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIAS-TIGWRWC 123

Query: 279 FLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLF 338
           FLIQ+PI+  S+IL+  ++   KE   +    + N F+  K  L+ +D +G+  ++  L 
Sbjct: 124 FLIQVPISMISSILMNYYVPNQKEYNDQ----NSNIFNDPKKILTGIDVMGSILIITGLT 179

Query: 339 SFMITASLG--GKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR--- 393
             ++  SLG     + +TS   + L   +VI  L+F   E K     I+P+  +      
Sbjct: 180 LQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSF 239

Query: 394 SVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI-IPNFFSTAFGSLGAGYY 452
            VL  S+   F   A +   + LP++F  VL       G R+ IP+ F T  GSL  G+ 
Sbjct: 240 VVLSISILVGFASYAYL---FTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGFS 295

Query: 453 MKKTG---KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPG-LGASVLITVAL 508
           M K        +  IS   L +   L I    P+  +    +L  IP  LG  +     L
Sbjct: 296 MSKYNCLRSLLYLGISLMFLGNFLFLFIEETSPNWLI----SLFLIPANLGQGITFPTTL 351

Query: 509 LAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSE 568
              I   P + QA  TS  Y FRS G   GV+I   + + S  N L + +         E
Sbjct: 352 FTFIFMFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGL----LDE 407

Query: 569 DELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACK 606
           + + +++ K S ++ ++  S    +K  +I  +  A K
Sbjct: 408 NTIKKLVIKLSDNSSYI-GSLHGEVKSAVIKSFDAATK 444

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  127 bits (318), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 131/481 (27%), Positives = 204/481 (42%), Gaps = 74/481 (15%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I++S++LG FL ALD TIV+ ++  IA EF E  +  W+AT++LL++  FQP+YGK+SD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 183 F-GRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
             GRK+  +     FF+G +I   + +      GR +                 DI   +
Sbjct: 102 ATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAK 161

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPK 301
            R +YQG  N  F                 ++GWR  F IQ+P+A F   L         
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGG-LLITTIGWRAIFAIQVPMALFCMFL--------- 211

Query: 302 ESKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTLV------LFLFSFMITASLGGKE 350
              GR + +   +  +   R     LS +D +G+ TLV      LFLFS           
Sbjct: 212 --TGRNVNIKLAHLPSRNERFTLKNLSRLDLLGSCTLVLSISGLLFLFS----------- 258

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALM 410
              TS     +   T++   IF Y E   AK+ I+P   L   S + S L+     +   
Sbjct: 259 ---TSMNRTWISAFTIVTFAIFIYNERFWAKERIIPFDLLCGTSGITSLLTVLSSFIMFG 315

Query: 411 TVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK-----YYWFVIS 465
            V +  PIY   V N+     G  I+    + A  S+  G+ +++T        Y  V+ 
Sbjct: 316 DV-FRSPIYLQIVQNVSLAKSGIFILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLV 374

Query: 466 FCVLASIG----CLQIVWIQPDISVFKQYTLMFIPGLGA--------------------- 500
              L  +G     + I  + P+ + +    +     L A                     
Sbjct: 375 MIFLQLVGTASNAILIANLIPNNTTYADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYG 434

Query: 501 SVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLK 560
            VL+ V L++++  VP + QA  T + Y +RS G  LG SI  A++    D +LKSK+  
Sbjct: 435 GVLVAV-LVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSITLALY----DLILKSKLRV 489

Query: 561 F 561
           F
Sbjct: 490 F 490

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  126 bits (317), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 138/562 (24%), Positives = 235/562 (41%), Gaps = 81/562 (14%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG FL+ALD TIV+ ++  +A +FN   +  W+AT+YLL++  FQP+YG++SDI
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK   +     F +GS +   S +       R +A                DI  ++ 
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRL--- 299
           R +YQG  N ++               DR +GWR  F  Q+P+   +  L   +L +   
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLIDR-IGWRALFAFQVPMVAVAMFLSFTYLNIKLA 246

Query: 300 ---PKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
              PKE + +               LS +D  G+ TLV+ +          G  I   S 
Sbjct: 247 HLPPKEERYKW------------KHLSKLDIFGSITLVITI----------GICIVILSD 284

Query: 357 KFIGLCVVTVIGALIFGY---TELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVS 413
             +   V+  +G L FG     E    K  ILPL+ L+  S   +SL+       +    
Sbjct: 285 NGLNRMVLGAMGLLSFGLFLIIEKYYTKHQILPLKCLQG-SFGYASLTIIISTYVIFGEY 343

Query: 414 YYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG------KYYWFVISFC 467
           +  PIY   + N   +  G  ++      A GS+  G  +K++        Y     S C
Sbjct: 344 FRTPIYLQVIQNFTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVC 403

Query: 468 VLASIGCLQIVWIQPDISVFKQYTLMFIPGLG---------------------------- 499
               +G L +  +   + +F        PG+G                            
Sbjct: 404 T-QFVGLLMLTLLINYLHIFNSNNTK--PGVGNIFHELTTVDFSWKIIFCIATSLVTFGY 460

Query: 500 ASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVL 559
           AS+L+   L++++  V  + Q   T + Y +RS G  LG SI    +    +N L SK+ 
Sbjct: 461 ASILVA-TLVSIVHTVEKSQQGSITGLFYLWRSLGNVLGTSITLITY----ENNLTSKLY 515

Query: 560 K--FKSPEHSEDELMRIIDKAS--QSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLL- 614
           K  F++PE   D +  I +  +  +++ ++++     + + L+  Y  A    +I  LL 
Sbjct: 516 KFMFENPEQHMDYIFTIEEYKALVKNSGYLRSHFSKDVVEELLAVYRNAFVQSYIPNLLI 575

Query: 615 CTIAATFSMAIIKEHR-LHNTL 635
           C++    S  +++ ++  H TL
Sbjct: 576 CSVGVVISYLLMRSYKPQHKTL 597

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  125 bits (315), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 123/471 (26%), Positives = 199/471 (42%), Gaps = 74/471 (15%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+LS++LG FL++LD+TIV+ ++  +A EF E  +  W+AT++LL++  FQP+YGK+SDI
Sbjct: 42  ILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDI 101

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  ++  +  F +G  +   + +       R I                 DI   R 
Sbjct: 102 TGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRE 161

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R +YQG  N  F             F D SVGWR+ F +Q+P+    + L          
Sbjct: 162 RGIYQGYANIVFGLGQLLGAPLGGLFID-SVGWRVIFGVQVPMLLLCSTL---------- 210

Query: 303 SKGRGLQVDGNYFSTIKVR-----LSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
              R + V   +    K R     LS +D  G+  LV  + S +   S        T+  
Sbjct: 211 -ATRNINVKLAHIPPRKERFTWKNLSRIDIFGSLALVGTISSLLFLTS--------TTLN 261

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVS---- 413
            I L +  +   ++F + EL  AK+ ILP   LK     GS     F + +L+TV+    
Sbjct: 262 KIVLTLSMIASFILFIWIELYYAKERILPFDLLK-----GS-----FGLCSLVTVASSFV 311

Query: 414 -----YYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCV 468
                +  PIY   V ++  T  G  ++    + A GSL  G+ ++ T K         +
Sbjct: 312 VFGDIFRSPIYLQLVQDISVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGII 371

Query: 469 LASIGCLQI---------------VWIQPDISVFKQYTL--------------MFIPGLG 499
           L  + C+Q+                 +  D S    +T               + +   G
Sbjct: 372 LGGV-CIQLCGLVIAYYLIKNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYG 430

Query: 500 ASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
            + L+   L++++  +  + Q   T I Y +RS G  LG S+   I+  SL
Sbjct: 431 YASLLVATLVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVIYENSL 481

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 139/575 (24%), Positives = 253/575 (44%), Gaps = 69/575 (12%)

Query: 103 IESRRISSKGTELSTARLKI-IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWV 161
           +E+  +  K  E + A  K  I+ S++LG FL++LD TIV+ ++  +A EF+E  R  W+
Sbjct: 17  VETLPLEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWI 76

Query: 162 ATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXX 221
           AT++LL++  FQP+YGK+SDI GRK  L+  +  F +G L+   + +       R I   
Sbjct: 77  ATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGI 136

Query: 222 XXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLI 281
                         DI   R R +YQG  N  F             F + ++GWR  F +
Sbjct: 137 GAGGLNAIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVFIE-TIGWRALFGV 195

Query: 282 QLPIAFFSTILII------LFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVL 335
           Q+P+    ++L I      LF   P + +            T+K  LS +D  G+ +LV 
Sbjct: 196 QVPVIMLCSVLAIKNINIKLFHVPPMKER-----------YTLK-NLSRIDIFGSLSLV- 242

Query: 336 FLFSFMITASLGGKEIPYTSH-KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS 394
                   A++ G     +SH   + L + T+   ++F   E   A + ILPL  L    
Sbjct: 243 --------ATISGVLFLCSSHLNKLYLTLFTIGSFIVFILVERYYATEKILPLELLTRSF 294

Query: 395 VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMK 454
            L S+++     +    + +  PIY   + N+  T  G  +I    S A GSL  G+ ++
Sbjct: 295 CLSSAVTVISSFVVFGEI-FRSPIYLQLLQNISVTKTGLFLIFPSVSVAVGSLVTGWLLR 353

Query: 455 KTG---------KYYWFVISFCVLASIGCLQIVWIQPDISVFKQ------------YTLM 493
            T            +  +I+  +   +G L + ++ PD +++              + L+
Sbjct: 354 NTKINLAHCAYQIIFGGMITQLLGLGLGYLLLAYLNPDYTIYDMLESITFESDSIWWKLI 413

Query: 494 FI-----PGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRE 548
           ++        G + L+   L++++  V  + Q   T + Y +RS G  LG S+    +  
Sbjct: 414 YVFASVLVSFGYACLLVATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYEN 473

Query: 549 SLDNLLKSKVLKFKSPEH---SEDELMRIIDKASQSTEWVQNSS-PSFIKQTLIDCYHFA 604
           SL ++L + + + K  +    ++ +   +I+     T +++  + P+ I   ++D Y   
Sbjct: 474 SLSSMLWNYMFETKRSDKYHFTKKQYYSLIND----TSYLRGPNFPTDIFVRILDIY--- 526

Query: 605 CKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
            K  F+   L  I       ++  + +H+T  R +
Sbjct: 527 -KKAFLISYLPNIVLAVVGIVLSFYLVHHTYKRTS 560

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 136/550 (24%), Positives = 240/550 (43%), Gaps = 60/550 (10%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG FL++LD+TIV+ ++  +A EF+E  +  W+AT++LL++  FQP+YGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GR+  L+     F +G L+   + +       R +                 DI   R 
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARE 157

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII------LF 296
           R +YQG  N  F             F + ++GWR  F +Q+P+    +IL I      LF
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGIFIE-TIGWRALFGVQVPMIIVCSILAIKNINIKLF 216

Query: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
              P + +            T+K  LS +D  G+ +LV         A++ G     +SH
Sbjct: 217 HVPPMKER-----------YTLK-NLSRIDIFGSLSLV---------ATISGVLFLCSSH 255

Query: 357 -KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYY 415
              I L + T+   ++F   E   A + ILP   L     L S+++     +    + + 
Sbjct: 256 MNKIYLALFTIGSFIVFVLVERYYATERILPFELLTGSFCLSSAVTVISSFVVFGEI-FR 314

Query: 416 LPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG---KYYWFVISFCVLAS- 471
            PIY   + N+  T  G  +I    S A GSL  G+ ++ T     +  + I F  + + 
Sbjct: 315 SPIYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKMNLAHCAYQIIFGGMVTQ 374

Query: 472 -----IGCLQIVWIQPDISV--------FKQYTLMF---------IPGLGASVLITVALL 509
                +G L +  + PD +V        FK +++ +         +   G + L+   L+
Sbjct: 375 LLGLGMGYLLLGHLYPDYTVYDMLESITFKSHSIWWKLIYVFASVLVSFGYACLLVATLV 434

Query: 510 AMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSED 569
           +++  V  + Q   T + Y +RS G  LG S+    +  SL ++L S + + K  +    
Sbjct: 435 SIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWSYMFERKRDDGYHF 494

Query: 570 ELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEH 629
              +     + S+   + + P+ I   ++D Y    K  F+   L  IA      ++  +
Sbjct: 495 TKKQYYSLINDSSYLRKPNFPTDIFVRILDVY----KKAFLISYLPNIALAVVGIVLSLY 550

Query: 630 RLHNTLDRDN 639
            + +TL R +
Sbjct: 551 LVKHTLKRSS 560

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  119 bits (297), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 99/339 (29%), Positives = 159/339 (46%), Gaps = 26/339 (7%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I++S++LG FL+++D+TIV+ ++  +A EF E     W+AT++LL++  FQP+YGK+SDI
Sbjct: 36  ILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDI 95

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+     F +G  +  LS + +     R I                 DI   ++
Sbjct: 96  TGRKFALLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKD 155

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTIL-----IILFL 297
           R +YQG  N  F             F   ++GWR  F IQ+P+   + IL      I  +
Sbjct: 156 RGIYQGYANIVFGMGQLLGAPVGGLFI-ATIGWRALFWIQVPLVIIAIILGEMYVNIKLV 214

Query: 298 RLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHK 357
            +P  S+    +            +S +D++G+ TLV  +  F+I  S        T   
Sbjct: 215 HVPPPSERFKWK-----------NISRIDFLGSFTLVSSITCFIILIS--------TKSN 255

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLP 417
            I L +++V+  + F Y EL ++KD ILP   LK  S   +S++       +    +  P
Sbjct: 256 VILLSLLSVLSFIAFIYVELYVSKDRILPFELLKG-SFGCNSIATVISSYVIFGEIFRSP 314

Query: 418 IYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKT 456
           IY   V +      G  +I    +TA GSL  G  +K+T
Sbjct: 315 IYLQLVQDFSVIKTGIFLIFPAITTAIGSLVTGAILKRT 353

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 120/464 (25%), Positives = 200/464 (43%), Gaps = 59/464 (12%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG F ++LD+TIV+ ++  +A EF E  +  W+AT++LL++  FQP+YGK+SDI
Sbjct: 45  ILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDI 104

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  ++  +  F +G L+   + +       R I                 DI   R 
Sbjct: 105 TGRKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRE 164

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R ++QG  N  F             F D  +GWR  F IQ+P+  F + L I  + +   
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGLFLDH-IGWRTLFGIQVPMIMFCSYLTITNVNI--- 220

Query: 303 SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLC 362
              + L V           LS +D  G+ +LV  +   +   S        T    + L 
Sbjct: 221 ---KLLHVPPRKERFTWKNLSRIDIFGSLSLVATISGILFLTS--------TQLDKLLLS 269

Query: 363 VVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYL------ 416
           + T I   +F + EL  AK+ ILP   L          S   C +  +  SY +      
Sbjct: 270 LFTFISFGLFMWIELYYAKERILPFDLLNG--------SFGLCSVVTVISSYVVFGDIFR 321

Query: 417 -PIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK-----YYWFVISFCVLA 470
            PIY   + ++  T  G  +I    + A GSL  G+ ++ T K      Y  ++S  ++ 
Sbjct: 322 SPIYLQLIQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKNLSHCAYGIILSGVIIQ 381

Query: 471 SIGC----LQIVWIQPDI----SVF-----------KQYTLMFIPGL-----GASVLITV 506
             G     L I  + P +    +VF           + + ++F+  L     G S ++  
Sbjct: 382 LAGLVIAYLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVA 441

Query: 507 ALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
            L++++  +  + Q   T I Y +RS G  LG S+   ++R +L
Sbjct: 442 TLVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTL 485

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 129/499 (25%), Positives = 212/499 (42%), Gaps = 83/499 (16%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I++S++LG FL ALD TIV+ ++  IA EF E  +  W+AT++LL++  FQP+YGK+SD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 183 F-GRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
             GRK   +     F +G +I   + +      GR +                 DI   +
Sbjct: 102 ATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAK 161

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILI-----ILF 296
            R +YQG  N  F                 ++GWR  F IQ+P+     +L      I  
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGG-LLITTLGWRAIFAIQVPVTLLCMVLAFRNVNIKL 220

Query: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV------LFLFSFMITASLGGKE 350
             LP   +   L+            LS +D +G+ TLV      LFLFS           
Sbjct: 221 AHLPPPKECFTLK-----------NLSRLDLLGSCTLVMSISGLLFLFS----------- 258

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS--NWFCMMA 408
              T+   + + + T +   +F Y E   A + I+P   L+  S + S+L+  + F M  
Sbjct: 259 ---TTLNKLWISIFTAVSFGLFVYNEYYWATERIIPFELLRGESGVTSALTVLSSFVMFG 315

Query: 409 LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK---------Y 459
            +  S   PIY   V N+     G  I+    + A  S+  G+ +++T            
Sbjct: 316 DVFRS---PIYLQVVQNVSLARSGLFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIV 372

Query: 460 YWFVISFCVLASIGCLQIVWIQPDIS----------------------VFKQYTLMFIPG 497
              +IS     +I  + I  ++P+ +                      ++   T++   G
Sbjct: 373 LGMIISQLAGTAINAVLIAKLKPNQTSHALTDSITQQTLQPEGLLWKIIYVSATVLNTFG 432

Query: 498 LGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSK 557
            G  VL+ V L++++  VP + QA  T + Y +RS G  LG S+   ++    D  LK+K
Sbjct: 433 YGG-VLVAV-LVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSVTLTLY----DLTLKAK 486

Query: 558 VLKFKSPE---HSEDELMR 573
           + K+ S      S  +L+R
Sbjct: 487 LWKYMSSNGLSSSYTQLIR 505

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  119 bits (297), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 130/481 (27%), Positives = 210/481 (43%), Gaps = 29/481 (6%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           +W+ TAYL++S +FQP+YG  SD  GR+  L F N  F +G L CG S +   L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS 278
                            D++P   R ++Q   N                 +  S+GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIAS-SIGWRWC 123

Query: 279 FLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLF 338
           FLIQ+PI+  S+IL+  ++   KE      + + + F      L  +D +G+  ++  L 
Sbjct: 124 FLIQVPISVISSILMNYYVPNQKEYN----RQNSSIFQNPGKILRDIDVMGSILIITGLT 179

Query: 339 SFMITASLG--GKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR--- 393
             ++  SLG    ++ +TS   + L V +VI  L+F   E K +   I+P+  +      
Sbjct: 180 LQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSV 239

Query: 394 SVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI-IPNFFSTAFGSLGAGYY 452
            VL  S+   F   A +   + LP++F  VL       G R+ IP+ F T  GSL  G+ 
Sbjct: 240 VVLSISILVGFASYAYL---FTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGFS 295

Query: 453 MKKTG---KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPG-LGASVLITVAL 508
           M K        +  IS   L +   L I    P+  +     L  IP  LG  +     L
Sbjct: 296 MSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLI----GLFLIPANLGQGITFPTTL 351

Query: 509 LAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSE 568
              I     + QA  TS  Y FRS G   GV+I   + + S   LL+S +         E
Sbjct: 352 FTFIFMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGL----LDE 407

Query: 569 DELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKE 628
           +++ ++I + S ++ ++  S    +K T+I  +  A K   +   L +  A   + I+K+
Sbjct: 408 NKIKKLIVQLSANSSYI-GSLHGEVKNTVIKSFDEATKRAHLMSTLLSSLALI-LCILKD 465

Query: 629 H 629
           +
Sbjct: 466 N 466

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  119 bits (299), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 131/556 (23%), Positives = 233/556 (41%), Gaps = 68/556 (12%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S++LG FL++LD+TIV+ ++  +A EF+E  +  W+AT++LL++  FQP+YGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+     F +G L+   + +       R I                 DI   R 
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII------LF 296
           R +YQG  N  F             F + ++GWR  F IQ+P+    ++L I      LF
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIE-TIGWRALFGIQVPVIMLCSVLAIKNINIKLF 216

Query: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
              P + +            T+K  LS +D  G+ +LV         A++ G     +S 
Sbjct: 217 HVPPMKER-----------YTLK-NLSRIDIFGSLSLV---------ATISGVLFLCSSQ 255

Query: 357 -KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYY 415
              + L + T+   ++F   E   A + ILP   L     L S+++     +    + + 
Sbjct: 256 LNKLYLALFTIGSFIVFILVERYYATEKILPFELLTRSFCLSSAVTVISSFVVFGEI-FR 314

Query: 416 LPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCL 475
            PIY   + N+  T  G  +I    S A GSL  G+ ++ T       ++ C    I   
Sbjct: 315 SPIYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGG 370

Query: 476 QIVW-------------IQPDISVFKQ------------YTLMFI-----PGLGASVLIT 505
            I+              + PD +++              + L+++        G + L+ 
Sbjct: 371 MIMQLLGLGLGYFLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLV 430

Query: 506 VALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPE 565
             L++++  V  + Q   T + Y +RS G  LG S+    +  SL ++L + + K K  +
Sbjct: 431 ATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDD 490

Query: 566 HSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAI 625
                  +     + S+     + P+ I   ++D Y    K  F+   +  IA      +
Sbjct: 491 EYHFTKKQYYSLINDSSYLRGPNFPTDIFVRILDVY----KKAFLISYIPNIALAAVGIV 546

Query: 626 IKEHRLHNTLDRDNEN 641
           +  + + +T  R + +
Sbjct: 547 LSLYLVKHTYKRSSSS 562

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 140/569 (24%), Positives = 241/569 (42%), Gaps = 65/569 (11%)

Query: 99  HYGAIESRRISSKGTELS---TARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNEL 155
           H GA+E  +   +  E+        K ++ S++    L+ALD TIVST +  +AS F + 
Sbjct: 77  HSGALEGNKEDEEDLEIDLRDPKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQQA 136

Query: 156 PRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAG 215
             ++WVATAYLL++   QP+YGKISDI GR+  L+F  I F VG  +C  S S   L   
Sbjct: 137 SMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIA 196

Query: 216 RFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQG----ICNFYFXXXXXXXXXXXXWFSDR 271
           R I                 D+ PL  R  Y G    +   +             +F   
Sbjct: 197 RGICGIGGSGTGAMTNIILSDMAPLSERGKYWGYGSMLGGVFQSLGGPLGGILLTYFGVS 256

Query: 272 SVGWRMSFLIQLPIAFFSTILIILFLR-LPKESKGRGLQVDGNYFSTIKVRLSAVDWIGA 330
            +     F+ Q+P    +  L   +++   +++KG   ++D      + V +S+      
Sbjct: 257 GL-----FIPQIPFCLATLYLSWKYVQDYNQDTKGSWKRIDFGGSICLLVGISS------ 305

Query: 331 TTLVLFLFSFMITASLGGKE--IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLR 388
               +F FS     S+       PY    F     + V+  ++F   E  +A + I+P+ 
Sbjct: 306 ---FIFFFSADENPSISEHSGWSPYKKWSF----AIFVLFTILFLVVEKYVALENIIPME 358

Query: 389 FLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLG 448
            LK    L + +     M+   T  + +P++   V  +  +  G  I+    S + GSL 
Sbjct: 359 VLKGTLGLLAFIQGLVSMIN-YTELFIVPLFLQLVWGISVSTSGAYIVCIVISYSVGSLL 417

Query: 449 AGYYMKKTGK------YYWFVISFCVLASIGCLQIVWIQPDISVFK------------QY 490
           +G  +KK  K       Y+  +S   ++ I  +   ++   +   K             +
Sbjct: 418 SGALIKKVAKPSRESTIYYSGVSIFYMSLISMVGYYFLDRAVRYTKPVYGDTKVPESLNF 477

Query: 491 TLMF---IPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFR 547
            L+F   + GL         +L  +A V    QA +TS+ + FRS G  L VS+   +F 
Sbjct: 478 QLIFGITLLGLCQGSQGVTIMLYNVAKVGRKGQASSTSVQFLFRSLGNVLSVSLAFNVFT 537

Query: 548 ESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSS-PSFIKQTLIDCYHFACK 606
            +L   L  KVL  K+     DEL  ++ K      +++N   P+    ++++ +H A  
Sbjct: 538 NALRKTL-GKVLAGKN-----DELFALLLK---DNAFLRNKDMPTDDLDSILEAFHKALV 588

Query: 607 NVFIFCLLCTI-----AATFSMAIIKEHR 630
           + F+ C+ C I     +    +A+ K++R
Sbjct: 589 SSFVPCIWCLILSVIFSGVLWIAVRKQYR 617

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 133/547 (24%), Positives = 236/547 (43%), Gaps = 60/547 (10%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I+ S+++G FL +LD+TIV+ ++  +A EF E  +  W+ T++LL++  FQP+YGK+SD+
Sbjct: 42  ILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GRK  L+  +  F VG L   LS +       R +                 DI   + 
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKE 161

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R +YQG  N  F            W  D S GW++ F  Q+P+     I+  +FL   + 
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLMD-SFGWKVIFAGQVPL-----IMTCMFLGY-RN 214

Query: 303 SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLC 362
              + L V   +       +  +D  G+ +L+  +  F+   S        T      L 
Sbjct: 215 VNIKLLHVPPRHERYRWENIKRIDLGGSISLIGTISGFLCLCS--------TDLNKPLLA 266

Query: 363 VVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAG 422
            +T++  ++F   EL  A + I+P   L     + S L+ +   +A   V +  P+Y   
Sbjct: 267 TLTLLSLVLFIMNELYWAPERIIPTDLLSGTFGITSLLTVFSSFIAFGDV-FRNPVYLQL 325

Query: 423 VLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG------KYYWFVISFC---VLASIG 473
           V N+ PT  G  ++ +  S+A  SL  G+ ++ T        Y    I+ C   +  S+G
Sbjct: 326 VQNISPTSTGGFLLFSSISSALASLATGWILRNTSLGLATCSYLLITIAVCLHFISLSLG 385

Query: 474 CLQIVWIQPDISV------------------FKQYTL----MFIPGLGASVLITVALLAM 511
              I  ++P+ +                   F+   L    M +   G + L+   L+++
Sbjct: 386 YTTISHLEPNPTSHVSALDTSGTNYWFTSNQFRWRVLYVIAMILNSWGYASLLVATLVSI 445

Query: 512 IAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDEL 571
           +  +P + QA  T   Y +RS G  LG S    IF  S      +K+ ++  P + + E 
Sbjct: 446 VFTIPKSQQATITGCFYLWRSIGTVLGASSVLTIFESS----ATTKLYQYLHPINMDKEY 501

Query: 572 MRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRL 631
             +I      T +++N     I + L++ Y+      F+   + T A +  +A+I   +L
Sbjct: 502 ESLI----HDTSFLRNHFSGKILRDLLEIYN----ESFLISYIPTFAVSI-LALIIAFKL 552

Query: 632 HNTLDRD 638
             + D++
Sbjct: 553 FISCDKE 559

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score =  111 bits (277), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 108/458 (23%), Positives = 194/458 (42%), Gaps = 28/458 (6%)

Query: 131 IFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           +F+ ALD  IV T++  + + F +  +  W+ T Y L +A F  ++G++S + G ++ +I
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGIC 250
            C I F  GSLI  L+ S   L++GR IA                 +V  ++R L   + 
Sbjct: 114 SCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLL 173

Query: 251 NFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESK--GRGL 308
           N  F             F+   V WR  F I LPI   + I I +F   P+ +    +G 
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA-IAIFIFFYNPEGADLLEKGS 231

Query: 309 QVDGNYFSTIKVRLSAVDWI-----GATTLVLFLFS-----FMITASLGGKEIPYTSHKF 358
           Q      S  +  LS    +     G   +   LF+     F++  + GG+  P+ S   
Sbjct: 232 QTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIV 291

Query: 359 IGLCVVTVI---GALIFGYTELKIAKD-----PILPLRFLKDRSVLGSSLSNWFCMMALM 410
           I   +V V+    +LI+ +      K      P+L    +  R++L ++ + +F  +A  
Sbjct: 292 ISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYN 351

Query: 411 TVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLA 470
               Y   +F  V        G  +IP   ST   S+ +G  +KKTG     ++    + 
Sbjct: 352 VQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMG 411

Query: 471 SIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV------TT 524
            +G   ++ +    +   Q  ++ +PG+    ++  AL+     +     +       TT
Sbjct: 412 VLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETT 471

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFK 562
           S++   +S G T+G  +   +F  SL N +K+  + F+
Sbjct: 472 SVNALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILFE 509

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 126/556 (22%), Positives = 233/556 (41%), Gaps = 66/556 (11%)

Query: 104 ESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVAT 163
           E++R       L  A    I+ S++LG FLA++D +IV+ ++  IA EF+E  +  W+AT
Sbjct: 30  ETQRCQEHNRSLPKAP---ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMAT 86

Query: 164 AYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXX 223
           ++LL++A FQP+YG+ SDI GRK  L+     F +G+L+   + +       R I     
Sbjct: 87  SFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGG 146

Query: 224 XXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQL 283
                       DI   + R +YQG  N  F               + +  WR+ F  Q+
Sbjct: 147 GGIGAMSSITVSDICTTKERGMYQGYANVIFGAGQVLGAPVGGLIME-TFNWRIIFAAQV 205

Query: 284 PIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMIT 343
                  IL    + L      + L +   +    +  LS +D  G++ L   L SF++ 
Sbjct: 206 VAIMICMILAYRNINL------KLLHIPPFHQRFTRKNLSRIDLFGSSMLSCSLVSFLML 259

Query: 344 ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSL--S 401
            S G     +         ++T++   +F   E  IA + +LP   L+    L + L   
Sbjct: 260 FSSGVSRSLWF--------LLTLVSLTLFCINERYIATERLLPNGILRGHFGLSALLIVV 311

Query: 402 NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW 461
           + F M A +   Y +P+Y   + ++  +  G  ++    S++  SL  G+ ++ T +   
Sbjct: 312 SSFMMFAEL---YRMPVYLQLIQDISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLG 368

Query: 462 FVISFCVLASIGCLQIVWI----------QPDISVFKQYTLMFIP------------GLG 499
            ++    LAS   +Q+V +          +P  +V   +  +F P             + 
Sbjct: 369 KLVYKIALAS-SFIQLVGMMLALFTTSVTEPSQAVHAGWA-VFSPRSAGQMHYFKSDSIA 426

Query: 500 ASVLITVALL---------------AMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGA 544
             VL+TVAL+               +++     + QA    + Y +RS G TLG S+  +
Sbjct: 427 WRVLLTVALMCSSFAYASLLVSILVSIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLS 486

Query: 545 IFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFA 604
           ++   +      K+  +   +   D  + ++  +S   +  +N + + + Q    C+  +
Sbjct: 487 VYEFEVAR----KLWDYMEAQGLRDTYLDLLHDSSILRQRFRNHTLAALLQIYRSCFQVS 542

Query: 605 CKNVFIFCLLCTIAAT 620
                  C+L  +AAT
Sbjct: 543 YLPSICVCILGILAAT 558

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score =  106 bits (264), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 156/717 (21%), Positives = 270/717 (37%), Gaps = 108/717 (15%)

Query: 1   MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDG------TESFVQTLAETSQLTK 54
           MG+KDKQRK+LR+F K K KQ Q   +  +                S  QT+ E      
Sbjct: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60

Query: 55  EDDENSVLLPI-----------------------------------------------RD 67
           ED++++ L P+                                                +
Sbjct: 61  EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDDN 120

Query: 68  ELLQDPST-----ELPGFIAAXXXXXXXXXXXTRSGHYGAIESR------RISSKGTELS 116
           +L+++PS      E     A+             S  YG+IE R        + +  +L 
Sbjct: 121 QLIEEPSRPQSSREEISSSASTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLE 180

Query: 117 TARLKIIMLS-----------MYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAY 165
           T    I +L+             L +F    D T+   L     S   +    SW+  +Y
Sbjct: 181 TNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWIIASY 240

Query: 166 LLSSATFQPIYGKISDIFGRKVVLIFC-NITFFVGSLICGL-SPSFEWLVAGRFIAXXXX 223
           L++    Q +  ++S  +     L +   + F +GS I  + + SF W+V  RFI     
Sbjct: 241 LITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLAS 300

Query: 224 XXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQL 283
                         + L  R     +  F                   S  W+  + +  
Sbjct: 301 GSLIYVMLTIINKCI-LNKRFSRPSMKIFTIPIVGGLSLAYATAIFITS--WQNVYFLLA 357

Query: 284 PIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMIT 343
             +FF+  LI+ +            + +    S+I   L  +D IG T L +FL    + 
Sbjct: 358 IFSFFTLFLIMFYF-----PSNESYKTNNTNLSSIVATLD-IDLIGCTILSVFLLLIAVI 411

Query: 344 ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNW 403
            +        TS     L +  ++  ++   +E    K+PI+PL F++++ +   SL+ +
Sbjct: 412 TTGNSNGFSITSPYSATLVISIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKSLTVF 471

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKY-YWF 462
           F  M+L+T  +Y P Y    LN+   DI KR  P F +  F  +     +       Y  
Sbjct: 472 FASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGL 531

Query: 463 VISFCVLASIG-CLQIVWIQPDIS---VFKQYTLMFIPGLGASVLITVALLAMIAAVPHN 518
           V  F ++  IG C+ + ++  D +   ++KQ  +  +P LG++ L+   L+ +       
Sbjct: 532 VTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDV---TDDK 588

Query: 519 HQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDE--LMRIID 576
              + ++ S+A  + G  LG+ I G IF + L + L           HS +E  L +II 
Sbjct: 589 KLPIISTSSFAVSTLGSILGICISGFIFNQGLYDELWV---------HSTEEKGLGKIIR 639

Query: 577 KASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAI-IKEHRLH 632
           K   ++E+   SS  +    +++ Y      VF+F  +C + A  S    IK  R H
Sbjct: 640 KMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH 694

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 105/460 (22%), Positives = 190/460 (41%), Gaps = 32/460 (6%)

Query: 131 IFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           +F+ ALD  IV T++  +   F +  +  W+ T Y L +A F  ++ ++S + G ++ ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGIC 250
            C I F  GSLI  L+ S   L+AGR +A                 +V  ++R L   + 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 251 NFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQV 310
           N  F             F+   V WR  F I LPI   + I I +F   P+      L+ 
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA-IAIFVFFYNPEGV--NLLEK 229

Query: 311 DGNYFSTI--------------KVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
            GN F  +              +  L   D +   +       F++  + GG+   + S 
Sbjct: 230 FGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSG 289

Query: 357 ---KFIGLCVVTVIGALIFGYTELKIAKD-----PILPLRFLKDRSVLGSSLSNWFCMMA 408
               FI + V+ +  +L++ +   +  K      P+L    + +RS+L S+ + +F  +A
Sbjct: 290 IVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVA 349

Query: 409 LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCV 468
                 Y   +F  V        G  +IP   ST   S+ +G   KKTG     ++    
Sbjct: 350 YNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSA 409

Query: 469 LASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV------ 522
           +  +G   +  +    +   Q  ++ +PG+    ++  AL+A    +   + +       
Sbjct: 410 MGVLGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLE 469

Query: 523 TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFK 562
           TTS++   +S G TLG  +   +F  S++N +K   L  +
Sbjct: 470 TTSVNALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLE 509

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 155/335 (46%), Gaps = 18/335 (5%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           ++LS+++  FLA++D TI++ ++  +  EF E  RI WVAT++LL+S  FQPIYGK+SD+
Sbjct: 49  MLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDV 108

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
            GR+ VL+     F +G L+   + +      GR I                 D+  ++ 
Sbjct: 109 TGRRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKE 168

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           +++YQ   +  +              +  +VGWR  FL Q+P+     + I ++L L  +
Sbjct: 169 QSIYQSYAHIIYTIGEVLGAPIGG-IALETVGWRAIFLAQVPV-----LTICIYLTLCDD 222

Query: 303 SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLC 362
              +          T K  +S +D  G+  L++ L   ++ +S     I Y    ++ L 
Sbjct: 223 DLAQQHIPPHGERLTWK-NISRMDLSGSILLIISLCGVILLSS--ATIIEY----WMWLL 275

Query: 363 VVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMAL-MTVSYYLPIYFA 421
           V+   G  I    EL    + I+P R LK    +G +         +  +  Y  P++  
Sbjct: 276 VIASAGLFIIN--ELYWVSECIIPFRKLK--GAIGLTSLLLLVSSFIEYSELYRTPLFLQ 331

Query: 422 GVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKT 456
            V NM  +  G  ++ +  ++A  +L +G+ ++ T
Sbjct: 332 LVQNMSTSTTGVVLLFSSAASAVATLLSGWVLRTT 366

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 106/474 (22%), Positives = 193/474 (40%), Gaps = 33/474 (6%)

Query: 131 IFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           +F+ ALD  IV T++  +   F +  +  W+ T Y L +A F  ++G+IS   G ++ ++
Sbjct: 53  MFVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIV 112

Query: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGIC 250
            C + F  GSLI  L+ S   L+AGR ++                 +V  ++R L   + 
Sbjct: 113 ACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 172

Query: 251 NFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILF--------LRLPKE 302
           N  F             F+   V WR  F I LPI   + +  + F        L   K+
Sbjct: 173 NCTFAIASIIGPFIGGAFTTH-VTWRWCFYINLPIGGVAILTFLCFYNPHNENLLEEGKK 231

Query: 303 SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFS---FMITASLGGKEIPYTSH--- 356
           +  R L+       + K     +      +  LF      F++  + GG+   + S    
Sbjct: 232 AFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSGVVI 291

Query: 357 KFIGLCVVTVIGALIFGYTELKIAKD-----PILPLRFLKDRSVLGSSLSNWFCMMALMT 411
            F+ + ++ ++ +L + +   +  K      P+L  R +   +++ S+ S +F  +A   
Sbjct: 292 SFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVAYNV 351

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLAS 471
              Y   +F  V        G  +IP   ST   S+ +G   KKTG     ++    +  
Sbjct: 352 QMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVFGSAMGV 411

Query: 472 IGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV------TTS 525
           +G   +  +    +   Q  ++ +PG+    ++  AL+A    +  ++          TS
Sbjct: 412 LGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGADMLEVTS 471

Query: 526 ISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKAS 579
           ++   +S G TLG  +   IF  S+ N       K KS   S +E M++   AS
Sbjct: 472 VNALLKSLGTTLGSILSTMIFSTSMYN-------KMKSRGMSLEEYMKLDGIAS 518

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 135/562 (24%), Positives = 221/562 (39%), Gaps = 58/562 (10%)

Query: 124 MLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIF 183
           ++S+ L IFLAALD  IVST++ ++A EF +  +  W+   Y L SA    I+G+I+ + 
Sbjct: 58  VISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVC 117

Query: 184 GRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNR 243
           G K  ++   I F VGSL+  L+ S + L+ GR IA                 +V    R
Sbjct: 118 GFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKR 177

Query: 244 ALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKES 303
            L        F             F+   V WR  F I LPI   +    ILF   P  S
Sbjct: 178 GLLIACMGSAFGIASVVGPFLGGAFTTH-VTWRWCFWINLPIGGLAFAFFILFYN-PHGS 235

Query: 304 K--------------GRGLQVDGNYFSTIKVRLSAVDWIGATTLVLF------LFSFMIT 343
                          G  L+  G        R+   + I    ++ F      L   ++ 
Sbjct: 236 DQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIYKFDIIEFALCTTGLVLILLA 295

Query: 344 ASLGGKEIPYTSHKFIGLCVVTV---IGALIFGYT---ELKIAKD-----PILPLRFLKD 392
            S GG +  + S   I + V+ +   I AL++ +     LK+ ++     P++PLR  K 
Sbjct: 296 LSFGGNKYAWNSGSTIAMFVIGILVTILALVYDFAIFPRLKVVRENPRYQPLIPLRVAKK 355

Query: 393 RSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYY 452
             +  ++++ +F  MA M    Y+  +F  + N         +I     T    + +G  
Sbjct: 356 FFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKASIHVIACVVPTVITVITSGIL 415

Query: 453 MKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGL--GASVLITVALLA 510
             K G      +     A +G   +  +    +  +   L+ +PG+  GA++  T+    
Sbjct: 416 NSKFGIVKPINVLGITAAIVGAGLLTLLTNKSTNSEHIGLLILPGVAFGATMQSTLIGSQ 475

Query: 511 MIAAVPHNHQ-----AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPE 565
           +       H      AVTT  ++  ++ G   G  +   +F  S+ N LK   +     +
Sbjct: 476 IQLDKKSTHYRMDFIAVTTMNNF-LKNLGQAFGGVLCNTVFTTSILNKLKQNDITIG--D 532

Query: 566 HSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAI 625
           H+  + + I  +AS       + S S +   + D    + KNVF  CL C  A  F   I
Sbjct: 533 HTTSDAL-ISYRASHF-----DGSTSLLGNLISD----SIKNVFYMCLGCA-AIAFIFGI 581

Query: 626 I---KEHRLHN-TLDRDNENEE 643
               K+  LH  T D   E   
Sbjct: 582 FSSNKKSELHKPTSDTQKETSS 603

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 119/531 (22%), Positives = 212/531 (39%), Gaps = 55/531 (10%)

Query: 126 SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGR 185
           S+ L +FLAALD   VST++  ++ +F +  ++ W+ T Y L +A    I+G+I+ + G 
Sbjct: 48  SLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGF 107

Query: 186 KVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRAL 245
           K   +   + F VGSL+  L+ S + L+ GR IA                 +V  RNR L
Sbjct: 108 KTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNRGL 167

Query: 246 YQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPK---- 301
              + +  F             F+   V WR  F I LP+   +  L + F    K    
Sbjct: 168 IIAVMSSSFGIASVVGPFLGGAFTTH-VTWRWCFYINLPVGGLAFFLFLTFYNPEKWVVN 226

Query: 302 ------ESKGRG----LQVDGN----YFSTIKVRLSAVDWIGATTLV---LFL------F 338
                 E  G G    L + G     +  ++ V+L+ + + G   ++   LF       F
Sbjct: 227 KDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGTWRIIARELFYRFDIVEF 286

Query: 339 SFMITASL--------GGKEIPYTSHKFIGLCVVTV---IGALIFG---YTELKIAK--- 381
            FM   S+        GG +  + S   I + V+ +   +GA ++    Y + +  K   
Sbjct: 287 VFMTLGSVLILLAFTFGGNKYKWNSGSTISMFVLGILFTLGAFVYDFFIYPKFEAVKTVP 346

Query: 382 --DPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF 439
              P++     K   V   +++ +F   A    + Y+  YF  V N         +I   
Sbjct: 347 HYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLVFNDTAWKAAIHLIATV 406

Query: 440 FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGL- 498
                  + +G    KTG      I   V   IG   +  +    S  K+  L+ +PG+ 
Sbjct: 407 VPVVITVVSSGIVNSKTGYVKPIAIFSGVTGIIGAGLLTLLDNHASSAKKIGLLILPGVT 466

Query: 499 -GA---SVLITVALLAMIAAVPHNHQAVTTSISYAF-RSTGCTLGVSIGGAIFRESLDNL 553
            GA   S +I V +L   ++  + +  +  +   AF ++ G   G  +   +F  S  NL
Sbjct: 467 FGAIMQSSIIGVQILLDKSSPTYRYDFIAVTTLNAFIKNIGQAYGAVLCDTVFSASAINL 526

Query: 554 LKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFA 604
           +K + +    P   E     +I    +  +   ++  + I  ++I+ ++ A
Sbjct: 527 MKKRHVSL--PGGYETSANNLIIARREYFDGPTSAIGNIISDSIINVFYMA 575

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 102/468 (21%), Positives = 183/468 (39%), Gaps = 48/468 (10%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IVST++  +A +F     I W+ T Y L +A    I+G+I+   G K  ++F  + F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            VGSLI  L+ S   L+ GR IA                ++V   NR +   I +  F  
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILF---------------LRLPK 301
                      F+ R V WR  F I LPI   +  L ++F               LR+P 
Sbjct: 212 ASVVGPFLGGVFTSR-VTWRWCFYINLPIGGLTFFLFLMFCNPDPHTFQETVRNILRIPS 270

Query: 302 ESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLF-------------SFMITASLGG 348
           +      +V G++ S +K       W    T ++F++             S ++  + GG
Sbjct: 271 QLIEFVRKV-GHHLSKVKELGKRTSWKILLTELVFMYDIIEFVLCTAGFTSILLAFTFGG 329

Query: 349 KEIPYTSHKFIGLCVVTVIGALI------FGYTELKIAK-----DPILPLRFLKDRSVLG 397
               + S + I L V+ VI  ++      F + +  + K      P++  R +K   +  
Sbjct: 330 NRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVVKTAPRYQPLMSWRNIKRPGIFT 389

Query: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG 457
            +++ +      ++   Y+  YF  + N         ++     T   S+  G    KT 
Sbjct: 390 VNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHLVACIIPTVITSVVCGVITDKTR 449

Query: 458 KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVP- 516
           +    ++   +L  +G   +  +    S      L+ +PG+    L+  ++LA    +  
Sbjct: 450 QIKPIIVISSILGVVGAGLLTLLNNSASNSAHIGLLILPGIAFGGLMQSSMLASQIQLDK 509

Query: 517 -----HNHQAVTTSISYAFRSTGCTLGVSIGGAIFR-ESLDNLLKSKV 558
                H+     T+ S   ++ G  LG  I   +F   +++ L KS +
Sbjct: 510 ESPTFHSDFVSITTFSTFSKNLGQALGGVISNTVFSAAAVNKLHKSNI 557

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 130/528 (24%), Positives = 215/528 (40%), Gaps = 53/528 (10%)

Query: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPI 175
           ST  L + ++S+ L +FLAALD  IV TL   I  +F++   I W+ T Y LS+A F  +
Sbjct: 3   STLSLTLCVISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLL 62

Query: 176 YGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXX 235
           +G++++I G K  L+   I F +GSLI  LS S   L++GR +A                
Sbjct: 63  WGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGT 122

Query: 236 DIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
            IV   +R +        +             F++  + WR  F I LPI  F+ I++  
Sbjct: 123 SIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAFIILAF 181

Query: 296 F---------LRLPKESK-----GRGLQVDGNYF-STIKVRLSAVDWIGATTLVLFLFSF 340
                     + LP + K       G  +  +++ +T +V +  +D +G           
Sbjct: 182 CNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLL 241

Query: 341 MITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAK-----------DPILPLRF 389
           M+  S GG   P+ S   I    V  I  L+F   +                 P+L    
Sbjct: 242 MLGLSFGGNNFPWNSGIIICFFTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNI 301

Query: 390 LKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPT----DIGKRIIPNFFST-AF 444
             +  +  SS++ +    A    S YL   +  V   KPT     + +  IP   +T A 
Sbjct: 302 ASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAI 361

Query: 445 GSLGAGYYMKKTGKYYWFVISFCVLASI-GCLQIVWIQPDISVFKQYTLMFIPGLGASVL 503
             L + Y + K        I F VL  I G      I  ++S    Y+++  PG+    +
Sbjct: 362 AYLNSKYGIIKP------AIVFGVLCGIVGSGLFTLINGELSQSIGYSIL--PGIAFGSI 413

Query: 504 ITVALLAMIAAVPHNHQ-------AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKS 556
               LL+    +  +          VT   S+A +S G   G ++G  IF  SL N ++S
Sbjct: 414 FQATLLSSQVQITSDDPDFQNKFIEVTAFNSFA-KSLGFAFGGNMGAMIFTASLKNQMRS 472

Query: 557 KVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFA 604
             L    P+ +  E   ++  +++  +  Q+S   FI   + D ++ A
Sbjct: 473 SQLNI--PQFTSVE--TLLAYSTEHYDGPQSSLSKFINTAIHDVFYCA 516

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 112/533 (21%), Positives = 206/533 (38%), Gaps = 42/533 (7%)

Query: 120 LKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI 179
           L + + S+ L +F+ ALD  IV T++  +A +F    +  W+ T Y L +A    ++G+ 
Sbjct: 34  LYLCLTSLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRF 93

Query: 180 SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVP 239
           + I G +  LI   + F  GSL+  L+ S   L+ GR +A                 +V 
Sbjct: 94  ASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVN 153

Query: 240 LRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRL 299
            R+R L   I +  F             F+   V WR  F I LPI  F+ I+ +L  + 
Sbjct: 154 ERSRPLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGFAVIMFLLTYKT 212

Query: 300 PKES---------------KGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITA 344
             E+               + R L   GN    +   L   D++G       L  F++  
Sbjct: 213 KSENILQQTRNILGRISKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGL 272

Query: 345 SLGGKEIPYTSHKFIGLCVVTVIGALIFGYTEL--------------KIAKDPILPLRFL 390
           + GG +  + S + I      V+G L+F ++ +                +  P+   R +
Sbjct: 273 TFGGNKYSWNSGQII---TYLVLGILLFVFSLIYDFFIFQKFNPEPDNTSYRPLFLKRLV 329

Query: 391 KDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAG 450
              +V+  ++  +   +       Y   +F  +        G  +IP   +    ++ +G
Sbjct: 330 AKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASG 389

Query: 451 YYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLA 510
              KK G     +I   +L  IG   +  +  + +   Q  ++ +PGL     +  +L++
Sbjct: 390 VITKKLGLVKPLLIFGGILGVIGAGLMTLMSNNSTSSTQIGVLILPGLSLGFALQASLMS 449

Query: 511 MIAAVPHNHQAVT------TSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP 564
               +  +    T      T+ +   +S G TLG  +   +F  SL N +K   L+    
Sbjct: 450 AQLQIKKDRPEATTDFIEITAFNTFMKSLGTTLGGVLSTTVFSASLRNKVKHAQLEMYVG 509

Query: 565 EHSEDELMRIIDKASQSTEWVQNSSPSFIKQTL-IDCYHFACKNVFIFCLLCT 616
           +  +D ++  +         + N     IK    +D   +A    FIFC+  +
Sbjct: 510 KTVDDMILYRLQNFDGPHSSIGNILSDSIKNVFWMDMGFYALG--FIFCIFSS 560

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 146/557 (26%), Positives = 223/557 (40%), Gaps = 70/557 (12%)

Query: 117 TARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIY 176
           T  L + ++S+ L +FLAALD  IV TL   I  +F++   I W+ T Y L++A F  ++
Sbjct: 4   TLSLTLCIISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLW 63

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXD 236
           G++++I G    L+   I F VGSLI  LS S   L++GR IA                 
Sbjct: 64  GRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTS 123

Query: 237 IVPLRNRA-LYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
           IV   +R  +   +   Y             +  +  + WR  F I LPI  F+ ++I+ 
Sbjct: 124 IVQENHRGTMITALATSYVIAEGVGPFIGGAF--NEHLSWRWCFYINLPIGAFA-LIILA 180

Query: 296 FLR-----LPKESKGRGLQVDGNY-----------FSTIKVRLSAVDWIGATTLVLFLFS 339
           F       LPK S    ++   +Y               KV +  +D IG T        
Sbjct: 181 FCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTL 240

Query: 340 FMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS----- 394
            M+  S GG    + S   I L  V  I  ++F   +      P+L LR+   R+     
Sbjct: 241 LMLGLSFGGNNFAWNSSTIISLFTVGPILLILFCAYDFHFL--PLLGLRYENKRTKPLLT 298

Query: 395 --------VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPT----DIGKRIIPNFFST 442
                   +  SS++ +F   A    S YL   +  VL  KPT     + +  IP   +T
Sbjct: 299 WSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIAT 358

Query: 443 -AFGSLGAGYYMKKTGKYYWFVISFCVLASI-GCLQIVWIQPDISVFKQYTLMFIPGLGA 500
            A   L A Y + K        I F VL  I G      I    S    Y+++  PGL  
Sbjct: 359 MAIAYLNAKYGIIKPA------IVFGVLCGIVGSGLFTLINGKSSQSIGYSIL--PGLAF 410

Query: 501 SVLITVALLAMIAAVPHNHQ-------AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNL 553
             +    LL+    +  +          VT   S+A +S G   G ++G  IF  SL N 
Sbjct: 411 GSIFQATLLSSQVQIKSDDPEFQNKFIEVTAFNSFA-KSLGFAFGGNMGAMIFTASLKNQ 469

Query: 554 LKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCL 613
           ++S  L    PE +  E +      + +TE   + S S + Q +    H    +VF +C 
Sbjct: 470 MRSSHLSL--PEFTSVETLL-----AYNTEH-YDGSQSLLSQLINTAIH----DVF-YCA 516

Query: 614 LCTIAATFSMAIIKEHR 630
           L   A +F   +    +
Sbjct: 517 LGCYALSFFFGVFTSSK 533

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 2/187 (1%)

Query: 111 KGTELSTAR-LKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSS 169
           K  ELS    L + ++++ L +FLAALD  IVST++  +A +      I W+ T Y L +
Sbjct: 50  KNVELSKGSILYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPN 109

Query: 170 ATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXX 229
           A    I+G+I+   G K  ++F  + F +GSLI  L+ S   L+ GR IA          
Sbjct: 110 ALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSL 169

Query: 230 XXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFS 289
                  +V    R +   I +  F             F+  SV WR  F I LPI   +
Sbjct: 170 SFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTS-SVTWRWCFYINLPIGGLA 228

Query: 290 TILIILF 296
             L +LF
Sbjct: 229 FFLFVLF 235

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 103/485 (21%), Positives = 196/485 (40%), Gaps = 37/485 (7%)

Query: 104 ESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVAT 163
           +++++ S+   +    L   + S+ L +FL+ALD  IVST++  ++ +FNE  +  W+ T
Sbjct: 26  QNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVT 85

Query: 164 AYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXX 223
            Y L +A    ++G+ + I G K  ++   I F VGSL+  L+ S   L+ GR I+    
Sbjct: 86  GYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGG 145

Query: 224 XXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQL 283
                        +V  R+R +   + +  F             F+   V WR  F I L
Sbjct: 146 SGLQTLCFLIISTLVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTH-VTWRWCFYINL 204

Query: 284 PIAFFSTILIIL---------------FLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWI 328
           PI   + ++ +L                +R        GL    +Y++T +  +   D++
Sbjct: 205 PIGGLAFLVFVLSYNPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFV 264

Query: 329 GATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGAL------IFGYTELKIAKD 382
           G           ++  + GG E  + S   I   V+ ++ ++       F +   K  ++
Sbjct: 265 GFALCSAGFCLILLGLTFGGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRE 324

Query: 383 -----PILPLRFLKDRSVLGSSLSNW-FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRII 436
                P++    +    V+ ++  N+  C+M    V Y +  +F  +        G  +I
Sbjct: 325 NMVYRPLVSWNVISKPGVITATAVNFTICLMYNAQVIYIVQ-FFQLIHGSTAWKAGIHLI 383

Query: 437 PNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIP 496
                T      +G    KTG   + ++   V A +G   +  +  +    K   L+ +P
Sbjct: 384 ACVVPTIITVNISGIINGKTGHVKFIIVVGVVAAIVGAGLLTLLDNNSGSSKHIGLLILP 443

Query: 497 GLGASVLITVALLAMIAAVP-------HNHQAVTTSISYAFRSTGCTLGVSIGGAIFRES 549
           G+    +I   L++    +        H+  +VTT  S+A ++ G   G  I   +F  S
Sbjct: 444 GIAFGAIIQSTLMSSQIQIDKSSPSFRHDFISVTTINSFA-KALGTAFGGVISNTVFTTS 502

Query: 550 LDNLL 554
           + N L
Sbjct: 503 VHNKL 507

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 112/531 (21%), Positives = 202/531 (38%), Gaps = 46/531 (8%)

Query: 120 LKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI 179
           L + + S+ L +F+ ALD  IV T++  +A +F    +  W+ T Y L +A    I+G+ 
Sbjct: 36  LYLCLASLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRF 95

Query: 180 SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVP 239
           + I G +  LI   + F  GSLI  L+ S   L+ GR +A                 +V 
Sbjct: 96  ASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVG 155

Query: 240 LRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRL 299
            R+R L   I +  F             F+   V WR  F I LPI   + I+ +L  + 
Sbjct: 156 ERSRPLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLAIIMFLLTYK- 213

Query: 300 PKESKGRGLQVDG-----NYFSTIKVR------------LSAVDWIGATTLVLFLFSFMI 342
             E+KG   Q+       + F+  K R            +   D+ G       L  F++
Sbjct: 214 -AENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLL 272

Query: 343 TASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTEL--------------KIAKDPILPLR 388
             + GG +  + S + I      V+G L+F ++ +               I+  P+L  R
Sbjct: 273 GLTFGGNKYSWNSGQVI---TYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRR 329

Query: 389 FLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLG 448
            +   +++  ++  +           Y   +F  +        G  +IP   +    ++ 
Sbjct: 330 LVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIA 389

Query: 449 AGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVAL 508
           +G   KK G     +I   VL  IG   +  +    +   Q  ++ +PG      +  +L
Sbjct: 390 SGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLLPGFSLGFALQASL 449

Query: 509 LAMIAAVPHNHQAV------TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFK 562
           ++    +  +           T+ +   +S G TLG  +   +F  S  N +    L+  
Sbjct: 450 MSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLSTTVFSASFHNKVSRAHLEPY 509

Query: 563 SPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTL-IDCYHFACKNVFIFC 612
             +  +D ++  +     S   + N     IK    +D   +A    F+FC
Sbjct: 510 EGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVFWMDLGFYALG--FLFC 558

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 105/527 (19%), Positives = 209/527 (39%), Gaps = 44/527 (8%)

Query: 135 ALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNI 194
            LD+ I     +++ + F+E   +S V     + SA  Q +Y +++D+FGR  + I   +
Sbjct: 110 GLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTLFITAVV 169

Query: 195 TFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYF 254
            + +G++I   S + E   AG                    D   L+ R  YQ    + F
Sbjct: 170 FYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQFAPTWPF 229

Query: 255 XXXXXXXXXXXXWFS---------DRSVGWRM---SFLIQLPIAFFSTILIILFLRLPKE 302
                       W S           +  W +   +F+  L        ++ ++ +  + 
Sbjct: 230 --------IINTWISGNITSRANPQENWSWDIGMWAFIFPLSCVPLICCMLHMWWKARRT 281

Query: 303 SKGRGLQVDGNYFST------IKVRLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTS 355
            + + L  +  YF T      IK     +D IG   + + L   ++  +L GG    +  
Sbjct: 282 EEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDD 341

Query: 356 HKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFCMMALMTVSY 414
            + IG  V+ V+   +    ELK A++PILP + +KDR+V  S S+S  +  +  M   Y
Sbjct: 342 SQIIGPLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDY 401

Query: 415 YLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGC 474
              +    V     +      +  F ST F    A  Y+ +  +   ++I+ C L  +  
Sbjct: 402 LYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFA-LYITRVTRLKPYIIAGCGLWMVAM 460

Query: 475 LQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRST 533
             +   +   S        + + G+G ++      +++ +A  H + A  TS++Y     
Sbjct: 461 GLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTLYRI 520

Query: 534 GCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFI 593
           G  +G+++ G I+ ++L + +  +V   K   ++ ++    I + +  T          I
Sbjct: 521 GSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYNFIAEYTWGTP---------I 571

Query: 594 KQTLIDCY-HFACKNVFIFCLLCTIAATFSMAI----IKEHRLHNTL 635
           +Q +++ Y H       +  + C     FS+ +    + +   HN L
Sbjct: 572 RQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAHNDL 618

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 129/340 (37%), Gaps = 39/340 (11%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           + + S+ + +FL ALD  I  TL   I  EFN+   + W+   Y L +A F  ++G+I+ 
Sbjct: 8   VCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIAS 67

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           + G K  L+   + F  GSL+ G + S   L+  R I+                 IV  +
Sbjct: 68  LVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEK 127

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPK 301
           +RA    +    +              ++  V WR  F + LPI   +   +        
Sbjct: 128 HRARVITVLGIAYMLAEGAGPFVGGGLAEH-VSWRWCFYVNLPIGGVALAALGWGYNPAG 186

Query: 302 ESKGRGLQ---VDGNYFSTIKVRLSAVDWIGATTLVLFLFSF-------------MITAS 345
            + GR L    V    F      L A  W  A  L++F                 M+  +
Sbjct: 187 RAPGRALARFWVRARAFP-YGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVMLALT 245

Query: 346 LGGKEIPYTSHKFIGL----------------CVVTVIGALIFGYTELKIAKDPILPLRF 389
            GG +  + S   + +                 V+  +GA I GY  L     P++P R 
Sbjct: 246 FGGNQYAWRSATIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYEPL-----PLVPWRL 300

Query: 390 LKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPT 429
             +  VL SSL  +F   A    S YL  Y+  V+N  PT
Sbjct: 301 AANVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPT 340

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 74/162 (45%), Gaps = 1/162 (0%)

Query: 134 AALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCN 193
           AALD  IV TL   I  +FN+   + W+ T Y LSSA F  ++G+++ + G K  L+   
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 194 ITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFY 253
           + F +GSLI  +S S   L+AGR +A                 +V  R+R +   +  F 
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 254 FXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
           F              ++ +  WR  F I LPI   +  ++ L
Sbjct: 176 FVGSNAGGPILGGALNEHA-SWRWCFFINLPIGGAAAFMLFL 216

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 106/520 (20%), Positives = 211/520 (40%), Gaps = 54/520 (10%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS-DIFGRKVVLIFCNIT 195
           D  IV+T++  + + F+   +  W+   Y L +A    ++G+I+    G K  ++   + 
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 196 FFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFX 255
           F +GSLIC L+ S + L+ GR IA                 +V  R R       +  F 
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 256 XXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTIL------------IILFLRLPKES 303
                       F+   V WR  F I LP+   + ++            ++L +   KE 
Sbjct: 194 IASVIGPFIGGAFTSH-VTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLKEL 252

Query: 304 KGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCV 363
             +  +V   +   +K  L  +D I    +   +   ++  + GG    + S+  I L V
Sbjct: 253 SEKVKKV--RFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFV 310

Query: 364 VT---VIGALIFGYT---ELKIAK------DPILPLRFLKDRSVLGSSLSNWFCMMALMT 411
           +    VI AL++ +     L+I K       P++  + L+ R +  +S++ +F  +  M+
Sbjct: 311 IGGCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMS 370

Query: 412 VSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLAS 471
            + Y   +F  + N  P      +I     T   ++  G+   K G      ++   LA 
Sbjct: 371 QTVYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAV 430

Query: 472 IGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVT-------- 523
           IG   +  +    +  +   L+ +PG+         ++A  A +  + ++ T        
Sbjct: 431 IGAGLLTLLDNHSNSAQHIGLLILPGVAFGACNQCTMMA--AQIELDKKSPTFKSDFVAV 488

Query: 524 TSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSE----DELMRIIDKAS 579
           T+++   ++ G  +G  I  ++F  ++ N +       KS  HSE    D+L  II +A 
Sbjct: 489 TTLNSFLKNCGQAVGSIISASVFGGAVMNKIG------KSSYHSEIRSVDDL--IIYRA- 539

Query: 580 QSTEWVQNSSPSFIKQTLIDCYHFA---CKNVFIFCLLCT 616
           +  +  ++   + I  ++ D ++ A   C   F+F +  +
Sbjct: 540 EHFDGARSVLGNMISDSVKDVFYMALGWCALAFLFAIFTS 579

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 115/539 (21%), Positives = 216/539 (40%), Gaps = 39/539 (7%)

Query: 110 SKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSS 169
           ++ + ++  RL + + ++ L   + ALD  IV+T++  ++       +  W+ T Y L +
Sbjct: 64  TQSSIMAGMRLYVCLFALVLAQLIVALDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPN 123

Query: 170 ATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXX 229
           +    I+G+ + + G +  ++     F VGS++   + S   LV GR +A          
Sbjct: 124 SLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTV 183

Query: 230 XXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIA--- 286
                  +V  RNR +   +    F             F+  +  WR  F I LP+    
Sbjct: 184 SMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTHAT-WRWCFWISLPVGGSA 242

Query: 287 ----FFS--------TILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV 334
               FF+        T  ++  L+L K    +  Q    Y + ++  +   D IG T   
Sbjct: 243 AFLFFFTYNPERLSITARLVRCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLIGFTLNC 302

Query: 335 LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFG------YTELKIAKDPI-LPL 387
             +  F++  + G ++  +    F+ +C + + G L+        Y   +I  +P     
Sbjct: 303 TGICLFLLGLTFGSEDNSW-KRAFV-VCFLVIGGLLVVCSVVYDFYIFDRINPEPANASY 360

Query: 388 RFLKDRSVLGSS---LSNWF-CMMALMTVSY--YLPIYFAGVLNMKPTDIGKRIIPNFFS 441
           R L  R+++G     L+N   C  A++   Y  Y   +F  VL     + G  +IP   +
Sbjct: 361 RPLMVRTLIGHKYFLLANTVTCAAAVVFAGYMVYSVQFFQLVLGYTAWNAGLHLIPLVIA 420

Query: 442 TAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGAS 501
           +   ++  G + KKTG   + +I+   L  IG      +    +   Q  +  +PG G  
Sbjct: 421 SLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVCTLLDNYSNNSMQIGVWILPGFGLG 480

Query: 502 VLITVALLAMIAAVPHNHQAVTTSIS--YAFRSTGCTLGVSIGGAIFRESLDNLL----- 554
             +  AL++    +  N     T +    AF S   +LG SIG  +   +  + L     
Sbjct: 481 ATLQCALISSQLQIDKNSPDAKTELVEITAFNSFCKSLGSSIGAVLSTTTFISALWRKIN 540

Query: 555 KSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCL 613
           K+K+  +   + +E    R+ +   +STE  +  S + +      CY F+    F  CL
Sbjct: 541 KAKLEGYYGKKINELVKYRLQNFDGKSTEAAEIFSAA-VTYVFWMCYAFSALAFFCACL 598

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 105/469 (22%), Positives = 175/469 (37%), Gaps = 46/469 (9%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IV TL   I  +F +  RI W+ T Y L +A F  ++G+++ I G K  L F  + F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            +GSLI  +S S   ++ GR +A                 +V  RNR +   +    F  
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFS 316
                      F++ +V WR  F I LPI   +  ++       ++S    L  +     
Sbjct: 143 AFAVGPVIGGAFTE-NVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQ 201

Query: 317 TIKVR--LSAVDWIGATTLVLF-------------LFSFMITASLGGKEIPYTSH---KF 358
           T +    ++A  W  A   ++F                FM+  + GG    + S     F
Sbjct: 202 TYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISF 261

Query: 359 IGLCVVTVIGALIFGYTEL--------KIAKDPILPLRFLKDRSVLGSSLSNWFCMMALM 410
           + +  + V+  L+F +  L        K    P+L         +  SS++N F      
Sbjct: 262 LTVGAILVLFWLVFDFVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFGFN 321

Query: 411 TVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA-----FGSLGAGYYMKKTGKYYWFVIS 465
             + Y+   +  V N  PT     +     +T       G   A + + K    +    +
Sbjct: 322 MQTVYIVQLYQLVFNSGPTAASMHLWAFLIATMVSVIIIGKAAAIFGLIKPAIVFG---A 378

Query: 466 FCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPH---NHQAV 522
            C L   G + +V           Y ++  PG     ++   LL+    V H   N Q +
Sbjct: 379 TCGLVGSGLMTLVRNTSTTGNVIGYCIL--PGAAFGSIMQGTLLSAQVQVDHDDENFQTM 436

Query: 523 ---TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSK---VLKFKSPE 565
               T+++   +S G + G  +   IF  S+ N L+S    V  F S E
Sbjct: 437 FIEATALNTFVKSLGFSFGGVVATMIFTNSVKNQLRSTSAGVAAFSSVE 485

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 109/470 (23%), Positives = 188/470 (40%), Gaps = 45/470 (9%)

Query: 114 ELSTARLKIIMLSM-YLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATF 172
           +  + + KI+++S  ++  F  +LD T+ ST   +  + ++E   +S V     + S   
Sbjct: 52  QFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGS 111

Query: 173 QPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXX 232
           Q +Y ++SD FGR  + +   I + +G++I   +       AG                 
Sbjct: 112 QVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTL 171

Query: 233 XXXDIVPLRNRALYQGICNF-YFXXXXXXXXXXXXWFSDRSVGWRMS-FLIQLPIAFFST 290
              D   L+ R  YQ    + Y                 ++  W ++ +    P++    
Sbjct: 172 ILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPI 231

Query: 291 ILIILFLRL--PKESKGRGLQVD------GNYFSTIKVRLSAVDWIGATTLVLFLFSFMI 342
           I +IL+++    K ++ R L+        G  F  +      +D +G           +I
Sbjct: 232 IFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGI---------LLI 282

Query: 343 TASLGGKEIPYT-----SHKFIGLCVVTVI---GAL--IFGYTELKIAKDPILPLRFLKD 392
           T SLG   +P T     S K+    ++  +   G L  IF Y E K AK P+LP + L D
Sbjct: 283 TVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSD 342

Query: 393 RSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF--FSTAFGSLGA 449
           R +     ++ +      ++  Y  P+    +++MK +      I N   F  A  S   
Sbjct: 343 RGIWAPLGVTFFNFFTFFISCDYLYPVL---LVSMKESSTSAARIVNLPDFVAATASPFY 399

Query: 450 GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDIS-----VFKQYTLMFIPGLGASVLI 504
              + KT K    VI  C  A + C+ + +     S     V     +M + GL  S  +
Sbjct: 400 SLLVAKTRKLKLSVIGGCA-AWMVCMGLFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSV 458

Query: 505 TVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLL 554
            V L AM     H+  AV T I Y F   G  +G S+ GAI+ +++ N L
Sbjct: 459 IVILQAM---TTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQL 505

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 109/470 (23%), Positives = 188/470 (40%), Gaps = 45/470 (9%)

Query: 114 ELSTARLKIIMLSM-YLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATF 172
           +  + + KI+++S  ++  F  +LD T+ ST   +  + ++E   +S V     + S   
Sbjct: 52  QFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGS 111

Query: 173 QPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXX 232
           Q +Y ++SD FGR  + +   I + +G++I   +       AG                 
Sbjct: 112 QVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTL 171

Query: 233 XXXDIVPLRNRALYQGICNF-YFXXXXXXXXXXXXWFSDRSVGWRMS-FLIQLPIAFFST 290
              D   L+ R  YQ    + Y                 ++  W ++ +    P++    
Sbjct: 172 ILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPI 231

Query: 291 ILIILFLRL--PKESKGRGLQVD------GNYFSTIKVRLSAVDWIGATTLVLFLFSFMI 342
           I +IL+++    K ++ R L+        G  F  +      +D +G           +I
Sbjct: 232 IFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGI---------LLI 282

Query: 343 TASLGGKEIPYT-----SHKFIGLCVVTVI---GAL--IFGYTELKIAKDPILPLRFLKD 392
           T SLG   +P T     S K+    ++  +   G L  IF Y E K AK P+LP + L D
Sbjct: 283 TVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSD 342

Query: 393 RSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF--FSTAFGSLGA 449
           R +     ++ +      ++  Y  P+    +++MK +      I N   F  A  S   
Sbjct: 343 RGIWAPLGVTFFNFFTFFISCDYLYPVL---LVSMKESSTSAARIVNLPDFVAATASPFY 399

Query: 450 GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDIS-----VFKQYTLMFIPGLGASVLI 504
              + KT K    VI  C  A + C+ + +     S     V     +M + GL  S  +
Sbjct: 400 SLLVAKTRKLKLSVIGGCA-AWMVCMGLFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSV 458

Query: 505 TVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLL 554
            V L AM     H+  AV T I Y F   G  +G S+ GAI+ +++ N L
Sbjct: 459 IVILQAM---TTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQL 505

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 110/534 (20%), Positives = 211/534 (39%), Gaps = 44/534 (8%)

Query: 120 LKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI 179
           L + + S+ L +F+ ALD  IV T++  +A +F    +  W+ T Y L +A    ++G+ 
Sbjct: 44  LYLCLASLTLVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRF 103

Query: 180 SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVP 239
           + I G +  LI   + F  GSL+  L+ S   L+ GR +A                 +V 
Sbjct: 104 ASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVD 163

Query: 240 LRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR- 298
            R+R L   I +  F             F+   V WR  F I LPI   + I+ +L    
Sbjct: 164 ERSRPLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLAVIMFLLTYDA 222

Query: 299 ----LPKESKGRGLQVDGNYFSTIK----------VRLSAVDWIG----ATTLVLFLFSF 340
               + ++ KG   ++ G  FS +K            +   D+ G    +T LVLFL   
Sbjct: 223 KNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGL 282

Query: 341 MITASLGGKEIPYTSHKFIG---LCVVTVIGALIFGY--------TELKIAKDPILPLRF 389
               + GG +  ++S + I    L +V  I +L++ +            I+  P+   R 
Sbjct: 283 ----TFGGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRL 338

Query: 390 LKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGA 449
           +   +++  ++  +           Y   +F  +        G  +IP   +    ++ +
Sbjct: 339 VAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIAS 398

Query: 450 GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALL 509
           G   KK G     +I    L  IG   +  ++ + +   Q  ++ +PG      +  +L+
Sbjct: 399 GIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQIGVLILPGFSLGFALQASLM 458

Query: 510 AMIAAVPHNHQAV------TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKS 563
           +    +  +           T+ +   +S G TLG  +   +F  SL N +    L+  +
Sbjct: 459 SAQLQINKDRPETPMDFIEITAFNTFMKSLGTTLGGVLSTTVFSTSLHNKVSHVHLEPYA 518

Query: 564 PEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTL-IDCYHFACKNVFIFCLLCT 616
            +  ++ ++  +     +   + N   + IK    +D   +A    F+FC+  +
Sbjct: 519 GKTVDEMILYRLHNFDGAHSTIGNILGASIKNVFWMDLGFYALG--FVFCVFSS 570

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 121/559 (21%), Positives = 215/559 (38%), Gaps = 80/559 (14%)

Query: 115 LSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQP 174
           LS  +L   M S+ L +FLAALD  I+S  +  I+ +FN+  +  W+ + Y L  A    
Sbjct: 35  LSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTL 94

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           ++G+ + IFG K+ L+   + F  GSLI  +S S   L+ GR +A               
Sbjct: 95  LWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIA 154

Query: 235 XDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
             +   R+R +   + +  +             F+   V WR  F I LPI   +  +++
Sbjct: 155 STLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTH-VTWRWCFYINLPIGSLAFAVLV 213

Query: 295 LFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIG-----ATTLVLFLFS---------- 339
           L  + P E         GN   +I   L +    G     +  L L +F           
Sbjct: 214 LTYK-PHE---------GNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIG 263

Query: 340 ----------FMITASLGGKEIPYTSHKFIGLCVVTVIGALI--------------FGYT 375
                     F++  + GG +  ++S   I   V  ++G  I              FG  
Sbjct: 264 FIFCSVGFILFLLGLTFGGDKYAWSSGAII---VYFIVGVTISVAFLLYDFMIFPKFGRV 320

Query: 376 ELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI 435
               +  P++P   +    +  +  +N+   +A      Y+  +F  V           +
Sbjct: 321 RKNASFRPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHV 380

Query: 436 ----IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT 491
               IP+  + A     +G   + TG     +    +   +G   +  +  D    K   
Sbjct: 381 VALEIPDIITVAI----SGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIG 436

Query: 492 LMFIPGLGASVLITVALLAMIAAVPHNHQA-----VTTSISYAFR-STGCTLGVSIGGAI 545
           L+ +PG+    ++  +LL+    +P +  +     V+T+  + F  S G + G  +   +
Sbjct: 437 LLILPGVAFGAMLQGSLLSCQLQIPKDSASFMPDFVSTTTVHTFSISLGMSFGSVLATMV 496

Query: 546 FRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFAC 605
           F  SL N + S   +F S + S DEL+         +  +QN   +  +  L   +  + 
Sbjct: 497 FGTSLHNKIASSGFEFLSTK-SVDELV---------SYRIQNFDGT--RSGLGYIFGNSI 544

Query: 606 KNVFIFCL-LCTIAATFSM 623
           KNVF   L LC +A  F +
Sbjct: 545 KNVFWMALGLCALAFIFGI 563

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 110/552 (19%), Positives = 211/552 (38%), Gaps = 64/552 (11%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IVST++  +A +F    +  W+   Y L +A    ++G+I+ I G K  ++   I F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            +GSLI G++ S   L+ GR IA                ++V  R R L     +  F  
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDG---- 312
                      F+  +  WR  F I LP+   +  L ++F   P+     G+ +      
Sbjct: 214 ASVIGPFLGGAFTTHAT-WRWCFYINLPVGGVAFALFVVFYN-PQRKSLEGISILSSLKE 271

Query: 313 --NYFSTIKVRLSAVDWIGATTLVLFL-FSF---------------MITASLGGKEIPYT 354
             N    I V  +  +W    ++V  L F F               ++  + GG +  ++
Sbjct: 272 FCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEFIFCSAGFVLVLLAFTFGGNQYNWS 331

Query: 355 SHKFIGLCVVTV---IGALIFGYT---ELKIAKD-----PILPLRFLKDRSVLGSSLSNW 403
           S   I + V+ +   I +L++ +      K  K+     P++         +  ++ + +
Sbjct: 332 SASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKENSLYQPLIKWSIFSHPGIFTANAALF 391

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG--KYYW 461
           F   A +  + Y+  +F  V           +I     T   +  +G    K G  K+  
Sbjct: 392 FECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIATVVPTVITTFSSGIANSKFGLVKHVT 451

Query: 462 FVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQA 521
           F+     L   G L +  +  + S  K   L+ +PG+G    +   ++   A +  + +A
Sbjct: 452 FIGVVTSLVGAGLLTL--LDNNSSSAKHIGLLILPGIGFGATMQSTMIG--AQIQLDKKA 507

Query: 522 VT--------TSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMR 573
           VT        T+++   +  G  LG  I   +F  S+ N L +  L         + +  
Sbjct: 508 VTYRSDFIAVTTLNAFLKGAGQALGGIICDTVFSASIVNKLNANDLHVPGG----NTVNN 563

Query: 574 IIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHN 633
           +I    Q+ +   +     I +++I+ ++ A         L   A +F   +   ++  +
Sbjct: 564 LIGYRDQNFDGTDSLMSKLISESIINVFYIA---------LGLAACSFIFGVFTSNKKVD 614

Query: 634 TLDR--DNENEE 643
              R  D E++E
Sbjct: 615 VRKRLVDEESQE 626

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 120/559 (21%), Positives = 221/559 (39%), Gaps = 47/559 (8%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           +L   + S+ L +FLAALD  I+S  +  IA +F +  +  W+ + Y L+ A    ++G+
Sbjct: 116 KLYTTIGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGR 175

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            + I G K  L+   + F  GSLI  +S S   L+ GR +A                 + 
Sbjct: 176 FATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLT 235

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFS-TILIILFL 297
           P R+R +   + +  +              +   V WR  F I LPI   +  +L +++ 
Sbjct: 236 PDRSRVIIISVLSCSYAVAAVVGPFLGGALTTH-VTWRWCFYINLPIGGLAFVVLAMVYN 294

Query: 298 RLPKES-------------KGRGLQVDGNYFSTIKVRLS-AVDWIGATTLVLFLFSFMIT 343
              ++S             +G G  +   ++S I   L   +D++G           ++ 
Sbjct: 295 PSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAGFTLLLLG 354

Query: 344 ASLGGKEIPYTSHKFIGLCVVTVI---GALIFGYTEL----KIAKD----PILPLRFLKD 392
            + GG    ++S   I   VV V+    +L++ +       ++ KD    P+LP R +  
Sbjct: 355 LTFGGSMYAWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPLLPWRVVSR 414

Query: 393 RSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYY 452
             +  S+ + +   +A      Y   +F  V           ++    S     +  G  
Sbjct: 415 PGIFTSNTAVFLGCIAYSAQIVYAVQFFQLVRGASAWTASIHLLSLDVSDIITVVVGGVV 474

Query: 453 MKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMI 512
            + TG     +++  V   +G   +  +  +    +   L+ +PG+ +   +  +LL+  
Sbjct: 475 NRTTGHVKPILVTGVVAGVVGAGLLTLLNNESGSSRHIGLLILPGVASGATLQSSLLSCQ 534

Query: 513 AAVPHNHQAVT------TSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEH 566
             +P N    T      T++   F S G + G  +   +F  SL + + S  L   S + 
Sbjct: 535 LQIPKNSATFTPDFVSATTVHTFFVSLGMSFGSVLATTVFGASLRSRIASSGLDSMSTK- 593

Query: 567 SEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCL-LCTIAATFSM-A 624
           S DEL+         T   QN     +K  L   +  + +NVF   L  C +A  F +  
Sbjct: 594 SVDELV---------TYRTQNFDG--VKSKLGYIFSDSIRNVFWMALGFCGLAFVFGIFT 642

Query: 625 IIKEHRLHNTLDRDNENEE 643
             K+  L +++ R  E EE
Sbjct: 643 SSKKVNLEDSVHRSKEGEE 661

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 96/465 (20%), Positives = 192/465 (41%), Gaps = 44/465 (9%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           II+ S ++  +   LD ++     ++  S +++ P IS +     + SA  Q ++ ++SD
Sbjct: 56  IILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSD 115

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + I   + + VG++I   +   +   AG                    D   LR
Sbjct: 116 VFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLR 175

Query: 242 NRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
            R +YQ       I N +F             +S     W  +F++  P++    I  +L
Sbjct: 176 WRLVYQFAPSWPYIINTWFAGTVTARANPQEHWSWDIAMW--AFIV--PLSALPMIFCML 231

Query: 296 FLRLP--KESKGRGLQVDGNYFS------TIKVRLSAVDWIGATTLVLFLFSFMITASL- 346
            +R    K  +   ++ + ++F       T+      +D +G   + + +   +   +L 
Sbjct: 232 HMRFKARKTEQWAAIKDEKSFFQSHGLIRTLVELFWKLDIVGVLLMTISVGCILAPLTLA 291

Query: 347 GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCM 406
           GG +  +++   IG  V+  +   +F   E K AK P++P   +KDR+V G+    +   
Sbjct: 292 GGVKSKWSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAVWGALGCQFLIG 351

Query: 407 MALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF--FSTAFGSLGAGYYMKKTGKYYWFVI 464
                V+ Y  IY   ++ +  +     +I +   F +   S     Y+ +  K   ++I
Sbjct: 352 FIYNAVAGY--IYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTKLKGYII 409

Query: 465 SFCVLASIGCLQIVWIQPDISVFKQYT-----------LMFIPGLGASVLITVALLAMIA 513
             C          +W+   + +F  Y             M I GLG ++LI    +++ +
Sbjct: 410 GGCG---------IWMLA-MGLFYHYRGGEFAHSGIVGAMVIWGLGDTLLIYPTTISVQS 459

Query: 514 AVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
           A  H++ A  T+++Y     G   G ++ GAI+ ++L   L S++
Sbjct: 460 ATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLYKALLSRL 504

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 118/553 (21%), Positives = 208/553 (37%), Gaps = 90/553 (16%)

Query: 112 GTELSTARLKIIMLSM-YLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSA 170
             +  T + + +M++  +L  F  +LD+T+ ST   +  + + E   +S +     + S 
Sbjct: 45  AVQFDTPKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSV 104

Query: 171 TFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXX 230
             Q ++ ++SD FGR  + +   I + +G+++   + S     AG               
Sbjct: 105 GSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVL 164

Query: 231 XXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS---------DRSVGWRMS-FL 280
                D   L+ R LYQ +  + F            W S         ++   W ++ + 
Sbjct: 165 LLILSDFSSLKWRILYQYVPYWPFIIIP--------WISGNIVTAANPEKDWSWDIAMWA 216

Query: 281 IQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFS- 339
              P++    I +++++ + K SK          +  +K R       G     +FLF  
Sbjct: 217 FIFPLSALPMICLLVYM-MYKSSKTPE-------WKALKERTHIKKNQGFLKNTVFLFWE 268

Query: 340 ------FMITASLGGKEIPYT----------SHKFIGLCVVTVIGALIFGYTELKIAKDP 383
                  +IT SLG   +P T          S K IG  V   +   IF + E   AK+P
Sbjct: 269 LDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFCIFVFWETAYAKNP 328

Query: 384 ILPLRFLKDRSV---LGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFF 440
           +LP + L DR +   LG +  N+F     +   +  P+    +     T      +P+F 
Sbjct: 329 LLPFKLLGDRGIWAPLGVAFFNYFTF--FIACDFLYPVLLVSMNESSTTATRILNLPDFV 386

Query: 441 STAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQY---------- 490
                    G  + K  +  + V+  C    I           + +F QY          
Sbjct: 387 GATLSPF-YGILVAKARRLKFSVVGGCAAWMI----------SMGLFYQYRGGSESHGGA 435

Query: 491 ----TLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIF 546
                +M + GL  S  + V+L AM     H   AV TSI + F   G  +G S+ GA++
Sbjct: 436 IAASVIMGMSGLLCSNSVIVSLQAMTT---HGRMAVITSIYFTFSKVGAAVGASVSGAVW 492

Query: 547 RESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSP--SFIKQTLIDCYHFA 604
            + + N L+           S D L    D A +S        P  S  +  +++ Y + 
Sbjct: 493 TQIMPNQLRKA--------FSNDTLA---DAAYESPYTFIYEYPWGSPERIAVVEAYRYV 541

Query: 605 CKNVFIFCLLCTI 617
            + +    L+CTI
Sbjct: 542 QRIMMTIGLVCTI 554

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 94/456 (20%), Positives = 179/456 (39%), Gaps = 31/456 (6%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++ S ++  +   LD  I      +  S ++E   +S +     + SA  Q +Y ++SD
Sbjct: 81  ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSD 140

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           I+GR  +L+   + + VG++I   +   +   AG                    D   LR
Sbjct: 141 IYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLR 200

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSD---------RSVGWRM---SFLIQLPIAFFS 289
            R  YQ +  + F            W S          +   W +   +F+  L      
Sbjct: 201 WRLFYQFVPTWPF--------IINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPIL 252

Query: 290 TILIILFLRLPKESKGRGLQVDGNYFS------TIKVRLSAVDWIGATTLVLFLFSFMIT 343
             +I +  R+  + + + LQ +  YF       T+K     +D +G   +V  L   ++ 
Sbjct: 253 CCMIHMHWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVP 312

Query: 344 ASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLS 401
            +L GG    +     IG  V+  +   IF Y E + A +P++P + +KDR V  +  +S
Sbjct: 313 LTLAGGVSSKWNHSNIIGPFVLGFVLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGIS 372

Query: 402 NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW 461
                +  M V Y   +    V     +      + +F ST    + A   + +  +   
Sbjct: 373 FLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVA-LALTRVTRMKP 431

Query: 462 FVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAAVPHNHQ 520
            +I  C L  +    +   +            + + GLG ++      +++ AA  H++ 
Sbjct: 432 VIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQAATNHDNM 491

Query: 521 AVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           A  T+++Y     G  +G ++ GAI+ ++L   LLK
Sbjct: 492 ATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLK 527

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 118/498 (23%), Positives = 194/498 (38%), Gaps = 77/498 (15%)

Query: 107 RISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYL 166
           RI     ++ST  + I+ LS++L  ++AALD T       +  S FN    +S +  A  
Sbjct: 64  RIEVVREKMSTKVIWILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANS 123

Query: 167 LSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXX 226
           +  A  +P   KISD+  R V      + + +G +I   SP+    V G           
Sbjct: 124 VIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSGI 183

Query: 227 XXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV------GWRMS-- 278
                    D   L+ R+        +F            W S   V       WR    
Sbjct: 184 SLMNMVIIADTTTLKWRS--------FFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYG 235

Query: 279 -FLIQLPIAFFSTILIILFL--------RLP-------------KESKGRGLQVDGNYFS 316
            F I  P+A    IL++ +L         +P              E++ RG +V   Y+ 
Sbjct: 236 MFAIITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKV---YWE 292

Query: 317 TIKVRLSAVDWIGATTLVLFLFSF---MITASL-GGKEIPYTSHKFIGLCVVTVIGALIF 372
            +KV L  +D  G   L+L  F+F   ++  SL    E  + +   I + VV   G L+ 
Sbjct: 293 LLKVSLIEIDAFG---LILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG--GILLI 347

Query: 373 GYT--ELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAG----VLNM 426
            Y   E+  A  P+LP R L +R+ +   + ++   MA     Y+  ++F      VLN+
Sbjct: 348 SYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMA----GYFSLLFFTSYTFVVLNL 403

Query: 427 KPTDIGKRIIPN-------FFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGC-LQIV 478
              D     + N       FF   +G+L  G++     +Y  F +    +  IG  L + 
Sbjct: 404 SYRD--WVYLSNTTTMGLCFFGVVWGALFRGFH-----RYKIFQVVGIAIKLIGMGLYVA 456

Query: 479 WIQPDIS--VFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCT 536
             + D S  +      + +   G +  +    +A  AAVPH   A T S+   + S G  
Sbjct: 457 CSKKDGSPGIGLVVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAA 516

Query: 537 LGVSIGGAIFRESLDNLL 554
           +G +I  A++ + L   L
Sbjct: 517 VGTAITSAVWTDQLPGAL 534

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 96/459 (20%), Positives = 172/459 (37%), Gaps = 48/459 (10%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++LS ++  +   LD  I      +  S ++E   +S +     + SA  Q IY ++SD
Sbjct: 76  ILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSD 135

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + I   I + VG++I   +   +   AG                    D   L+
Sbjct: 136 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLK 195

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFL- 297
            R LYQ +  + F              ++  V W      +    P++    +L +L + 
Sbjct: 196 WRLLYQFVPTWPFIINTWIAGNITS-RANPVVNWSWDVGMWAFIFPLSCVPIVLCMLHMQ 254

Query: 298 -RLPKESKGRGLQVDGNYFST------IKVRLSAVDWIGATTLVLFLFSFMITASL-GGK 349
            R  K  +   L+   +Y+        +K     +D +G   +   L   ++  +L GG 
Sbjct: 255 WRARKTPEWHALKGQKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGV 314

Query: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFCMMA 408
           +  +   + IG  V+  +   I    E + A+DPILP R +KDR+V  S  +S     + 
Sbjct: 315 KTTWNDSRLIGPFVLGFVLIPILWIWEYRFARDPILPYRLVKDRAVWSSMGISFLIDFIY 374

Query: 409 LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA-----------------FGSLGAGY 451
            M   Y   +    V     +      + +F ST                  F   G   
Sbjct: 375 YMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASPFFALLVTRCTRLKPFIMFGCAL 434

Query: 452 YMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAM 511
           +M   G  Y F       + I     VW                 G+G ++      +++
Sbjct: 435 WMVAMGLLYHFRGGSQSHSGIIGALCVW-----------------GVGTTLFTYPVTVSV 477

Query: 512 IAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
            +AV H + A  T+++Y     G  +G ++ GAI+ ++L
Sbjct: 478 QSAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTL 516

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 123/562 (21%), Positives = 208/562 (37%), Gaps = 64/562 (11%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           + + S+ L +FL ALD  I  TL   I   FN+   + W+ T Y L +A    ++G+I+ 
Sbjct: 8   VCIFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIAS 67

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           + G K  L+   + F  GSL+  L+ S   L+ GR IA                 +V  +
Sbjct: 68  LVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEK 127

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPK 301
           +RA    I    +             F++  V WR  F I +PI      L IL      
Sbjct: 128 HRARVVTILGIAYMLAEGAGPFIGGAFAEH-VSWRWCFFINIPIG--GVALAILCWGYNP 184

Query: 302 ESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSF-----------------MITA 344
             +     ++  + S  K     V  + + T V+ LF +                 M+  
Sbjct: 185 AGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLAL 244

Query: 345 SLGGKEIPYTSHKFIGLCVVTVIGAL----------IFGYTELKIAKD---PILPLRFLK 391
           + GG +  + S   I  C+ T+  AL          +  Y   ++      P++P     
Sbjct: 245 TFGGNKFAWNSASII--CMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLAC 302

Query: 392 DRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPT----DIGKRIIPNFFSTAFGSL 447
           +  +L SS++ +F   A    S YL  Y+  V N  P      + +  +P   +     +
Sbjct: 303 NMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMSVPALITV----I 358

Query: 448 GAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVA 507
            +    +K G     +++  V   IG   +     + S         + G     +  ++
Sbjct: 359 VSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASIGYSMLAGASFGCVYQLS 418

Query: 508 LLAMIAAV----PHNHQAVTTSISYA--FRSTGCTLGVSIGGAIFRESLDNLLKSKVLKF 561
           LL+    V    P  H+      +Y    ++ G +    +   IF  SL NL  S V   
Sbjct: 419 LLSSQLEVRKDDPEYHKNFIEVTAYNTFIKTMGFSFAGILSTTIFSVSLKNLASSHV--- 475

Query: 562 KSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATF 621
             P  S  E   I+D  SQ  +   +     + Q++        +NVF +C L   A +F
Sbjct: 476 GLPHFSTVE--DIMDYRSQHYDGRNSPLGKIMAQSI--------RNVF-YCALACSALSF 524

Query: 622 SMAIIKEHRLHNTLDRDNENEE 643
              I    +   T  RD + +E
Sbjct: 525 IFGIFTSSKRTAT-SRDEQMQE 545

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 109/507 (21%), Positives = 194/507 (38%), Gaps = 68/507 (13%)

Query: 115 LSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQP 174
           LS  +L   M S+ L +FLAALD  I+S  +  I+ +FN+  +  W+ + Y L  A    
Sbjct: 35  LSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTL 94

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           ++G+ + IFG K+ L+   + F  GSLI  +S S   L+ GR +A               
Sbjct: 95  LWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIA 154

Query: 235 XDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
             +   R+R +   + +  +             F+   V WR  F I LPI   +  +++
Sbjct: 155 STLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTH-VTWRWCFYINLPIGGLAFAVLV 213

Query: 295 LFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIG-----ATTLVLFLFS---------- 339
           L  + P E         GN   +I   L +    G     +  L L +F+          
Sbjct: 214 LTYK-PHE---------GNSARSIVSVLKSCCEFGTARLFSKDLYLKMFNELVFGFDFIG 263

Query: 340 ----------FMITASLGGKEIPYTSHKFIGLCVVTVIGALI--------------FGYT 375
                     F +  + GG +  ++S   I   V  V+G  I              FG  
Sbjct: 264 FIFCSVGFILFRLGLTFGGDKYTWSSGAII---VYFVVGVTISVAFLLYDFMVFPKFGRV 320

Query: 376 ELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI 435
               +  P++P   +    +  +  +N+   +A      Y+  +F  V           +
Sbjct: 321 RKNASFRPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHV 380

Query: 436 ----IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT 491
               IP+  + A     +G   + TG     +    +   +G   +  +  D    K   
Sbjct: 381 VALEIPDIITVAI----SGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIG 436

Query: 492 LMFIPGLGASVLITVALLAMIAAVPHNHQA-----VTTSISYAFR-STGCTLGVSIGGAI 545
           L+ +PG+    ++  +LL+    +P +  +     V+T+  + F  S G   G  +   +
Sbjct: 437 LLILPGVAFGAMLQGSLLSCQLQIPKDSASFMPDFVSTTTVHTFSISLGMYFGSVLATMV 496

Query: 546 FRESLDNLLKSKVLKFKSPEHSEDELM 572
           F  SL N + S   +F S + S D+L+
Sbjct: 497 FGTSLHNKIASSGFEFLSTK-SVDKLV 522

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IV T+L  IA +FN   +I W+ T Y LS+A F  ++G+ + IFG K  L+   I F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            +GSL+  +S S + ++ GR IA                 +V    R     + +  +  
Sbjct: 96  EIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAV 155

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIA 286
                       ++  V WR  F I LPI 
Sbjct: 156 ASALGPYIGGALTEY-VTWRWCFYINLPIG 184

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/489 (20%), Positives = 193/489 (39%), Gaps = 51/489 (10%)

Query: 97  SGHYGAI-ESRRISSKGTELSTARLK------IIMLSMYLGIFLAALDNTIVSTLLAHIA 149
           SG Y A+ +++ +  K TE+     K      I+++S ++  +   LD  I      +  
Sbjct: 49  SGKYDALRQNKSLVIKQTEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYAT 108

Query: 150 SEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSF 209
           S ++E   +S +     + SA  Q IY ++SD+FGR  + I   I + VG++I   +   
Sbjct: 109 SSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDV 168

Query: 210 EWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFX-------XXXXXXX 262
           +   AG                    D   L+ R LYQ    + F               
Sbjct: 169 QRYAAGSIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKAN 228

Query: 263 XXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRL--PKESKGRGLQVDGNYFS---- 316
               W  D  + W   F    P++    +L +L ++    K  +   L+ + +Y+     
Sbjct: 229 PVENWSWDIGM-WAFIF----PLSCIPIVLCMLHMQWIARKTPEWHALKDEKSYYQEHGF 283

Query: 317 --TIKVRLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFG 373
              ++     +D IG   +   L   ++  +L GG +  +   + IG  V+  +   I  
Sbjct: 284 VKVLEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILW 343

Query: 374 YTELKIAKDPILPLRFLKDRSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIG 432
             E ++A+DPI+P + +KDR V  S  +S     +  M   Y   +    V     +   
Sbjct: 344 VWEYRVARDPIIPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATR 403

Query: 433 KRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT- 491
              + +F S    S   G  M +  +   F++  C      CL ++     + +  +Y  
Sbjct: 404 ISTLSSFVSVV-ASPFFGLIMTRCTRLKPFIMFGC------CLWML----AMGLLYRYRG 452

Query: 492 ----------LMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSI 541
                      + + GLG ++      +++ +AV H + A  T+++Y     G  +G ++
Sbjct: 453 GRESHSGIIGALCVWGLGTTLFTYPVTVSVQSAVSHENLATVTALNYTLYRIGSAVGAAV 512

Query: 542 GGAIFRESL 550
            GAI+ ++L
Sbjct: 513 SGAIWTQTL 521

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 110/470 (23%), Positives = 183/470 (38%), Gaps = 37/470 (7%)

Query: 115 LSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQP 174
           +S  RL + + ++ L  F+ ALD  IV+T++  +++      +  W+   Y L ++ F  
Sbjct: 52  MSGLRLYVCVAALVLATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLPNSLFSL 111

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           I+G+ + + G +  +      F VGS++   + S + L+ GR IA               
Sbjct: 112 IWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIG 171

Query: 235 XDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
             IV  +NRA+   I    F             F+   + WR  F I LPI    T L+ 
Sbjct: 172 SSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVI-WRWCFWINLPIGAV-TALLF 229

Query: 295 LFLRLPKESKG-----------RGLQVDG-----NYFSTIKVRLSAVDWIGATTLVLFLF 338
            F   PK               + L  +       Y    K  L   D +G  T    + 
Sbjct: 230 YFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFATGCAGVC 289

Query: 339 SFMITASLGGKEIPYTSHKFIGLCVV----TVIGALIFGYTELKIAKDP-------ILPL 387
             ++  +LGG++  + S   I   +V    +V+  +   Y   KI  +P       +L  
Sbjct: 290 LLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVK 349

Query: 388 RFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSL 447
             L +R +L  +L      +A      Y   +F  V+     + G  +IP   ++   ++
Sbjct: 350 GLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIASIVSAI 409

Query: 448 GAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVA 507
             G  MKKTG+    +IS   +  IG      +        Q  +  +PG G    +  A
Sbjct: 410 ICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSGNSMQIGVWILPGFGLGAALQCA 469

Query: 508 LLA---MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGG----AIFRESL 550
           L++    I     N +     ++ AF S   +LG SIGG    AIF  SL
Sbjct: 470 LISSQLQIDKESPNSEIELVEVT-AFNSFTKSLGSSIGGVLCTAIFTSSL 518

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 105/474 (22%), Positives = 178/474 (37%), Gaps = 54/474 (11%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IV T++  +A++FN      W+ T Y L +A    ++G+   + G K  ++   + F
Sbjct: 91  DILIVGTIMETVAAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIF 150

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            VGSLI   + S   L+ GR I+                 +V  R R     I +  F  
Sbjct: 151 EVGSLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAV 210

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILI----------------ILFLRLP 300
                      F+   V WR  F I LPI   +                    IL  R+ 
Sbjct: 211 ASVAGPFLGGAFATH-VTWRWCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIK 269

Query: 301 KESKGRGLQVD--GNYFSTIKVRLSAVDWIGAT---TLVLFLFSFMITASLGGKEIPYTS 355
           + S  + L V      F T+  +    ++  ++   TLVL   +F      GG    + S
Sbjct: 270 RISYSQLLTVSFYRRLFRTLVFKFDFFEFALSSAGFTLVLLALTF------GGNRYDWNS 323

Query: 356 HKFIGLCVVTVI--------GALIFGYTELKIAKDPILPL---RFLKDRSVLGSSLSNWF 404
              I   VV ++          ++F   + +  + P LPL     +    VL  +++N+ 
Sbjct: 324 GTIIAYFVVGILLIIASFVYDFVVFDRVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFC 383

Query: 405 -CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFV 463
            C    M V Y +  YF  V           +I    ST    L  G   +KTG     +
Sbjct: 384 TCFCYNMQVVYIVQ-YFQLVWGDSAWKASIHLIAPVISTVITVLFCGIITRKTGHVKILL 442

Query: 464 ISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQ--- 520
           +   ++  +    +  + P  S   +  L+ +PG+    ++  +LL+    +  NH    
Sbjct: 443 VVGGIVIPVASGILTLLGPKSSSSAKIGLLILPGISFGSVMNGSLLSSQLQIQKNHPLFR 502

Query: 521 ----AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP-EHSED 569
               AVTT     F +    LG++ GG +        +++++ K K P  HS+ 
Sbjct: 503 FDFIAVTT-----FNAFVKMLGMAFGGIMSNMIFTTSVRNELSKIKPPLPHSQS 551

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 113/465 (24%), Positives = 172/465 (36%), Gaps = 58/465 (12%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IV TL   I  +F++   I W+ T Y LS+A F  ++G++++I G    L+   + F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            +GSLI  LS +   L+ GR IA                 IV    R +        +  
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQ------- 309
                      F++  + WR  F I LPI  F+ I     L     S G+ L        
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAFIS----LAFCCASGGKWLSKKWLLSK 198

Query: 310 ----VDGNYFSTIK---------VRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSH 356
                   Y+   K         + +  +D IG           M+  S GG    + S 
Sbjct: 199 INSITSYKYYEIFKASFWKKVFQILVFKLDMIGIILSSAGFTLLMLGLSFGGNNFAWNSS 258

Query: 357 KFIGLCVVTVIGALIFGYTELKIA-----------KDPILPLRFLKDRSVLGSSLSNWFC 405
             I    +  I  ++F   +  I              P+L  +   +  +  SS++ +F 
Sbjct: 259 IIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYARPLLTWKIASNAGIFTSSITGFFS 318

Query: 406 MMALMTVSYYLPIYFAGVLN----MKPTDIGKRIIPNFFST-AFGSLGAGYYMKKTGKYY 460
             A    S YL   +  VL     +    + +  IP   +T A   L A Y + K     
Sbjct: 319 CFAYELQSAYLVQLYQLVLKRNSMLASIHLWELSIPAMITTMATAYLNAKYGIIKP---- 374

Query: 461 WFVISFCVLASI-GCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALL-AMIAAVPHN 518
              I F VL  I G      I  +IS    Y+L+  PG+    +    LL + +   P +
Sbjct: 375 --AIVFGVLCGIVGSGIFTLINGEISQSIGYSLL--PGIAFGSIFQATLLSSQVQITPDD 430

Query: 519 HQ------AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSK 557
                    VT   S+A +S G + G +IG  IF  SL N L+S 
Sbjct: 431 PDFQNKFIEVTAFNSFA-KSLGFSFGGNIGAMIFTASLKNQLRSS 474

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 105/553 (18%), Positives = 212/553 (38%), Gaps = 61/553 (11%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++ + ++  +   LD         +  S + +   +S +     + SA  Q +Y ++SD
Sbjct: 93  ILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSD 152

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           ++GR  +     + + VG++I   +   +   AG                    D   LR
Sbjct: 153 VYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLR 212

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSD---------RSVGWRM---SFLIQLPIAFFS 289
            R +YQ +  + F            W S          ++  W +   +F+  L      
Sbjct: 213 WRLVYQFVPTWPFIINT--------WISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPLL 264

Query: 290 TILIILFLRLPKESKGRGLQVDGNYFS------TIKVRLSAVDWIGATTLVLFLFSFMIT 343
            ++I ++    K  + + L  +  ++       TI      +D +G   + + L   ++ 
Sbjct: 265 CVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCILVP 324

Query: 344 ASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLS 401
            +L GG +  + +   IG  V+  +   I    E K A+DPI+P + +KDR V  S ++S
Sbjct: 325 LTLAGGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRGVWASFAIS 384

Query: 402 NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW 461
                +  M   Y   +   GV     +      +  F ST  GS      + +  +   
Sbjct: 385 FLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTV-GSPIFSLLITRFSRLKP 443

Query: 462 FVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAAVPHNHQ 520
           F+I  C L  +    +   +            + + G+G ++      +++ AA  H H 
Sbjct: 444 FIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVSVQAATSHEHM 503

Query: 521 AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQ 580
           A  T+++Y F   G  +G ++ GAI+ ++L                   +L++ +  A+ 
Sbjct: 504 ATVTALNYTFYRIGSAVGAAVSGAIWTQTL-----------------YKQLLKRVGDAAL 546

Query: 581 STEWVQNSSP-SFI---------KQTLIDCYHFACK-NVFIFCLLCTIAATFSMAIIKEH 629
           +TE    +SP  FI         +Q ++  Y +  +    +  + C     FS+  +++ 
Sbjct: 547 ATE--AYASPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLC-LRDA 603

Query: 630 RLHNTLDRDNENE 642
           RL + +  DN  E
Sbjct: 604 RLTDKVAHDNIAE 616

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 98/466 (21%), Positives = 187/466 (40%), Gaps = 51/466 (10%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++ S ++  F   LD+ I      +  S + +   +S VA    L SA  Q  Y ++SD
Sbjct: 65  ILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYARLSD 124

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + +   + + +G++I   +   +   AG                    D   L+
Sbjct: 125 VFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGLFLILVLILSDCSSLK 184

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVG--------------WRMSF-LIQLPIA 286
            R  YQ    + F            W S   +               W   F L  LPI 
Sbjct: 185 WRLFYQYAPTWPFIIIT--------WISGNIISRANPIENWSWGIGMWAFIFPLTCLPIL 236

Query: 287 FFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAV------DWIGATTLVLFLFSF 340
           F    ++ +  +  K  + + L    ++F T  +  + V      D +G   + + L   
Sbjct: 237 F---CMLHMRFKARKTPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVGIFIMTISLGCI 293

Query: 341 MITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSS 399
           ++  +L GG    + + + IG  V+  +   +F Y E K AKDP+ P   LKDR +  S 
Sbjct: 294 LVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRGIWASM 353

Query: 400 LSNW-----FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMK 454
             N+     +CM A     Y  P+    V     +      + +F ST   S   GY + 
Sbjct: 354 CFNFLMDFVYCMAA----GYLYPVLIVAVDESTKSATRITSLASFVSTV-ASPFMGYAVS 408

Query: 455 KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVAL----LA 510
           ++ +   +++S C +  +    +   +   S  + ++ +    +   +  T+++    ++
Sbjct: 409 RSTRLKPYIVSGCGMWFLATGLLYHYR---SGLESHSGIIGGLVLLGLGCTLSIYPINVS 465

Query: 511 MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
             +   H + A  T+++Y     G  +GV++ GAI+ ++L ++LLK
Sbjct: 466 AQSLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLK 511

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 180/497 (36%), Gaps = 67/497 (13%)

Query: 107 RISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYL 166
           RI     ++ST    I+ LS++L   +AALD T       +  S FN    +S +  A  
Sbjct: 64  RIEVVREKMSTRVRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANS 123

Query: 167 LSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXX 226
           +  A  +P   KISD+  R V      + + +G +I   SP+    V G           
Sbjct: 124 VIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGI 183

Query: 227 XXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV------GWRMS-- 278
                    D   L+ R+        +F            W S   V       WR    
Sbjct: 184 SLMNMVIIADTTTLKWRS--------FFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYG 235

Query: 279 -FLIQLPIAFFSTILIILFLRLPKESKGR----------------GLQVDG--NYFSTIK 319
            F I  P+A    IL++ +L       G                    V G   Y+  +K
Sbjct: 236 MFAIITPVALTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVK 295

Query: 320 VRLSAVDWIGATTLVLFLFSF---MITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYT 375
           V L  +D  G   L+L  F+F   ++  SL    E  + +   I + VV  I  + +   
Sbjct: 296 VSLIEIDAFG---LILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVF 352

Query: 376 ELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMA--------------LMTVSYYLPIYFA 421
           E+  A  P+LP R L +R+ +   + ++   MA              ++ +SY   +Y +
Sbjct: 353 EVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLS 412

Query: 422 GVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQ 481
               M            FF   +G+L  G++  K  +     I    +            
Sbjct: 413 NTTTMGLC---------FFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGS 463

Query: 482 PDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSI 541
           P I +     ++   G  A+V+ T   +A  AAVPH   A T S+   + S G  +G +I
Sbjct: 464 PGIGLVVAALVVTNFGDAANVMGT--QVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAI 521

Query: 542 GGAIFRESLDNLLKSKV 558
             AI+ + L   L   V
Sbjct: 522 TSAIWTDRLPGALSKYV 538

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 137 DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITF 196
           D  IVST++  +A +F     I W+ T Y L +A    I+G+I+   G K  ++F  + F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 197 FVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX 256
            +GSLI  L+ S   L+ GR IA                 +V    R +   + +  F  
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 257 XXXXXXXXXXWFSDRSVGWRMSFLIQLPIA 286
                      F+  SV WR  F + LPI 
Sbjct: 203 ASVVGPFLGGVFTS-SVTWRWCFYVNLPIG 231

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/464 (21%), Positives = 182/464 (39%), Gaps = 60/464 (12%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           ++ + +L  +   LD  I S   ++ A+ +   P IS ++    + SA  Q  + ++SD+
Sbjct: 60  LLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSDV 119

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  + +     + VG++I   +   +    G                    D   LR 
Sbjct: 120 FGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLRW 179

Query: 243 RALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILF 296
           R LYQ      GI N +              +S     W  +F+I  P+     IL +L 
Sbjct: 180 RLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMW--AFII--PLTCLPMILCMLH 235

Query: 297 LRLP--KESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASL-------- 346
           +R    +  +   L+ + +Y+ T  +  + ++      +V  L   ++TAS+        
Sbjct: 236 MRFKARRTEQWAELRNERSYYQTHGLIKTLIELFWKVDVVGIL---LMTASIGCVLAPLT 292

Query: 347 --GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404
             GG    + + + I   V+  +   IF   E K A+DPI+P   +KDR+V  S  S + 
Sbjct: 293 LAGGTGSKWQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFL 352

Query: 405 C-MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA-----------------FGS 446
              + +M   Y   I   GV     +     I+ +F +TA                 +  
Sbjct: 353 IGFIYMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIV 412

Query: 447 LGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITV 506
            G G +M   G +Y +         I    +VW                 GLG  +LI  
Sbjct: 413 AGCGLWMLAMGLFYHYRGGEFAHGGIVAAMVVW-----------------GLGDVLLIYP 455

Query: 507 ALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
             +++ +A  H++ A+ T+++Y     G + G +I GAI+ ++L
Sbjct: 456 ITVSVQSATSHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTL 499

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 105/538 (19%), Positives = 209/538 (38%), Gaps = 31/538 (5%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++ S ++  +   LD  I      +  S + E   +S +     ++SA  Q +Y + SD
Sbjct: 114 ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASD 173

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + I   + + VG++I   +   +   AG F                  D   L+
Sbjct: 174 VFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLK 233

Query: 242 NRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
            R  YQ       I N +              +S     W   F    P++    IL ++
Sbjct: 234 WRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIF----PLSSIPIILCLI 289

Query: 296 FLRL--PKESKGRGLQVDGNYF------STIKVRLSAVDWIGATTLVLFLFSFMITASL- 346
            +R    K  + + L+ + +Y       S I      +D IG   +   L   ++  +L 
Sbjct: 290 HMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTLA 349

Query: 347 GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFC 405
           GG    +     I    +  +   IF + E K +K P++P + +KDR+V  S ++S    
Sbjct: 350 GGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFLID 409

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVIS 465
            +  M V Y   +   GV     +      + +F ST  GS      + +  +   F+++
Sbjct: 410 FIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTV-GSPIFALLITRFTRLKPFIVA 468

Query: 466 FCVLASIGCLQIVWIQPDISVFKQYTL-MFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524
            C L  +    +   +   S        + + G+G ++      +++ AAV H   A  T
Sbjct: 469 GCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINVSVQAAVSHADMATVT 528

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEW 584
           +++Y     G  +G ++ GAI+ ++L   L  ++          D  +     +S  +  
Sbjct: 529 ALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRM---------GDATLATAAYSSPYSFI 579

Query: 585 VQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENE 642
           V  +  + ++  +++ Y +  +   I  L+ T+        +++ RL + +  D+  E
Sbjct: 580 VNYTWGTTVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVASDDIEE 637

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/475 (21%), Positives = 189/475 (39%), Gaps = 23/475 (4%)

Query: 97  SGHYGAI-ESRRISSKGTEL-STARLK-----IIMLSMYLGIFLAALDNTIVSTLLAHIA 149
           SG Y A+ ++R +  K TE+  TA  K     I++ S ++  +   LD  I      +  
Sbjct: 48  SGKYDALRQNRSLIIKQTEIIGTAYNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYAT 107

Query: 150 SEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSF 209
           S +++   +S +     + SA  Q IY ++SD+FGR  + I   I + VG++I   +   
Sbjct: 108 SSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDV 167

Query: 210 EWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS 269
           +   AG                    D   L+ R LYQ    + F              +
Sbjct: 168 QRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITS-RA 226

Query: 270 DRSVGWRMS---FLIQLPIAFFSTILIILFL--RLPKESKGRGLQVDGNYFST------I 318
           +  V W      +    P++    +L +L +  R  K  + + L+   +Y+        +
Sbjct: 227 NPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQWRAGKTPEWQELKGQKSYYQEHGLMKIL 286

Query: 319 KVRLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTEL 377
           +     +D IG   +   L   ++  +L GG +  +   + IG  V+  +   I    E 
Sbjct: 287 EQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVWEY 346

Query: 378 KIAKDPILPLRFLKDRSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRII 436
             A+DPILP + +KDR V  S  +S     +  M   Y   +    V     +      +
Sbjct: 347 SYARDPILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTL 406

Query: 437 PNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFI 495
            +F S    S   G  M +  +   F++S C L  +    +   +            + +
Sbjct: 407 SSFVSVV-ASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCV 465

Query: 496 PGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
            G+G ++      +++ +AV H + A  T+++Y     G  +G ++ GAI+ ++L
Sbjct: 466 WGVGTTLFTYPVTVSVQSAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTL 520

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 95/458 (20%), Positives = 170/458 (37%), Gaps = 48/458 (10%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           ++LS ++  +   LD  I      +  S ++E   +S +     + SA  Q IY ++SD+
Sbjct: 77  LLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDV 136

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  + I   I + VG++I   +   +   AG                    D   L+ 
Sbjct: 137 FGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKW 196

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFL-- 297
           R LYQ    + F              ++  V W      +    P++    +L +L +  
Sbjct: 197 RLLYQFAPTWPFIINTWIAGNITS-RANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQW 255

Query: 298 RLPKESKGRGLQVDGNYFST------IKVRLSAVDWIGATTLVLFLFSFMITASL-GGKE 350
           R  K  +   L+   +Y+        IK     +D IG   +   L   ++  +L GG +
Sbjct: 256 RAKKTPEWHTLKGQKSYYQEHGFIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLAGGVK 315

Query: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFCMMAL 409
             +   + IG  V+  +   +    E + A+DPILP + +KDR+V  S  +S     +  
Sbjct: 316 TTWNDSRLIGPFVLGFVLIPVLWIWEYRFARDPILPYKLVKDRAVWSSMGISFLIDFIYY 375

Query: 410 MTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA-----------------FGSLGAGYY 452
           M   Y   +    V     +      + +F ST                  F   G   +
Sbjct: 376 MAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASPFFALLVTRCTRLKPFIMFGCSLW 435

Query: 453 MKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMI 512
           M   G  Y F       + I     VW                 G+G ++      +++ 
Sbjct: 436 MVAMGLLYHFRGGSQSHSGIIGALGVW-----------------GVGTTLFTYPVTVSVQ 478

Query: 513 AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
           +AV H + A  T+++Y     G  +G ++ GAI+ ++L
Sbjct: 479 SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTL 516

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 95/446 (21%), Positives = 170/446 (38%), Gaps = 51/446 (11%)

Query: 136 LDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNIT 195
           LD    S    +  S +NE   +S +     + S   Q I+ ++SDIFGR  + +   + 
Sbjct: 93  LDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVL 152

Query: 196 FFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFX 255
           + VG++I   +        G                    D+ P + R L+Q   ++   
Sbjct: 153 YIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSW--- 209

Query: 256 XXXXXXXXXXXWFSDRSV-------GWRMS---FLIQLPIAFFSTILIILFL--RLPKES 303
                      W S   V        WR     +    PI+    I+ +L+   +  K +
Sbjct: 210 -----PCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPFIIFLLYFTRQASKTA 264

Query: 304 KGRGLQVDGNYFST-----IKVRLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHK 357
           + + +Q D    S      IK   S +D +G + + + L   ++  +L GG    +    
Sbjct: 265 EWKEIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPG 324

Query: 358 FIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYL- 416
            I   VV  +  + F   ++K AK+ +LP + LKDR V  S  +     +   T+S YL 
Sbjct: 325 IIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLY 384

Query: 417 PIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIG-CL 475
           P+    V     +      +P F +   GS+  G  + +T +         + + IG CL
Sbjct: 385 PVLLVSVNESSKSATRILWLPTFVACT-GSIFFGLLVVRTKR-------LKIYSIIGVCL 436

Query: 476 QIVWIQPDISVFKQYT-----------LMFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524
            I+     I +F  Y               + G G+++     ++ +     H + A  T
Sbjct: 437 WIL----SIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMTSHKNMASIT 492

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESL 550
            + + F   G   G SI GAI+ +++
Sbjct: 493 GLYFMFAQIGSASGASISGAIWTQTM 518

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 113/555 (20%), Positives = 201/555 (36%), Gaps = 66/555 (11%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           ++ S +L  F   LD    S    + A+ + +   +S +     +     Q  + ++SD+
Sbjct: 66  LLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLSDV 125

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  + +   I + VG++I   +   +    G                    D+ PLR 
Sbjct: 126 FGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRW 185

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSD---------RSVGWRM---SFLIQLPIAFFST 290
           R  YQ   +F              W S          ++  W +   +F+  L    F T
Sbjct: 186 RLFYQFTASF--------PCIIISWISGDIVEAANPMKNWSWDIGMWAFIFPLSSLPFIT 237

Query: 291 ILIILFLRLPKESKGRGLQVD-----GNYFSTIKVRLSAVDWIGATTLVLFLFSFMITAS 345
            L        K  K + L+        N    +K   + +D +G   +   L   ++  +
Sbjct: 238 YLFYATHISSKTKKWKDLRNKVETHKRNIILVVKDIFNQIDIVGTVLVTAALGLILVPLT 297

Query: 346 L-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404
           L GG    +     I   V+ +   L+F + E K AK+  LP   LKDR V  S ++ + 
Sbjct: 298 LAGGVSERWHEPGIIATLVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFL 357

Query: 405 CMMALMTVSYYL-PIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFV 463
             M    +S YL P+    V     +      +P F +    S+  G  +    +   F 
Sbjct: 358 EKMIYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMA-CLCSVFFGLLVVSVQRLKVFT 416

Query: 464 ISFCVLASIGCLQIVWIQPDISVFKQYT-----------LMFIPGLGASVLITVALLAMI 512
           I         C   +WI   I +F Q+               + G G+++     ++ + 
Sbjct: 417 I---------CGTFLWI-ISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSIIVTLQ 466

Query: 513 AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLKSKVLKFKSPEHSEDEL 571
           A   H++ A  T + + F   G   G SI GAI+ +++   LLK   LK        D  
Sbjct: 467 AMASHDNMASITGLYFMFAQVGAATGASISGAIWTQTMYKQLLKQ--LK------DSDLT 518

Query: 572 MRIIDKASQ---STEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKE 628
           M +     +   S  W         +  +I  Y    K   +  L+ T+    S+   K+
Sbjct: 519 MAVFASPYEFIASYAWGTKE-----RDLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKD 573

Query: 629 HRLHNTLDRDNENEE 643
            +L +++  D  +E+
Sbjct: 574 RKLSDSVSSDASHED 588

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 104/478 (21%), Positives = 191/478 (39%), Gaps = 53/478 (11%)

Query: 106 RRISSKGTELSTARLKIIML-SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATA 164
           R+      +  T +LK I L S ++  F   LD++I  T + +  + ++    IS V+  
Sbjct: 54  RKSELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVI 113

Query: 165 YLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXX 224
            L+ SA  Q I+G +SDIFGR  + +   + + VG++I   +   +   AG         
Sbjct: 114 VLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLV 173

Query: 225 XXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV---------GW 275
                      D   L+ R  Y  I ++              W S   V          W
Sbjct: 174 GVMLQVVLMLSDNSSLKWRLFYTLIPSW--------PSIITTWVSGSVVEAANPLENWSW 225

Query: 276 RMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYFST-----IKVRL-SAVD 326
            ++ +    P+     IL +L +R  +  + + + LQ + +Y+ T     + V+L   +D
Sbjct: 226 NIAMWAFIFPLCCIPLILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKLD 285

Query: 327 WIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPIL 385
            +G       +   ++  +L GG    + + K IG  V+  +    F Y E ++A  P  
Sbjct: 286 VVGVLLFTAGVGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVLVPGFIYWESRLALVPFA 345

Query: 386 PLRFLKDRSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF-FSTA 443
           P + LKDR V     +  + C +  M   Y   I    V     +    RII  + F TA
Sbjct: 346 PFKLLKDRGVWAPLGIMFFICFVYQMAAGYLYTILVVAVDESASS--ATRIINLYSFVTA 403

Query: 444 FGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQY-----------TL 492
             +   G  + ++ +    + S+ +    G L  +     + +F +Y             
Sbjct: 404 VVAPFLGLIVTRSSR----LKSYIIFG--GSLYFI----TMGLFYRYRSGQDADGGIIAG 453

Query: 493 MFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
           M I GL + +     ++++ +   H + A  T+++Y     G  +  +I GAI+ +SL
Sbjct: 454 MVIWGLSSCLFDYPTIVSIQSVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSL 511

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 111/539 (20%), Positives = 203/539 (37%), Gaps = 39/539 (7%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I +   +L  +   LD+ I      +  S ++E   +S V     + SA  Q +Y ++SD
Sbjct: 69  IFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLSD 128

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
            FGR  + +   + + +G++I   +   +   AG                    D+  LR
Sbjct: 129 AFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTLR 188

Query: 242 NRALYQGICNFYFXXXX-------XXXXXXXXWFSDRSVGWRMSF-LIQLPIAFFSTILI 293
            R  YQ +  + +                   W  D  + W   F L  LPI      +I
Sbjct: 189 WRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGM-WAFIFPLSCLPIL---ACMI 244

Query: 294 ILFLRLPKESKGRGLQVDGNYFSTIKVRLSAV------DWIGATTLVLFLFSFMITASL- 346
            +  R  K  + + L+    Y+    +  S V      D IG   +   L   ++  +L 
Sbjct: 245 HMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLFWKIDIIGVLLMAASLGCILVPLTLA 304

Query: 347 GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFC 405
           GG    +   + IG+ V+  +   IF   E K A DPI+P + +KDR V  S  +S    
Sbjct: 305 GGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFATDPIVPYKLVKDRGVWASLGISFLID 364

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA---FGSLGAGYYMKKTGKYYWF 462
            +  M   Y   +    V            + +F ST    F SL    + +       F
Sbjct: 365 FIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKP----F 420

Query: 463 VISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAAVPHNHQA 521
           +I  C L  +    +   +   S        + + GLG++       +++ AAV H   A
Sbjct: 421 IIFGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQAAVSHEQMA 480

Query: 522 VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQS 581
             ++++Y F   G  +G ++ GAI+ + L   L S +          D  +      S  
Sbjct: 481 TVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLM---------GDATLATAAYGSPY 531

Query: 582 TEWVQNSSPSFIKQTLIDCYHFACK-NVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
           T  V  +  +  ++ +++ Y +  +    +  + C     FS+  +++ RL + +  D+
Sbjct: 532 TFIVTYTWGTPEREAMVEAYRYIQRLETVVALVFCVPLVAFSLC-LRDSRLTDNVAHDD 589

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 110/479 (22%), Positives = 186/479 (38%), Gaps = 67/479 (13%)

Query: 120 LKI-IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           LKI ++++++L  +   L   I  ++  + A+ F + P+I  + T   + +A     Y +
Sbjct: 60  LKIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYAR 119

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           +SD FGR    IF  + + VG +I   +P+F  L AG  I                 DI 
Sbjct: 120 LSDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADIS 179

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVG------WRMSFLIQLPIAFFSTIL 292
            LR+R     I    F               D   G      WR  + I   I  FST+L
Sbjct: 180 GLRDRTFAMNI----FLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLL 235

Query: 293 IIL---FLRLPKESKGRGLQVD----GNYFSTIKVRLSA-VDWIGATTLVLFLFSFMITA 344
           +IL   + +     +GR  Q +    G  +     +L+  V+ IG      FL   ++  
Sbjct: 236 LILPYAYAQYLAWREGRLPQFEFRKQGQSWKQALWKLTEDVNLIGIVLFTAFLVLVLLPL 295

Query: 345 SL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNW 403
           +L GG    +     I + VV     ++F   EL +AK P +P  +L D ++  + L  +
Sbjct: 296 TLAGGASTKWKEGHIIAMIVVGGCCGILFFVWELWLAKKPFIPRVYLGDATIYVALLMEF 355

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFV 463
              +AL     YL                          AFG   +    ++ G+ Y F+
Sbjct: 356 AWRLALQIELEYL--------------------ITVLMVAFGE--SKLSAQRIGQLYNFL 393

Query: 464 ISFCVLASIGCLQIVWIQPDISVFK-------------QYTLMF--IPGL-GASVLITVA 507
            S C    +G +   +  P   +               +Y + +  I GL GA V++ +A
Sbjct: 394 QS-CTNVVVGIMLHFYPHPKPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGIA 452

Query: 508 -------LLAMI-AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
                  +  ++ A+  H   AV T +  +    G  +G SI GAI+ + L   L  ++
Sbjct: 453 GSMVRFPMWTLVHASTSHEEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRL 511

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 99/492 (20%), Positives = 192/492 (39%), Gaps = 63/492 (12%)

Query: 106 RRISSKGTELSTARLK-IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATA 164
           R+      +  T  LK + + S +L  F   LD  I    + +  + ++    IS V   
Sbjct: 55  RKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVI 114

Query: 165 YLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXX 224
            ++ SA  Q IY  +SD+FGR  + I   + + VG++I   +   +   AG         
Sbjct: 115 SMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLV 174

Query: 225 XXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV---------GW 275
                      D   L+ R  Y  +  +              W S   +          W
Sbjct: 175 GVMLQVILVLSDNSSLKWRLFYTFVPAW--------PSIITTWVSGNVIETANPEDNWSW 226

Query: 276 RMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYFS------TIKVRLSAVD 326
            ++ +    P++    I  +L +R  +  E + + LQ +  Y+       T+      +D
Sbjct: 227 NIAMWAFIFPLSCIPLIACMLHMRWKVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLD 286

Query: 327 WIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPIL 385
            +G   L +     ++  +L GG    + S K I   V+  +   IF Y E K+A  PI 
Sbjct: 287 VVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVLIAIFIYWESKLALAPIA 346

Query: 386 PLRFLKDRSVLGSSLSNWFCMMALMTVSYYLP---IYFAGVLNMKPTDIGKRIIPNFFS- 441
           P + LKDR +          +M L+   Y +    +Y   ++ +  TD+    I + +S 
Sbjct: 347 PFKMLKDRGIWAP-----LWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSF 401

Query: 442 -TAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTL-------- 492
            +A  +   G+ + ++ +   +++  C L  +           + +F +Y +        
Sbjct: 402 VSAIFAPVLGFIVARSSRLKPYMVLGCSLYFV----------TMGLFYRYRVGKDAHQGV 451

Query: 493 ---MFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRES 549
              M + G+ + +      +++ +   H + A  T++SY   S G  +  S+ GAI+ + 
Sbjct: 452 IGAMVVWGICSCLFDYPVTVSIQSVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQ- 510

Query: 550 LDNLLKSKVLKF 561
              LL  K+L++
Sbjct: 511 ---LLYPKLLEY 519

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 119/296 (40%), Gaps = 27/296 (9%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +++   ++  +  +LD+ +      + AS + +   +S +     ++SAT Q +Y + SD
Sbjct: 115 LLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASD 174

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           IFGR  +L+   I + VG++I   +   +   AG F                  D   L+
Sbjct: 175 IFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLK 234

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFS----DRS-----VGWRM---SFLIQLPIAFFS 289
            R  YQ I  +              W S    DR+       W +   +F+  L      
Sbjct: 235 WRFFYQAILAW--------PNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSCIPIL 286

Query: 290 TILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVD--W----IGATTLVLFLFSFMIT 343
             LI +     +  + + L+   +YF     + S +D  W    +G   L  F+   +I 
Sbjct: 287 CCLIHMQWLASQTDEWKQLKKGKSYFKYYGYKDSLIDMFWRFDVVGVILLAAFIGLILIP 346

Query: 344 ASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS 398
            +L GG +  ++  K I   V+  +    F   E   AK PI+P R +KDRS+  +
Sbjct: 347 LTLAGGTKSRWSEGKLIAPFVIGCVMVPCFAIWEKWFAKHPIMPWRLIKDRSIWAA 402

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 532 STGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPS 591
           +T     + + G  F+  +   LK ++ ++   +HS DEL   I KA  S EW++  SP 
Sbjct: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582

Query: 592 FIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHR 630
            I  ++  CY  + + VFIF L CT        + + H+
Sbjct: 583 LISTSIFSCYLDSIRYVFIFNLFCTCIGISFFHLARTHK 621

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPE 35
          MGKKDKQRK+LR F + K  Q   D +P  P   E
Sbjct: 1  MGKKDKQRKRLRKFVQLKEAQRLFD-DPTTPIAKE 34

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 103/475 (21%), Positives = 184/475 (38%), Gaps = 66/475 (13%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           ++++++L  +   L   I  ++  + A+ F +  ++  + T   + ++     Y +ISD 
Sbjct: 66  LLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDR 125

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR    IF  + + +G +I   +P+F  L AG  I                 D+  LR+
Sbjct: 126 FGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRD 185

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVG----------WRMSFLIQLPIAFFSTIL 292
           R     I                 W S   V           WR  + I   I   ST++
Sbjct: 186 RTFAMNI--------FLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLI 237

Query: 293 IILFL-----------RLPK---ESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLF 338
           ++L             +LP    + KG+ L+       T+      ++ IG      FL 
Sbjct: 238 LVLPYVYAQYISWRSGKLPPLKLKEKGQTLR------QTLWKFADDINLIGVILFTAFLV 291

Query: 339 SFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLG 397
             ++  ++ GG    +     I + VV      IF   ELK AK+P +P  +L D ++  
Sbjct: 292 LVLLPLTIAGGATSKWREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPRVYLGDPTIYV 351

Query: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRI--IPNFFSTAFGSLGAGYYMKK 455
           + L  +   + L     YL      V   + T   +RI  + NF  +   ++  G  +  
Sbjct: 352 ALLMEFVWRLGLQIELEYLVTVLM-VAFGESTLSAQRIAQLYNFLQSC-TNIVVGIMLHF 409

Query: 456 TGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMF--IPGL-GASVLITVALLAMI 512
                 FV++  +L  IG          + +  +Y +++  I GL GA +++ +A   MI
Sbjct: 410 YPHPKVFVVAGSLLGVIG----------MGLLYKYRVVYDGISGLIGAEIVVGIA-GGMI 458

Query: 513 ---------AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
                    A+  HN  A  T +  +    G  +G SI GAI+ + L   L  ++
Sbjct: 459 RFPMWTLVHASTTHNEMATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRL 513

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 108/488 (22%), Positives = 177/488 (36%), Gaps = 57/488 (11%)

Query: 107 RISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYL 166
           RI     ++ST    I+  S+ L  ++AALD T       +  S FN    +S +  A  
Sbjct: 65  RIEVVKEKMSTKVTWILAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLTIANS 124

Query: 167 LSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXX 226
           +  A  +P   KISD+  R V      I + +G +I   SP+    V G           
Sbjct: 125 VIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVGQSGI 184

Query: 227 XXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDR------SVGWRMS-- 278
                    D   L+ R+    + +  +            W S        S  WR    
Sbjct: 185 NLMNMVIVADTTSLKWRSFITSLLSVPY--------LVTTWISGYIVQNIISSNWRWGYG 236

Query: 279 -FLIQLPIAFFSTILIILFLRL-------------PKESKGRGLQVDG-----NYFSTIK 319
            F I  P+A    IL++ +L               P   K R ++  G      Y+  +K
Sbjct: 237 MFAIITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLK 296

Query: 320 VRLSAVDWIG------ATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFG 373
             L  +D  G      A +L+L   S    A  G K     + + IG   + +I  +IF 
Sbjct: 297 TSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIG--GIFLISYVIF- 353

Query: 374 YTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAG----VLNMKPT 429
             E+  A  P+LP R L +R+ +   + ++   M      Y+  ++F      VLN+   
Sbjct: 354 --EVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMG----GYFSLLFFTSYTFVVLNLSYK 407

Query: 430 DIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGC-LQIVWIQPDIS--V 486
           +             F  +  G   +   +Y  F +    +  IG  L +   + D S  +
Sbjct: 408 NWVYLSNTTTMGLCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGI 467

Query: 487 FKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIF 546
                 + +   G +  +    +A  AAVPH   A T S+   + S G  +G +I  A++
Sbjct: 468 GLIVAALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVW 527

Query: 547 RESLDNLL 554
              L   L
Sbjct: 528 TNELPGAL 535

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 118/557 (21%), Positives = 211/557 (37%), Gaps = 72/557 (12%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +I  S+++  +   LD  +  T      S FN     S V     ++S+  Q  + + SD
Sbjct: 77  LIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASD 136

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           IF R+  ++   + + VG++I   + S      G  I                 D   L 
Sbjct: 137 IFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLN 196

Query: 242 NRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLP---IAFFS 289
            R + +       I N +               SD    W+     + I  P   I  F 
Sbjct: 197 WRVVAENAPMLPAIINTWVSGNIT---------SDLGSKWQWGLGMWAIIFPASCIPLFV 247

Query: 290 TILIILFLRLPKESKGRGLQVDGNYFS----TIKVRLSAVDWIGATTLV-LFLFSFMITA 344
            I  + ++      K R +    +  +     I + +  +D+IG   LV +F    +   
Sbjct: 248 CIYHMRYMAKKNNEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFT 307

Query: 345 SLGGKEIPYTSHKFIGLCVVTVIGAL-IFGYTELKIAKDPILPLRFLKDRSVLGSSLSNW 403
           + GG    + S  FI   VV  + AL IF   E K ++ PIL L  + DR +  +   ++
Sbjct: 308 TSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISF 367

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF-FSTAFGSLGAGYYMKKTGKYYWF 462
           F    L     YL  +    ++ + T  G RI     F     +   G ++ K  +   F
Sbjct: 368 FIQFCLYVNDTYLYTFLLVAVD-QTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIF 426

Query: 463 VISFCVLASIGCLQIVWIQPDISVFKQYTLM--FIPGLGA-SVLITVALL---------- 509
           ++       IGC         +S F  Y L   +  GLG+ S +IT + L          
Sbjct: 427 IV-------IGC---------VSWFVVYGLYVHYNGGLGSRSGIITASCLSGFGYGFIKS 470

Query: 510 ---AMIAAVPHNHQ--AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP 564
              A + A  ++HQ  A+ T++  A  + G   G ++ GAI+   L + L+  +      
Sbjct: 471 PLKASLQASSNSHQNLAIVTALFLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLA 530

Query: 565 EHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMA 624
           + + D  ++ I +    T          ++Q L+  Y    + + I CL+  I    S  
Sbjct: 531 DSAFDSPIKFIKQYKWHTA---------VRQHLVSSYGSVWRILNIVCLVLVIPMLVSSF 581

Query: 625 IIKEHRLHNTLDRDNEN 641
           ++++ +L N++  D  +
Sbjct: 582 LLRDRKLSNSVAYDQRD 598

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 93/449 (20%), Positives = 167/449 (37%), Gaps = 26/449 (5%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I  S++L  F+  LD+ +  ++ A+  + + +   +S V     +++A   P+Y ++SD+
Sbjct: 77  IFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSDV 136

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  +++   + +  G++IC  +       AG  +                 D   L  
Sbjct: 137 FGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAADFSNLNW 196

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS----FLIQLPIAFFSTILIILFLR 298
           R     I    F               D    W       + I LP+A    +L  + ++
Sbjct: 197 RVFCTLISAAPFIINTWVSGDIVEAIGDN---WSWPGIGVWAICLPVATIPLVLCFIHMQ 253

Query: 299 LPKESKG-----RGLQVDGNYFS----TIKVRLSAVDWIGATTLVLFLFSFMITASL-GG 348
              +  G     RG+Q +          ++V    +D  G  +L++ L   +   +L GG
Sbjct: 254 YLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTLAGG 313

Query: 349 KEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV---LGSSLSNWFC 405
           +   + + K I   ++      +F + E +IA  PI P    +DR V   LG  +   FC
Sbjct: 314 ETAEWRTAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMFRDRGVYCALGIGILIDFC 373

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNF-FSTAFGSLGAGYYMKKTGKYYWFVI 464
               M   Y   I    +   +      RI   + FST    L  G  + K  K   F++
Sbjct: 374 WY--MQGDYLYTILVVAI--HESVKSATRINSLYSFSTIITGLCVGLAISKVRKMKCFIV 429

Query: 465 -SFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVT 523
              C+      + I +     S         + G G +        ++ A V H   A  
Sbjct: 430 FGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYVNHERMATI 489

Query: 524 TSISYAFRSTGCTLGVSIGGAIFRESLDN 552
           T++       G  +G S+ GAI+ + L N
Sbjct: 490 TTLYAISYYIGSAVGSSVSGAIWTQVLPN 518

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 107/493 (21%), Positives = 184/493 (37%), Gaps = 81/493 (16%)

Query: 112 GTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSAT 171
           G   ST +  +++++++L  +   L   I  ++  + A+ F +  ++  + T   + S+ 
Sbjct: 51  GVTFSTLK-TVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSV 109

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXX 231
               Y ++SD FGR    IF  + + VG +I   +P+F  L AG  I             
Sbjct: 110 VAVPYARMSDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLAT 169

Query: 232 XXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVG----------WRMSFLI 281
               D+  LR+R     I                 W S   V           WR  + I
Sbjct: 170 ALTGDLSGLRDRTFAMNI--------FLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGI 221

Query: 282 QLPIAFFSTILIILFLRLPKESKGRG-------LQVDG-NYFSTIKVRLSAVDWIGATTL 333
              I  FST++++L     +    R        L+  G N   TI      ++ IG    
Sbjct: 222 FCIIVPFSTLILVLPYAYAQYISWRNGTLPPFKLKEKGQNLRQTIWKFAEDINLIGIILF 281

Query: 334 VLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKD 392
             FL   ++  ++ GG    +     I + VV      IF   EL+ AK+P +P  +L D
Sbjct: 282 TAFLVLVLLPLTIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGD 341

Query: 393 RSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFG--SLGAG 450
            ++  + L  +   + L     YL                          AFG  +L A 
Sbjct: 342 PTIYVALLMEFVWRLGLQIELEYL--------------------VTVLMVAFGESTLSA- 380

Query: 451 YYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFK-------------QYTLMF--I 495
              ++ G+ Y F+ S C    +G +   +  P + V               +Y +++  I
Sbjct: 381 ---QRIGQLYNFLQS-CTNIVVGIILHFYPHPKVFVVAGSLLGVLGMGLLYKYRVVYDGI 436

Query: 496 PGL-GASVLITVALLAMI---------AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI 545
            GL GA +++ +A   MI         A+  H   A  T +  +    G  +G SI GAI
Sbjct: 437 SGLIGAEIVVGIA-GGMIRFPMWTLVHASTTHKEMATVTGLLMSVYQIGDAVGASIAGAI 495

Query: 546 FRESLDNLLKSKV 558
           + + L   L  ++
Sbjct: 496 WTQRLAKELIQRL 508

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 115/293 (39%), Gaps = 21/293 (7%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++ S +L  +   LD ++      +  + + E   +S +A    + SA  Q +Y +++D
Sbjct: 64  ILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYARLAD 123

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + I   I + VG++I   +   +   AG                    D   L+
Sbjct: 124 VFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGYVGVVLVLLLILSDFSSLK 183

Query: 242 NRALYQGICNFYFXXX-------XXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
            R  YQ +  + F                   W  D S+ W   F    P++    I  +
Sbjct: 184 WRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISM-WAFIF----PLSALPIICCM 238

Query: 295 LFLRLPKE--------SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASL 346
           L +R+           S+ +       +  T+      +D IG   + + L   ++  +L
Sbjct: 239 LHMRIKARKTPEWQVLSEEKSFYQTHGFIQTLVQLFWKLDVIGVLIMTVSLGCILVPLTL 298

Query: 347 -GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS 398
            GG    + + + IG  V+  +   ++ Y E K AK+P+ P + LKDR V  +
Sbjct: 299 AGGYSSKWQNSQIIGPIVLGFVLIPMYIYWESKWAKEPMAPFKLLKDRGVWAA 351

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 130/339 (38%), Gaps = 51/339 (15%)

Query: 301 KESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLG-GKEIPYTSHKFI 359
           K  K R   V   +F  I      +D IG   + +     ++  +L  G    + S K I
Sbjct: 115 KALKERAHSVKRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKII 174

Query: 360 GLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV---LGSSLSNWFCMMALMTVSYYL 416
           G  V   +  LIF + E   A +P+LP + LKDR +   LG +  N+F     +   +  
Sbjct: 175 GTLVSGGVLFLIFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFY--IACDFLY 232

Query: 417 PIYFAGVLNMKPTDIGKRI-IPNFFSTA---FGSL--------------GAGYYMKKTGK 458
           P+     +N   T   + + +P+F ++    F SL              G   +M   G 
Sbjct: 233 PVLLVS-MNESSTSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGL 291

Query: 459 YYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHN 518
           +Y F   +    S G            V     +M   GL  S  + V L AM     H+
Sbjct: 292 FYRFRGGY---GSHG-----------GVISASVIMGFSGLLCSNSVIVLLQAMTT---HS 334

Query: 519 HQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKA 578
             AV T I Y F   G  +G S+ G ++ +++ + L   +        + +     ID  
Sbjct: 335 RMAVMTGIHYTFSRIGAAVGASVSGGVWTQTMPSRLYKLLGNDTLAAEAYESPYSFIDSY 394

Query: 579 SQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTI 617
              T  V+       +  +++ Y +  + + I  L+CTI
Sbjct: 395 PWGT--VE-------RYAVVEAYKYVQRIMMIVGLICTI 424

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 114/293 (38%), Gaps = 27/293 (9%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +++ S++L  +   LD ++ S    +  + ++    +S ++   L+  A+ Q  + ++SD
Sbjct: 69  VLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSD 128

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  +LI   + + VG++I   +   +   AG                    D   LR
Sbjct: 129 VFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVILILSDFSSLR 188

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSV-------GWRMS---FLIQLPIAFFSTI 291
            R  Y  + ++ F            W S   V        W  S   +    P+     +
Sbjct: 189 WRLFYTFVPSWPF--------IINMWVSGNVVNAANPLENWSWSIGMWAFIFPLTCLPLV 240

Query: 292 LIILFLRL--PKESKGRGLQVDGNYF------STIKVRLSAVDWIGATTLVLFLFSFMIT 343
             IL +R    K    R LQ++  Y+       T+      +D +G   L + L   ++ 
Sbjct: 241 CCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQLFWKLDVVGVLLLTVTLGCILVP 300

Query: 344 ASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395
            +L GG    + +   I   V+  +   IF   E K A DPI P   LKDR V
Sbjct: 301 LTLAGGVSQKWNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGV 353

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 101/487 (20%), Positives = 189/487 (38%), Gaps = 55/487 (11%)

Query: 106 RRISSKGTELSTARLKIIMLS-MYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATA 164
           R+     ++ +T   +++ LS  +L  +  +LD++I    + +  + +N    +S ++  
Sbjct: 58  RKTEIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISII 117

Query: 165 YLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXX 224
            ++ SA  Q  +  +SD+FGR  ++I   + + VG++I   +   +   AG         
Sbjct: 118 NMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGVV 177

Query: 225 XXXXXXXXXXXDIVPLRNRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMS 278
                      D   L+ R LY        I N +              +S     W  +
Sbjct: 178 GVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMW--A 235

Query: 279 FLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFS------TIKVRLSAVDWIGATT 332
           F++ L        ++ +  +  K  + + L+ +  ++       TI      VD +G   
Sbjct: 236 FILPLSCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHGFVHTIVEVFWKVDIVGLLL 295

Query: 333 LVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLK 391
           L   +   ++  ++ GG    + + K IG  V+ V    +  Y E   AK P  P   LK
Sbjct: 296 LTASMGCILVPLTIAGGISEQWNNGKIIGPLVLGVFLVPLTIYWESNWAKVPFAPFLLLK 355

Query: 392 DRSVLGS-SLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGA- 449
           DR +    S+    C +  M   Y   +Y   +++M  T++    I N +S   G     
Sbjct: 356 DRGIWAPMSIMFLVCFIYQMAAGY---LYTILLVSMNQTELSATRIMNLYSFVAGIYSPI 412

Query: 450 -GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVAL 508
            G+ + +TG+   F++  C      CL  +     + +F +Y      GLGA   I  A+
Sbjct: 413 FGFVVARTGRLKSFMLVGC------CLYFL----VMGLFYRYR----GGLGAESGIIGAM 458

Query: 509 LAMIAA---------------VPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNL 553
           +    A                 H + A  T++       G  +G S+ GAI+     NL
Sbjct: 459 VVWGIASCMYTYPVTTSAQSVTSHENMATVTAMLLTIFRIGGAVGASVSGAIW----TNL 514

Query: 554 LKSKVLK 560
           L  K+L+
Sbjct: 515 LYPKLLQ 521

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 98/481 (20%), Positives = 179/481 (37%), Gaps = 39/481 (8%)

Query: 105 SRRISSKGTELSTARL------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           ++RI  + +EL   +        + + S ++  F   LD+ I S  + +  +++     +
Sbjct: 50  TKRIVIRKSELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLL 109

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S V+   L  SA  Q  +  +SD+FGR  + I     + VG++I   +   +   AG   
Sbjct: 110 STVSVISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIF 169

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV----- 273
                            D   L+ R  Y  +  +              W S   +     
Sbjct: 170 YNIGLVGAMFQVTLMLSDSSSLKWRLFYNFVPAW--------PALVTVWISGNVIHLANP 221

Query: 274 ----GWRMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYFST------IKV 320
                W ++ +    P A    I  +L +R  L  + + + LQ +  YF T      +K 
Sbjct: 222 KQNWSWGIAMWAFIFPAACLPIIGCLLHMRWKLRNDPEWKDLQEEKTYFQTHGLVQTLKQ 281

Query: 321 RLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
               +D +G     +     +I  ++ GG    + S K I   V+  +    F Y E K+
Sbjct: 282 LFWKLDVVGVLLFSVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVLVPAFIYWESKL 341

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWF-CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPN 438
           A  P+ P + LKDR +    L  +  C + +M   Y   I    V   + +    RI   
Sbjct: 342 ALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILL--VAGNESSLSATRITSL 399

Query: 439 F-FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIP 496
           + F  A  S   G ++ +  +   F +  C L  +        +  +   K     M I 
Sbjct: 400 YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIW 459

Query: 497 GLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           G+ +        ++M     H + A  T++       G  +G ++ GAI+ ++L   LLK
Sbjct: 460 GITSCFFNYPINISMQTVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLK 519

Query: 556 S 556
           +
Sbjct: 520 A 520

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 105/557 (18%), Positives = 208/557 (37%), Gaps = 62/557 (11%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           ++++S ++  +   LD  I      +  S + E   +S V     + SA  Q +Y ++SD
Sbjct: 72  VLLVSAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSD 131

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
            FGR ++ +   + + VG++I   +   +   AG                    D   L+
Sbjct: 132 FFGRFILFVIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLK 191

Query: 242 NRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295
            R  YQ       I N +              +S     W   F    P++    +L ++
Sbjct: 192 WRLFYQFAPTWPFIINTWISGNITLAANPLVHWSWDVGMWAFIF----PLSCIPMLLCMI 247

Query: 296 FLRLPKE--SKGRGLQVDGNYFS------TIKVRLSAVDWIGATTLVLFLFSFMITASL- 346
            ++       + + L+ + +Y+       T+K     +D IG   +V +L   ++  +L 
Sbjct: 248 HMQWKASKTEEWKELKKEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLA 307

Query: 347 GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFC 405
           GG +  +   + IG  V+  +   IF   E   A+DP++P   +KDR V  S  +S    
Sbjct: 308 GGVKSKWNDGRIIGPFVLGFVLVPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLID 367

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA-----------------FGSLG 448
            +  M   Y   +    V     +      + +F ST                  F  +G
Sbjct: 368 FIFYMASDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVG 427

Query: 449 AGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVAL 508
              +M   G  Y F       + I     VW                 G+G ++      
Sbjct: 428 CSLWMLSMGLLYHFRGGEQSHSGIIGALCVW-----------------GIGTTLFTYPVN 470

Query: 509 LAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSE 568
           +++ +A  H + A  T+I+Y     G  +G ++ GAI+ +     L   +LK  +     
Sbjct: 471 VSVQSATSHENMATVTAINYTCYRLGSAIGAAVSGAIWTQK----LYPDILKRVTEVVGA 526

Query: 569 DELMRIIDKASQS--TEWVQNSSPSFIKQTLIDCYHFACK-NVFIFCLLCTIAATFSMAI 625
            E + I  +A  S  T   + +  + ++  +++ Y +  +    +  + C     FS+  
Sbjct: 527 TEAVTIATEAYSSPYTFITKYTWGTPVRDAVVESYRYIQRLETIVALVFCVPLIIFSLC- 585

Query: 626 IKEHRLHNTLDRDNENE 642
           +++ +L + +  +N  E
Sbjct: 586 LRDAKLTDEIAHENIKE 602

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 99/481 (20%), Positives = 179/481 (37%), Gaps = 39/481 (8%)

Query: 105 SRRISSKGTELSTARL------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           ++RI  +  EL   +        + + S ++  F   LD+ I S  + +  +++     +
Sbjct: 50  TKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLL 109

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S V+   L  SA  Q  +  +SD+FGR  + I   + + VG++I   +   +   AG   
Sbjct: 110 STVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIF 169

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS--------- 269
                            D   L+ R LY  +  +              W S         
Sbjct: 170 YYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAW--------PALVTVWISGNVVHVANP 221

Query: 270 DRSVGWRMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYF------STIKV 320
           +++  W ++ +    P      I  +L +R  L   S+ + LQ +  YF       T+K 
Sbjct: 222 EKNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQ 281

Query: 321 RLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
               +D +G     +     +I  ++ GG    + S K I   V+  +    F Y E K+
Sbjct: 282 LFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFFIYWESKL 341

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWF-CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPN 438
           A  P+ P + LKDR +    L  +  C + +M   Y   I    V   + +    RI   
Sbjct: 342 ALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILL--VAGNESSLSATRITSL 399

Query: 439 F-FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIP 496
           + F  A  S   G ++ +  +   F +  C L  +        +      K     M + 
Sbjct: 400 YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVW 459

Query: 497 GLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           G+ +        ++M     H + A  T+        G  +G ++ GAI+ +SL   LLK
Sbjct: 460 GITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLK 519

Query: 556 S 556
           +
Sbjct: 520 A 520

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 99/481 (20%), Positives = 179/481 (37%), Gaps = 39/481 (8%)

Query: 105 SRRISSKGTELSTARL------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           ++RI  +  EL   +        + + S ++  F   LD+ I S  + +  +++     +
Sbjct: 50  TKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLL 109

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S V+   L  SA  Q  +  +SD+FGR  + I   + + VG++I   +   +   AG   
Sbjct: 110 STVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIF 169

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS--------- 269
                            D   L+ R LY  +  +              W S         
Sbjct: 170 YYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAW--------PALVTVWISGNVVHVANP 221

Query: 270 DRSVGWRMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYF------STIKV 320
           +++  W ++ +    P      I  +L +R  L   S+ + LQ +  YF       T+K 
Sbjct: 222 EKNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQ 281

Query: 321 RLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
               +D +G     +     +I  ++ GG    + S K I   V+  +    F Y E K+
Sbjct: 282 LFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFFIYWESKL 341

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWF-CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPN 438
           A  P+ P + LKDR +    L  +  C + +M   Y   I    V   + +    RI   
Sbjct: 342 ALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILL--VAGNESSLSATRITSL 399

Query: 439 F-FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIP 496
           + F  A  S   G ++ +  +   F +  C L  +        +      K     M + 
Sbjct: 400 YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVW 459

Query: 497 GLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           G+ +        ++M     H + A  T+        G  +G ++ GAI+ +SL   LLK
Sbjct: 460 GITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLK 519

Query: 556 S 556
           +
Sbjct: 520 A 520

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 100/481 (20%), Positives = 183/481 (38%), Gaps = 39/481 (8%)

Query: 105 SRRISSKGTELSTARL------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           ++RI  + +EL   +        + + S ++  F   LD+ I +  + +  + +     +
Sbjct: 50  TKRIVIRKSELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLL 109

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S V    +  SA  Q  +  +SD+FGR  + I   + + VG++I   +   +   AG   
Sbjct: 110 STVNVISMTISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIF 169

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS--------- 269
                            D   L+ R  Y  +  +              W S         
Sbjct: 170 YNIGLVGAMFQVTLMLSDSSSLKWRLFYNFVPAW--------PAVVTVWISGDVINVANP 221

Query: 270 DRSVGWRMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYFST--IKVRLSA 324
            ++  W ++ +    P      I  +L +R  L  + + + LQ    YF T  +   L  
Sbjct: 222 KQNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLKNDPEWKDLQEKKTYFQTHGLVQTLKQ 281

Query: 325 VDW-IGATTLVLFLFS---FMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
           + W + A  ++LF  S    ++  ++ GG    + S K I   V+  +  L+F Y E K+
Sbjct: 282 LFWKLDAVGVLLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVLVFIYWESKL 341

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWF-CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPN 438
           A  P+ P + LKDR +    L  +  C + +M   Y   I    V   + +    RI   
Sbjct: 342 ALVPLAPFKMLKDRGIWAPLLLMFLVCFVYVMPADYLYTILL--VAGNESSLSATRITSL 399

Query: 439 F-FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIP 496
           + F TA  S  AG  + +  +   F    C L  +        +      K     M + 
Sbjct: 400 YSFVTAVLSAAAGILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVW 459

Query: 497 GLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           G+ +        ++M     H + A  T++  A    G  +G ++ GAI+ ++L   LLK
Sbjct: 460 GVASCFFDYPINISMQTVTSHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLK 519

Query: 556 S 556
           +
Sbjct: 520 T 520

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 103/484 (21%), Positives = 181/484 (37%), Gaps = 77/484 (15%)

Query: 120 LKIIML-SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           LKI +L +++L  +   L   I  ++  + A+ F +  ++  + T   + ++     Y +
Sbjct: 61  LKITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYAR 120

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           +SD FGR    +F  + + VG +I   +P+F  L AG  I                 D+ 
Sbjct: 121 MSDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLS 180

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV----------GWRMSFLIQLPIAFF 288
            LR+R     I                 W S   V           WR  + I   I  F
Sbjct: 181 GLRDRTFAMNI--------FLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPF 232

Query: 289 STILIILFLRLPKESKGRG-------LQVDG-NYFSTIKVRLSAVDWIGATTLVLFLFSF 340
           ST++++L     +    R        L+  G N   T+   +  ++ IG      FL   
Sbjct: 233 STLMLVLPYAYAQYIGWRNGTLPPYKLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLL 292

Query: 341 MITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSS 399
           ++  ++ GG    +     I + VV      IF   EL+ AK+P +P  +L D ++  + 
Sbjct: 293 LLPLTIAGGATSKWREGYIIAMIVVGGCLGFIFLIWELRFAKNPFIPRVYLGDPTIYVAL 352

Query: 400 LSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKY 459
           L  +   ++L     YL                          AFG   +    ++  + 
Sbjct: 353 LMEFVWRLSLQIELEYL--------------------VTVLMVAFGE--SKLSAQRIAQL 390

Query: 460 YWFVISFCVLASIGCLQIVWIQPDISVFK-------------QYTLMF--IPGL-GASVL 503
           Y F+ S C    +G +   +  P + V               +Y +++  I GL GA ++
Sbjct: 391 YNFLQS-CTNIVVGIILHFYPHPKLFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIV 449

Query: 504 ITVALLAMI---------AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLL 554
           + +A   MI         A+  HN  A  T +  +    G  +G SI GAI+ + L   L
Sbjct: 450 VGIA-GGMIRFPMWTLVHASTTHNEMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKEL 508

Query: 555 KSKV 558
             ++
Sbjct: 509 IQRL 512

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 101/491 (20%), Positives = 191/491 (38%), Gaps = 61/491 (12%)

Query: 105 SRRISSKGTELSTARLK------IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           +R I  K TE+  A+        I++ + ++  +   LD  I      +  + ++E   +
Sbjct: 41  TRHIVIKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLL 100

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S +     +  A  Q +Y +++D FGR  + I   + + VG++I   +   +   AG   
Sbjct: 101 STIGVVNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVF 160

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXX-------XXXXXXXXXXWFSDR 271
                            D   LR R LY  +  + F                   W  D 
Sbjct: 161 YNIGYVGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDI 220

Query: 272 SVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAV------ 325
            +    +F+  L        +I + ++  K  +   L+ + +YF T  +  + V      
Sbjct: 221 GM---WAFIFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKL 277

Query: 326 DWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPI 384
           D +G   L+  L   ++  +L GG    + +   IG  V+  +   I  + E++ A+DP+
Sbjct: 278 DVVGVLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPL 337

Query: 385 LPLRFLKDRSV---LGSSLSNWFC-------MMALMTVSYYLPIYFAGVLNMKPTDIGKR 434
           +P   +KDR V   L  S  N+F        + A++ V+    +  A  ++   + +   
Sbjct: 338 VPYGLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVV 397

Query: 435 IIPNF--FST------AFGSLGAGYYMKKTG-KYYWFVISFCVLASIGCLQIVWIQPDIS 485
             P F  F T       +  LG   +M   G  Y++   S+     IG L  VW      
Sbjct: 398 WSPIFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGAL-CVW------ 450

Query: 486 VFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI 545
                      G G+++      +++ +A  H + A  T+++Y     G  +G ++ GAI
Sbjct: 451 -----------GAGSTMWTYPVNISVQSATSHENLATVTALNYTLYRIGGAVGTAVSGAI 499

Query: 546 FRESL-DNLLK 555
           + ++L   LLK
Sbjct: 500 WTQTLYKQLLK 510

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 118/314 (37%), Gaps = 25/314 (7%)

Query: 106 RRISSKGTELSTARLK------IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRIS 159
           R +  K TE+ +A         I++ S ++  +   L+  I      +  S + E   +S
Sbjct: 45  RSLVIKKTEIMSAVYDKWYHHVILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLS 104

Query: 160 WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIA 219
            V     + SA  Q IY ++SD FGR  + I   + + VG++I   +   +   AG    
Sbjct: 105 TVNVINAVVSAASQIIYSRLSDFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFY 164

Query: 220 XXXXXXXXXXXXXXXXDIVPLRNRALYQ------GICNFYFXXXXXXXXXXXXWFSDRSV 273
                           D   L+ R  YQ       I N +              +S    
Sbjct: 165 NAGYVGIILILLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVG 224

Query: 274 GWRMSFLIQLPIAFFSTI--LIILFLRLPKESKGRGLQVD------GNYFSTIKVRLSAV 325
            W   F    P+A    I  +I +  +  K  +   L+ +        ++ T+      +
Sbjct: 225 MWAFIF----PLACIPMIGCMIHMQWKASKTPEWHALRSEKSFYQANGFYKTMTELFWKL 280

Query: 326 DWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPI 384
           D IG       L   ++  +L GG    + + + IG  V+  +   I G  E K A+DP+
Sbjct: 281 DIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWARDPL 340

Query: 385 LPLRFLKDRSVLGS 398
           +P + ++DR V  +
Sbjct: 341 IPYKLVRDRGVWAA 354

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 112/240 (46%), Gaps = 18/240 (7%)

Query: 321 RLSAVDWIGATT--LVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELK 378
           RLS +DWIG+ T  L L LF+F+   +       + S   I L V++VI  + FG  EL+
Sbjct: 248 RLS-MDWIGSFTGVLGLILFNFVWNQA---PADGWNSAYLIVLLVISVIALIAFGIYELR 303

Query: 379 IAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRI 435
            A++P+LP   +++R ++    +  F   +    ++Y   YF+ VLN++   P   G   
Sbjct: 304 YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSY 360

Query: 436 IPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLA-SIGCLQIVWIQPDISVFKQYTL-- 492
                S    ++  G+ MKK       +++F ++  ++GC+ I  + P    + +  L  
Sbjct: 361 FIFVISGTITAISCGFLMKKIRPA--VLLTFSMVGFNLGCI-IFSVTPVHQTYFRNILGT 417

Query: 493 MFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDN 552
           M I  LG  +    + + +   +P+ HQ +  S+     +   +L + I G + +    N
Sbjct: 418 MIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKN 477

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 160 WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           W+  ++ L S +F  + G++ DI+G K +LI   +   + SLI GLS
Sbjct: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 141

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 132/315 (41%), Gaps = 67/315 (21%)

Query: 357 KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVS--Y 414
           + IG CV   +    F   E+K AK P++P   +KDR +       W  ++  + ++  +
Sbjct: 294 EVIGWCVALPL----FLLWEMKFAKHPLVPWNVIKDRGI-------WSALIIAIHINFIW 342

Query: 415 YLP---IYFAGVLNMKPTDIGKRIIPNFFS--TAFGSLGAGY---YMKKTGKYYWFVISF 466
           Y+    +Y   ++ +  +      I + +S  +    LG G+   Y++KT K+  F I  
Sbjct: 343 YMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGLGFVIAYIRKTKKFIMFGIG- 401

Query: 467 CVLASIGCLQIVWIQPDIS----VFKQYTLMFIPGLGASVLITVALLAMIA-AVPHNHQA 521
           C + S G L  +  + D S    +     L+   G GA         ++ A A  H   A
Sbjct: 402 CWVVSFGLL--IHYRGDSSSHSGIIGAQCLL---GFGAGFFTYTTQTSIQASAKTHQDMA 456

Query: 522 VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV-------LKFKSPEHSEDELMRI 574
           V T++  +F + G  LG S+ GAI+   L   L+ ++       L + SP         I
Sbjct: 457 VITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALAYGSP------FTFI 510

Query: 575 IDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAII------KE 628
           I     + E          ++ ++  Y +  K      LLC +   F   +I      ++
Sbjct: 511 ITYVWGTPE----------REAVVKSYQYVQK------LLCVVGICFCATLIASALFLRD 554

Query: 629 HRLHNTLDRDNENEE 643
           HRL +++  ++E+E+
Sbjct: 555 HRLGDSVALEDEDEK 569

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 99/481 (20%), Positives = 177/481 (36%), Gaps = 39/481 (8%)

Query: 105 SRRISSKGTELSTARL------KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRI 158
           ++RI  + TEL   +        + + S ++  F   LD+ I +  + +  + ++    +
Sbjct: 48  TKRIVIRKTELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLL 107

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           S V+   L  SA  Q  +  +SD+FGR  + I   + + VG++I   +   +   AG   
Sbjct: 108 STVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIF 167

Query: 219 AXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVG---- 274
                            D   L+ R  Y  +  +              W S   V     
Sbjct: 168 YYIGLVGSMFEITLILSDCSSLKWRLFYSFVPAW--------PALVTVWISGNVVSVANP 219

Query: 275 -----WRMS-FLIQLPIAFFSTILIILFLR--LPKESKGRGLQVDGNYFST------IKV 320
                W ++ +    P +    I  +L +R  L    +   LQ +  YF T      +K 
Sbjct: 220 LENWSWGIAMWAFIFPASCLPIIGCLLHMRWKLRNNPEWIELQEEKTYFQTHGLVQTLKQ 279

Query: 321 RLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKI 379
               +D +G     +     ++  +L GG    + S K I   V+  +   +F Y E K+
Sbjct: 280 LFWKLDVVGVLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLLVPVFIYWESKL 339

Query: 380 AKDPILPLRFLKDRSVLGSSLSNWF-CMMALMTVSY-YLPIYFAGVLNMKPTDIGKRIIP 437
           A  P+ P + LKDR +    +  +  C + +M   Y Y  +  AG  N  P    +    
Sbjct: 340 ALVPLAPFKMLKDRGIWAPLVITFLICYIYMMAAGYLYTILVVAG--NESPLSATRITSL 397

Query: 438 NFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIP 496
             F  A  S   G ++ +  +   F +  C L  +        +      K     M I 
Sbjct: 398 YSFVAAVFSPVVGIFVARFTRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIW 457

Query: 497 GLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLK 555
           G+ +        ++M     H + A  T+        G  +G ++ GAI+ +SL   LLK
Sbjct: 458 GITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLK 517

Query: 556 S 556
           +
Sbjct: 518 T 518

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 538 GVSIGGA--IFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQ 595
           GV+I GA  +F  +L   L + + +  S EH +++L +I+ +A +S+ W+Q+S+P F ++
Sbjct: 582 GVAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEFAQE 641

Query: 596 TLIDCYHFACKNVFIFCLLCTIAATFSM 623
           T+   +      +F+  +     + F M
Sbjct: 642 TIYASFRHNFTTLFLAAITLLTTSLFCM 669

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 95/465 (20%), Positives = 175/465 (37%), Gaps = 26/465 (5%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           I++++  +  F   LD  + ST   +  + F++   ++ +     + S   Q  + ++SD
Sbjct: 82  ILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINVINSVVSIASQLFFARLSD 141

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
            FGR  +  FC + + VG+++   S +      G                    D   L 
Sbjct: 142 HFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGYTGVRLLMTIMMSDFSTLG 201

Query: 242 NRALYQG-------ICNFYFXXXXXXXXXXXXWFSDRSVGWRMSF-LIQLPIAFFSTILI 293
            R            I  +              W  D ++ W   F L  +P+  F   L+
Sbjct: 202 WRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAM-WAFIFPLTTIPLVGF---LV 257

Query: 294 ILFLRLPKESKGRGLQVDGNYFST---IKVRLSAVDWIGATTLVLFLFSFMITASL-GGK 349
            +F +  +  + + L+       T   IK     +D  G   + + L   +I  ++ GG+
Sbjct: 258 YMFYKASRTDEWKELRSVTKKMPTPVYIKEVFWNLDIPGVLLIAISLGCILIPLTVSGGE 317

Query: 350 EIPYTSHKFIG-LCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMA 408
              +   + IG LC+ +V+   IF   E KIAK P+L L +LKDR V     +++F   A
Sbjct: 318 TEEWKDSRNIGVLCLGSVLFP-IFLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNA 376

Query: 409 -LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFC 467
            L+   Y   +   G    +        +P+F          G  + +        I+ C
Sbjct: 377 YLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPF-TGLLITRWKHLKVLTITGC 435

Query: 468 VLASIG-CLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSI 526
           +   I   L   +     +V          G G+ +     ++++ A   H   A+ T++
Sbjct: 436 IFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMVSLQAVSSHTKIAIVTAL 495

Query: 527 SYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDEL 571
            Y F   G  +G SI GAI+ + +   +  ++     PE  E  L
Sbjct: 496 FYTFEQVGRAVGSSISGAIWTQVMFKEISKRL-----PEEPEVAL 535

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 86/472 (18%), Positives = 177/472 (37%), Gaps = 41/472 (8%)

Query: 106 RRISSKGTELSTARLKIIML-SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATA 164
           R+      + S+ + ++++L S +L  +   LD  + S       + ++    +S +   
Sbjct: 65  RKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVV 124

Query: 165 YLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXX 224
             +  A  Q +Y ++SD++GR  + +   + + VG++I   +   +   AG         
Sbjct: 125 NAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYV 184

Query: 225 XXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFS---------DRSVGW 275
                      D   L+ R  Y  +  + F            W S         +++  W
Sbjct: 185 GVILIVLLILSDFSSLKWRLFYSFVPTWPFIINT--------WISGNIVDVAKPEQNWSW 236

Query: 276 RMS---FLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAV------D 326
            ++   F+  L        ++ +  R  +    + L     Y+ T  +  S V      D
Sbjct: 237 DIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLD 296

Query: 327 WIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPIL 385
            IG   +++ L   ++  +L GG    + +   I   ++  +    F   E K A++PI 
Sbjct: 297 VIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFILGFVLIPFFIAWESKWAREPIA 356

Query: 386 PLRFLKDRSVLGSSLSNWFCMMAL------MTVSYYLPIYFAGVLNMKPTDIGKRIIPNF 439
           P + L+DR +  +      C+  L      M   Y   I    V     +      +  F
Sbjct: 357 PFKLLRDRGIWAA-----LCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTF 411

Query: 440 FSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGL 498
            ST F    A +  + T +   F+I+ C L  +    +   +   +  K     + + GL
Sbjct: 412 TSTVFSPFFALFITRFT-RLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGL 470

Query: 499 GASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
           G ++      +++ +   H + A  T++SY     G  +G ++ GAI+ + L
Sbjct: 471 GTTMFTYPVTVSLQSVTSHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLL 522

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 90/462 (19%), Positives = 170/462 (36%), Gaps = 54/462 (11%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           + +L+ ++  F   LD+ I    + +   ++ E   +S V    L+ SA  Q  +  +SD
Sbjct: 71  VFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSD 130

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           +FGR  + +   I + VG++I   +      VAG                    D   L+
Sbjct: 131 VFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGLVGAIFQVTIILSDCSSLK 190

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFS-------DRSVGWRMSFLIQ---LPIAFFSTI 291
            R  Y  +  +              W S       + S  W     +     P +    I
Sbjct: 191 WRLFYNFVPAW--------PAFVTVWISGNVIHIANPSENWSWGIGMWGFIFPASCLPLI 242

Query: 292 LIILFLR--LPKESKGRGLQVDGNYFSTIKVRLSAV------DWIGATTLVLFLFSFMIT 343
             +L +R  +  + + + LQ + +YF T  V  S V      D  G   L       ++ 
Sbjct: 243 ACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLLTACTGCILVP 302

Query: 344 ASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLS 401
            ++ GG    + S K I   V+      +F Y E +IA  P+ P + LKDR +    ++ 
Sbjct: 303 LTIAGGVSAQWRSAKVIAPFVLGFALVPVFLYWESRIALVPLAPFKMLKDRGIWAPLAIM 362

Query: 402 NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFS--TAFGSLGAGYYMKKTGKY 459
              C +  M   Y   +Y   ++    +D+    I + +S   A  S   G  + ++ + 
Sbjct: 363 FLICFIYQMAAGY---LYTVLLVAANESDLSATRITSLYSFVAAIFSPILGVLVARSTRL 419

Query: 460 YWFVISFCVLASIGCLQIVWIQPDISVFKQYT-----------LMFIPGLGASVLITVAL 508
             + +  C L  +           + +F  Y             M + G+ + +      
Sbjct: 420 KPYTLVGCSLYFV----------TMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPIS 469

Query: 509 LAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
           ++M     H   A  T+++      G  +G ++ GAI+ ++L
Sbjct: 470 ISMQTVTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQAL 511

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 11/140 (7%)

Query: 492 LMFIPG-LGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL 550
           L  IP  LG  +     L   I A P + QA  TS  Y FRS G   GV++   + +   
Sbjct: 39  LFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYF 98

Query: 551 DNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFI 610
              L+S +         ED++  ++ K + ++ +++      +K  +ID    A K    
Sbjct: 99  GKSLRSNL----KDLLDEDKINELVTKITSNSSYIEKLHGE-LKDVVIDVLILARKKTH- 152

Query: 611 FCLLCTIAATFSMA--IIKE 628
             LL TI +  ++A  +IKE
Sbjct: 153 --LLSTILSLLALAFCVIKE 170

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 122/581 (20%), Positives = 222/581 (38%), Gaps = 63/581 (10%)

Query: 99  HYGAIESRRISSKGTELSTARLKII--MLSMYLGIFLAA----LDNTIVSTLLAHIASEF 152
           H  A E +       E+ TA+   I   L ++  IFL +    LD  I  TL  +  + +
Sbjct: 24  HEDAGEEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSY 83

Query: 153 NELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWL 212
           ++   ++ V     + +A  Q  + + +DIFGR  VLI   I + +G++I   + +    
Sbjct: 84  SQHSLLATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRF 143

Query: 213 VAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDR- 271
            AG                    D   L  R L   +    F            W S   
Sbjct: 144 AAGACFYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIINT--------WISGNV 195

Query: 272 ----SVGWRMS---FLIQLPIAFFSTILIILFLR-LPKESKGRGLQVDGNYFST------ 317
                  W+     +   LP++       +L +R L  ++    L+ +   F T      
Sbjct: 196 LTAIGTNWKWGIGMWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEY 255

Query: 318 -IKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALI----F 372
            ++V    +D+ G   + +     +I  +LGG        K  G+ V  VIG ++    +
Sbjct: 256 IVEVFFWRLDFPGLILICVTFGCILIPFTLGGG--LNEKWKTAGIIVPEVIGWVVALPLY 313

Query: 373 GYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNM---KPT 429
              E K A+ P+ P + +KDR +  + +        +  + Y    Y   VL +   +  
Sbjct: 314 MIWESKYARHPLTPWKLIKDRGIFSALI----IAFHINFIWYMQGDYMFTVLRVAVNESN 369

Query: 430 DIGKRI--IPNFFSTAFGSLGAGYYMK--KTGKYYWFVISFCVLASIGCLQIVWIQPDIS 485
              +RI  + +F S   G+L     +K  +T K+  F I  C   S G L  V  + D S
Sbjct: 370 SSAQRITSLYSFVSVITGTLLGLVIVKVRRTKKFILFGI-VCWFISFGLL--VHFRGDSS 426

Query: 486 VFKQYTLMF-IPGLGASVLITVALLAMIAAVPHNHQ-AVTTSISYAFRSTGCTLGVSIGG 543
                     + G GA         ++ A+  H+   AV TS+  A  + G  +G ++ G
Sbjct: 427 SHSGIIGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSG 486

Query: 544 AIFRESLDNLLKSKVLKFKSPEHSEDE-LMRIIDKASQSTEWVQNSSPSFIKQTLIDCYH 602
           AI+   L   +  ++      + +  E L  I+    ++ E          +Q ++  Y 
Sbjct: 487 AIWTNVLPKEIGKRLNDATLTQQAYLEPLTFILTYTWETIE----------RQAVVLAYR 536

Query: 603 FACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENEE 643
           +  K + I  L       FS  ++++HRL + +  ++ +E+
Sbjct: 537 YTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDVIALEDLDEK 577

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYG 177
            LK I + +  G+ LA++   IV  L+  I + FN    +  W  T+Y+++ A F   +G
Sbjct: 22  HLKFICILIACGLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFG 79

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSF 209
           ++ DI G  +++   ++ F + SL+C + P+F
Sbjct: 80  RVGDIVGNGIMMCVFSVIFGIFSLLCAVVPNF 111

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 126/575 (21%), Positives = 215/575 (37%), Gaps = 101/575 (17%)

Query: 120 LKIIML--SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYG 177
           +K IM+  S++L  F   LDN++ +T      S +++   +S V     + SA  Q  + 
Sbjct: 72  IKRIMVFSSLFLIAFAYGLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFA 131

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           + +D+FGR  +L    I + +G++I   +       AG  I                 D 
Sbjct: 132 RSADMFGRPTILTISIIFYVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADF 191

Query: 238 VPLRNR---ALYQGICNFYFXXXXXXXXXXXXWFS-------DRSVGWRMS-FLIQLPIA 286
             L  R   A  Q + N               W S       D++  W +  +    P++
Sbjct: 192 SNLNWRVTAAAAQVLPN-----------VITTWISGNITGAIDKNWEWGIGMWAFIFPLS 240

Query: 287 FFSTILIILFLRLPKESKGRGLQV---DGNYFS----TIKVRLSAVDWIGATTLVLFLFS 339
               I+ I+ +R         L+V     NY +     I +    +D IG   LV F   
Sbjct: 241 CVPLIICIIHMRYLARKNNENLKVVFQKPNYMTWKEYCIDIFFWKLDIIGLILLVAFFSL 300

Query: 340 FMITASLGGKEIPYTSHKFIGLCVVTVIGAL-IFGYTELKIAKDPILPLRFLKDRSVLGS 398
            ++  +L G  + + S K I   V+  + A+ ++   ELK A+ P+ P   +KDR +   
Sbjct: 301 ILVPFTLAG-SLTWKSPKIIVPEVLGWVLAIPLYLIWELKYARYPLTPWNSIKDRGIWAP 359

Query: 399 SLSNWFCMMA-LMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGA---GYYMK 454
            + N F   A  M  +Y L +    V   K +    RII   F +  G L A   G+ + 
Sbjct: 360 LIINLFQEFAYYMQNTYMLTVLLVAVGQSKKS--ATRIIK--FYSFVGVLTAFFLGFVVA 415

Query: 455 KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLM--FIPGLGASVLITVALLAM- 511
           K  +   F     +   IG    +W       F  + L+  +  GLGA   I  A+  + 
Sbjct: 416 KVRRTKEF-----IALGIG----IW-------FVAFGLLEHYEGGLGARAGIIAAICILG 459

Query: 512 ---------------IAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKS 556
                           AA  H    + TS+  A  S G   G ++ G I+     N+L  
Sbjct: 460 FGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAGGIW----SNVLPG 515

Query: 557 KVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIK---------QTLIDCYHFACKN 607
           ++ K            RI + ++ +T +   S   FIK         Q ++  Y    + 
Sbjct: 516 EINK------------RITNNSTLAT-YAYGSPTKFIKQYGWETTERQAVVSAYKVVERL 562

Query: 608 VFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNENE 642
           + I  L   +    +   ++  RL + +  D  +E
Sbjct: 563 MAIVGLCLLVPMLVASIFLRNRRLEDVVSFDKLDE 597

>KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {ON}
           Anc_5.469 YDR387C
          Length = 546

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 70/182 (38%), Gaps = 6/182 (3%)

Query: 117 TARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIY 176
           T R+ +I+ +  +G  L   D  ++S +L ++         ++ +   ++ +S +    +
Sbjct: 38  TLRMALILFAATIGGLLFGYDTGVISGVLINLDPADLNRTEMTSLNEEFITASTSVGSFF 97

Query: 177 GKI-----SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXX 231
           G +     +D  GRK  L  C + F V ++   LS S  WLV+GR I             
Sbjct: 98  GSLLAFPLADKAGRKFTLAACCVVFVVAAIWMALSSSLIWLVSGRMIVGVAVGAAAQCVP 157

Query: 232 XXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQ-LPIAFFST 290
               +I P + R     + +               +  D    WR  F I  +P  FF  
Sbjct: 158 IYLSEISPAKVRGFILTLNSVAITGGQLLSYIIAYFLGDARHAWRYLFAISAIPAIFFLL 217

Query: 291 IL 292
           +L
Sbjct: 218 VL 219

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 10/105 (9%)

Query: 122 IIMLSMY--LGIFLAALDNTIVSTLLAHIASEFN--EL----PRISWVATAYLLSSATFQ 173
           IIML+    L  FL   D   +S+ L  I ++ +  EL      I+  AT+  L +  F 
Sbjct: 73  IIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATS--LGALIFA 130

Query: 174 PIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
            + G   DIFGRK  L+F NI F +G+++   +  F  + AGRFI
Sbjct: 131 LVAGFSVDIFGRKPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFI 175

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 127/557 (22%), Positives = 209/557 (37%), Gaps = 61/557 (10%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           ++  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + + SD
Sbjct: 59  LLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASD 118

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           IFGR  +LI   + + VG++I   + +     AG                    D   L 
Sbjct: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSD---RSVG--WRMS---FLIQLPIAFFSTILI 293
            R L   +    F            W S     +VG  W+     +    P+A       
Sbjct: 179 WRLLALFVPALPF--------IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCC 230

Query: 294 ILFLRL-----PKESKGRGLQVDGN-----YFSTIKVRLSAVDWIGATTLVLFLFSFMIT 343
           +L +R       K+   + + V  +     YF  I V    +D IG   +V F    ++ 
Sbjct: 231 MLHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-FIDVLFWKLDMIGLLLMVCFFGCVLVP 289

Query: 344 ASL-GGKEIPY-TSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLG---- 397
            +L GG    + T+H  +   +  V+   ++   E+K +K P+ P   LKDR V      
Sbjct: 290 FTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALII 349

Query: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYM---K 454
           +++ N FC    M   Y   +    V     +      + +F S   G+ G G  +   +
Sbjct: 350 ATMIN-FCWY--MQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGT-GLGLVLIKVR 405

Query: 455 KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAA 514
           +T  +  F IS   +A  G L I +     S       + + G GA    T    A I A
Sbjct: 406 RTKPFIIFGISMWFVA-FGLL-IRYRGDSASHAGIIGSLCLLGFGAG-FFTYTTQASIQA 462

Query: 515 VPHNHQ--AVTTSISYAFRSTGCTLGVSIGGAIFRESL-DNLLKSKVLKFKSPEHSEDEL 571
              +HQ  AV T++  A  + G  LG ++ GA++   L D + K+   +  + E      
Sbjct: 463 TTRSHQKLAVITALYLAAYNIGSGLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPF 522

Query: 572 MRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRL 631
             II     +  W      + +K    D     C     FC+    AA F    ++ HRL
Sbjct: 523 TFII-----TNTWGTPDRMAVVKAYR-DVQKILCIIGLCFCIPLLCAALF----LRNHRL 572

Query: 632 H-----NTLDRDNENEE 643
                 N LD  N  E+
Sbjct: 573 EDVVALNELDEKNVKED 589

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 103/245 (42%), Gaps = 25/245 (10%)

Query: 325 VDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYT---ELKIAK 381
           VD+IG     + L   ++  +L G      SH      V  V+G+++F +    E  +A 
Sbjct: 163 VDFIGTLIFSVALGCVLVPLTLAGGYSSKWSHS--DSIVPLVVGSVLFVFYIVWESFMAS 220

Query: 382 DPILPLRFLKDRSVLGSSLSNWFCMMA--LMTVSYYL------PIYFAGVLNMKPTDIGK 433
            P LP + LKDR +       W  ++A  LM + YY       P+    +     +    
Sbjct: 221 YPALPFKLLKDRGI-------WIPILAGFLMDLVYYFSCDYMYPVLMVAINESTKSATNI 273

Query: 434 RIIPNFFSTAFGSLGAGYYMKKTGKYYWFVIS-FCV-LASIGCLQIVWIQPDISVFKQYT 491
             +P F +T      A   ++ TG+  W+ I  F + + S+G L   +   + S      
Sbjct: 274 ASLPLFVTTVASPFFA-VLLRWTGRLKWYAIGGFAIWMVSLG-LFFRYRCGEGSHDGMVA 331

Query: 492 LMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESL- 550
            + + GLG +      L  M A  PH   A  T + + + S G  +G SI GA++ + + 
Sbjct: 332 AVVLLGLGRTFTQFPLLTTMQARAPHTKMATVTGLFHVWGSVGSVVGASISGAVWTQKMP 391

Query: 551 DNLLK 555
             LLK
Sbjct: 392 KKLLK 396

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 109/489 (22%), Positives = 178/489 (36%), Gaps = 59/489 (12%)

Query: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPI 175
           +T R  +   S++L  +   LD  + ST      S +     +S V     + SA  Q  
Sbjct: 54  TTQRRLLFFFSIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIA 113

Query: 176 YGKISDIFGRKVVLIFCNITFFV-GSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           Y + +DIFGR   L+F  I F+V G+++   + +      G                   
Sbjct: 114 YARAADIFGR-TSLVFTAIFFYVIGTVVESQATNITRYAVGACFYSLGHAAIVLALEVLA 172

Query: 235 XDIVPLRNRALYQG------ICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPI 285
            D   L  R L         + N +               SD    W+     + I  P+
Sbjct: 173 ADFSNLNYRILASAAPMLPNVINTWISGNIT---------SDIGDHWQWGIGMWAIIFPV 223

Query: 286 AFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDW-----------IGATTLV 334
                +  +  +R   + K    ++    FSTI   ++ +++           +G    V
Sbjct: 224 CCIPLLFCLFHMRYLAQYKHNRRELRS--FSTIPPNMTRMEYFIDVFFWRLDILGLLLGV 281

Query: 335 LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALI----FGYTELKIAKDPILPLRFL 390
           +F    +I  +L  K       K   + V  VIG L+    + + E K AK P+ P   +
Sbjct: 282 IFFACVLIPFTLAAKATD--KWKSASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLV 339

Query: 391 KDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAG 450
           KDR V G  L   F   A    S Y   Y   +++   T +      N F T  G + A 
Sbjct: 340 KDRGVYGGLLIALFLDFAYYVQSTYK--YTVLLVSFDTTVLAATRTNNMF-TFVGVITAN 396

Query: 451 YY-------MKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVL 503
                    +++T  + +F IS  ++ S G L    I     V        + G G   L
Sbjct: 397 LLGIFVAKKLRRTKGFIFFGISMYIV-STGLLYRYRIGAHAKVGTIVACCLL-GFGNGFL 454

Query: 504 ITVALLAM-IAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV---- 558
              A  ++  AA  H + A+ TS+  A  S G   G S+ GAI+   ++  L   +    
Sbjct: 455 KFPARASIQAAAYTHKNLAIITSLFLALGSIGEGFGSSVAGAIWSNRMEVELSKYISNQT 514

Query: 559 ---LKFKSP 564
              L ++SP
Sbjct: 515 AVSLAYESP 523

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 97/463 (20%), Positives = 176/463 (38%), Gaps = 42/463 (9%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  +L+   I + +G++I   + +      G                    D   L  
Sbjct: 133 FGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298
           R L   I    F              S     W+     +   LP+A     L +L +R 
Sbjct: 193 RLLALFIPALPFIINTWISGNVT---SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY 249

Query: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASLGG--K 349
           L ++     L+ +    + +K +   +D   W    IG   +  F    ++  +L G  K
Sbjct: 250 LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLK 309

Query: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS------NW 403
           E   T+H  +   +  V+   ++   E+K ++ P+ P   +KDR +  + L       NW
Sbjct: 310 EEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNW 369

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYM---KKTGKYY 460
           +     M   Y   +    V     +      + +F S   G++  G+ +   ++T  + 
Sbjct: 370 Y-----MQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTI-LGFILIKVRRTKPFI 423

Query: 461 WFVISFCVLASIGCLQIVWIQPD----ISVFKQYTLMFIPGLGASVLITVALLAMIA-AV 515
            F IS C + S G L  V  + D      +     L+   G GA     V   ++ A A 
Sbjct: 424 LFGIS-CWIVSFGLL--VHYRGDSGAHAGIIGSLCLL---GFGAGSFTYVTQASIQASAK 477

Query: 516 PHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
            H   A+ TS+  A  + G   G S+ GA++   L   +  ++
Sbjct: 478 THARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRI 520

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQP 174
           S  R  + +++  L   L     T   T++  ++  FN E  + +W+  ++ L + +F  
Sbjct: 65  SFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFIL 124

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           I G++ DI+G K +L+   +T  V SLICGLS
Sbjct: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 84/213 (39%), Gaps = 26/213 (12%)

Query: 106 RRISSK--GTELSTARLKIIMLSMYLGI--FLAALDNTIVST----------LLAHIASE 151
           RRI S   G E    R  + ML  +      L+ +D +I+S           L AH AS 
Sbjct: 81  RRICSLDLGFEFEDKRYMVYMLGAFASAAGILSGIDQSIISGASIGMNKALHLSAHEASM 140

Query: 152 FNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEW 211
            + L  +  +A + ++S          +++ FGRK  ++   I + VG+++C  S S   
Sbjct: 141 VSSLMPLGAMAGSVIMS---------PLNEWFGRKSSIMISCIWYTVGAILCAASTSHHL 191

Query: 212 LVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDR 271
           + AGRFI                 + VP   R     +  F               F D 
Sbjct: 192 MYAGRFILGVGVGIEGGCVGIYVSESVPSTVRGNLVSMYQFNIALGELFGYIVGVIFFDV 251

Query: 272 SVGWRMSFLIQLPIAFFSTILIILFLRLPKESK 304
             GWR  F++   +  FSTIL++    LP+  +
Sbjct: 252 HGGWR--FMVGSSLV-FSTILLVGMFFLPESPR 281

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa]
          {ON} Anc_8.272 YDR119W
          Length = 589

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS 60
          MG+KDKQRKKLR F K K KQ   + +     P   +GT+     L    QL  E +E++
Sbjct: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATP---NGTQKPTSELNTVQQL--EPEEST 55

Query: 61 VLLPIRDELLQDPS-TELP 78
           LL   +     P+  E+P
Sbjct: 56 PLLKTSNHETSTPAEKEMP 74

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 100/241 (41%), Gaps = 17/241 (7%)

Query: 393 RSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYY 452
           R  L   L N F M+AL+    YLP+Y   V N     +  R++P + S     L    Y
Sbjct: 363 RKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARY 422

Query: 453 MKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMI 512
            KK    Y   +   ++  IG  Q+  +      +  +    IP +G +        ++I
Sbjct: 423 AKK----YNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVT--------SVI 470

Query: 513 AAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELM 572
            A   N +     I       G +  + +   +F  +L + L+  +LK +S    + EL+
Sbjct: 471 MANTKNMRDFAVGI-----LVGGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKELL 525

Query: 573 RIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLH 632
           +I++K  ++ +W    +P+  +  + + +  A   +F+  L+ +I    S  ++  H   
Sbjct: 526 KILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIFLSLLVISIFIIISSCLVSTHSDD 585

Query: 633 N 633
           N
Sbjct: 586 N 586

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE 210
           +W+  ++ L+S +F  + G+I DI+G K   I  NI F + S++CG+S   E
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE 164

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 120/275 (43%), Gaps = 36/275 (13%)

Query: 282 QLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV--LFLFS 339
           Q P  FF+T  I +F+ L       G+    N+  T    L  +DWIG+   V  L L +
Sbjct: 234 QWPWIFFATA-IAVFINLI-----MGIYSIPNHVPTNIYNLK-MDWIGSLLGVIGLILMN 286

Query: 340 FMIT-ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS 398
           F+   A + G    Y     I + +V V   + F   ELK A+ P+LP    K+R ++  
Sbjct: 287 FVWNQAPISGWSKAY----IIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTI 342

Query: 399 SLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRIIPNFFSTAFGSLGA---GYY 452
            +S +    A    ++Y   Y+A  LN++   P   G     +F    FGSL A    + 
Sbjct: 343 IISLFLGWGAFGIWTFY---YYAFNLNLRHFSPLWAGST---HFVFIIFGSLTAITVAFT 396

Query: 453 MKKTGKYYWFVISFCVLASIG--CLQIVW--IQPDISVFKQ-YTLMFIPGLGASVLITVA 507
           + K G      + FC L+SIG  C  I++    PD + ++    +  I  LG  +    +
Sbjct: 397 INKVGP----SVLFC-LSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGS 451

Query: 508 LLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIG 542
            + +   +P  +Q ++ S+     +   +L + +G
Sbjct: 452 SIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 1/102 (0%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNE-LPRISWVATAYLLSSATFQPIYG 177
           R  I +L +    F+     +I++     +A EFN  L  IS++    +L+ A    I  
Sbjct: 76  RRDIALLVVGWHCFVGGGQTSILAAGSRSLAEEFNRSLSDISYLVGGMMLALAFGSIIAS 135

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIA 219
             + +FG++++ +   I FF GS+ C +S S+E L+A R ++
Sbjct: 136 PSAVLFGKRILYLIGIIVFFFGSIGCSVSHSYESLLASRIVS 177

>TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON}
           Anc_5.469 YDR387C
          Length = 500

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 31/143 (21%)

Query: 103 IESRRISSKGTELSTA------------------RLKIIMLSMYLGIFLAALDNTIVSTL 144
           I  R+++S+   L+T                   RL +I++S  +G  L   D  I+S +
Sbjct: 16  IPDRQVTSQAQSLTTQNSILSIDNIDNLPVQFNKRLFLIIISSTIGGLLFGYDTGIISGV 75

Query: 145 LAHIA---------SEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNIT 195
           LA++          S F++    S  +    L+S     I   ++D +GRK  L  C+  
Sbjct: 76  LANLQPNDISLIDLSNFHKELITSMTSLGSFLASL----IAFALADHYGRKFTLALCSCI 131

Query: 196 FFVGSLICGLSPSFEWLVAGRFI 218
           F + SL   LS +  +LV GRFI
Sbjct: 132 FIIASLWMALSTTLTYLVIGRFI 154

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 108/247 (43%), Gaps = 18/247 (7%)

Query: 319 KVRLSAVDWIGATT--LVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTE 376
            VR S++DWIG+    L + LF+F+      G  + + +   I L +V+V   + F   E
Sbjct: 243 NVRGSSMDWIGSGIGLLGMILFNFVWNQ---GPIVGWDTAYIIVLLIVSVAAIVAFFLYE 299

Query: 377 LKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGK 433
            K A DP++P   + +  +L + L+ +F   +    ++Y   YF  VLN++   P   G 
Sbjct: 300 TKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFY---YFCFVLNLREYTPLWAGG 356

Query: 434 RIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLA-SIGCLQIVWIQPDISVFKQ-YT 491
                       ++  GY +K+       ++   +LA   GC+ +     D + F+    
Sbjct: 357 SYFMFLIWGIIAAISVGYTIKRIPPS--LILFLSMLAFDCGCIMLSVTPVDQTYFRMILG 414

Query: 492 LMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI---FRE 548
           +M I   G  +    + + +   +P  +Q +  S+     +   ++ + I G +     +
Sbjct: 415 MMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINK 474

Query: 549 SLDNLLK 555
           + D+LLK
Sbjct: 475 NGDDLLK 481

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  ++ L S +F  + GKI DI+G K  L+   +   + SLICGL+
Sbjct: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 110/257 (42%), Gaps = 36/257 (14%)

Query: 318 IKVRLSAVDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYT 375
           + V   A+DWIG+   V  L LF+F+   S     + + +   I L +V++    +F   
Sbjct: 253 VNVNKFAMDWIGSALGVSGLVLFNFVWNQS---TVVGWATGYIIALLIVSIFLIALFFIF 309

Query: 376 ELKIAKDPILPLRFLKDRS---VLGSSLSNWFCMMALMTVSYYLPIYFAGVL---NMKPT 429
           E+K AK P+LP    + RS   +L S ++ W       +   ++  YF  VL   N  P 
Sbjct: 310 EIKYAKVPLLPKEVTESRSIIMILASLMAGW------GSFGIWIFYYFQFVLTLRNYSPV 363

Query: 430 DIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQ 489
             G             +L  G+ +K+ G     V+ F  + +  C  I+     +SV   
Sbjct: 364 WAGGTFFMVSIVGCIAALTVGFSIKRVGPA---VLLFFSMIAFTCGSII-----LSVTPV 415

Query: 490 YTLMFIPGLGASVLITVAL-LAMIAA-------VPHNHQAVTTSISYAFRSTGCTLGVSI 541
           +   F   LGA V+++  + L+  AA       +   +Q +  S+     +   +L + I
Sbjct: 416 HETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGI 475

Query: 542 GGAIFRE---SLDNLLK 555
           GG I R+   S D LL+
Sbjct: 476 GGTIERQINKSGDRLLE 492

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNEL-PRISWVATAYLLSSATFQPIYGKIS 180
           + +LS  +G  L    +T+  + +  +  E +    + SW+  ++ L S +F  I G++ 
Sbjct: 65  LFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLG 124

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLS 206
           DI+G K +L+   I   + SLICGLS
Sbjct: 125 DIYGLKKMLLLGYIWLTIWSLICGLS 150

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 3/126 (2%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           +S+ FGRK  L+   I + VG+++C  + +   + AGRF+                 + V
Sbjct: 160 LSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAGRFLIGVGVGIEGGGIGVYIAESV 219

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R     +  F               F D   GWR  +++   +  FSTIL+I  L 
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWR--YMVGSSLV-FSTILLIGLLF 276

Query: 299 LPKESK 304
           LP+  +
Sbjct: 277 LPESPR 282

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 57/150 (38%), Gaps = 4/150 (2%)

Query: 132 FLAALDNTIVSTLLAHIASEFNELPRI----SWVATAYLLSSATFQPIYGKISDIFGRKV 187
           FL   D   +S+ L  I ++ +  P       ++  A  L +       G  +D+FGRK 
Sbjct: 145 FLFGYDTGYISSALISIGNDLDNRPLTYGDKEFITAATSLGALISSIFAGTAADVFGRKP 204

Query: 188 VLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQ 247
            L+F N+ F VG+++   +  F  + AGR +                 +I P + R    
Sbjct: 205 CLMFSNLMFVVGAIVQITAHKFWQMTAGRLVMGFGVGIGSLIAPLYIGEIAPRKIRGRLT 264

Query: 248 GICNFYFXXXXXXXXXXXXWFSDRSVGWRM 277
            I + +               +  + GWR+
Sbjct: 265 VINSLWLTGGQLIAYGCGAGLTKVNNGWRI 294

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 118/310 (38%), Gaps = 36/310 (11%)

Query: 113 TELSTARLKIIML--SMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSA 170
           +E     +K I+L  S++L  +  +LD+T+  T      + F+E   +S+V     + SA
Sbjct: 46  SEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSFVNCFSAIVSA 105

Query: 171 TFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXX 230
             +  + + +DIFGR  +   C + + VG++I   S       AG  I            
Sbjct: 106 IGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYSFGESGIDMVM 165

Query: 231 XXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAF 287
                D   L  R L  G+                   SD S  W+     F I +P+A 
Sbjct: 166 QLLVSDFSHLNWR-LVAGVIP--MLPNVINAWASGTIVSDFSDNWQWGIGMFAIIVPVAC 222

Query: 288 FSTILIILFLR-LPKESKGRGLQV---DGNYFSTIKVRLSAVDW----IGATTLVLFLFS 339
               + +  +R + K++K   L+      N  S  +     + W    +G  TL      
Sbjct: 223 IPLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLITL------ 276

Query: 340 FMITASLGGKEIPYT-----------SHKFIGLCVVTVIGALIFGYTELKIAKDPILPLR 388
               ASLG   +P+T           +   +   +   +G  ++   E   AK P+ PLR
Sbjct: 277 ---GASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLR 333

Query: 389 FLKDRSVLGS 398
            ++DR V  +
Sbjct: 334 LIRDRGVYAA 343

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 7/111 (6%)

Query: 103 IESRRISSKGTELSTARLK------IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-EL 155
           I S  + S+   LS    K      + ++S  +  F++    T   +++  +A E N E 
Sbjct: 75  INSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEK 134

Query: 156 PRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
            R +W+  ++ LS  +F  + G++ DI+G K VL+       + SLICG S
Sbjct: 135 SRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 107/256 (41%), Gaps = 55/256 (21%)

Query: 324 AVDWIGATTLVLFLFSFMITASLGGKE--IPYTSHKFIGLCVVTVIGALIFGYTELKIAK 381
           ++DWIGA   +L +F  +I   +  +   + + S   I L V++    +IF   E+K AK
Sbjct: 294 SMDWIGA---ILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 350

Query: 382 DPILPLRFLKDRSVLGSSLSNWFC-MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFF 440
            P++P     +R +L   L   FC   A  T ++Y   YF+ VLN++             
Sbjct: 351 TPLIPKAISSNRGML-MILFALFCGWGAFGTWTFY---YFSFVLNVR------------- 393

Query: 441 STAFGSLGAGYYMKKTGKYYWFVISFCVLASI-----------------------GCLQI 477
              + +  AG      G Y+ F++S C +A++                       GC+ +
Sbjct: 394 --GYTAAWAG------GSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVML 445

Query: 478 VWIQPDISVFKQ-YTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCT 536
                  S F+    +MF+  +G  +    A + +  A+P  +Q +  S+ Y   +   +
Sbjct: 446 TVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTS 505

Query: 537 LGVSIGGAIFRESLDN 552
           + + + G++     DN
Sbjct: 506 ICLGMAGSVEAYHNDN 521

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 99/464 (21%), Positives = 175/464 (37%), Gaps = 44/464 (9%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  +L+   I + VG++I   + +      G                    D   L  
Sbjct: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298
           R L   +    F              S     W+     +   LP+A     L +L +R 
Sbjct: 193 RLLALFVPALPFIVNTWISGDVT---SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY 249

Query: 299 LPKESKGRGLQ--------VDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGG-- 348
           L ++     L+        +D   FS I +    +D IG   +  F    ++  +L G  
Sbjct: 250 LARKHAKDKLRPEFETLNNLDWKSFS-IDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGL 308

Query: 349 KEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS------N 402
           KE    +H  +   +  V+   ++   E+K ++ P+ P   +KDR VL +         N
Sbjct: 309 KEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINFN 368

Query: 403 WFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYM---KKTGKY 459
           W+     M   Y   +    V     +      + +F S   G++  G+ +   ++T  +
Sbjct: 369 WY-----MQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTI-LGFILIKVRRTKPF 422

Query: 460 YWFVISFCVLASIGCLQIVWIQPD----ISVFKQYTLMFIPGLGASVLITVALLAMIA-A 514
             F IS C + S G L  V  + D      +     L+   G GA     V   ++ A A
Sbjct: 423 ILFGIS-CWIVSFGLL--VHYRGDSGAHAGIIGSLCLL---GFGAGSFTYVTQASIQASA 476

Query: 515 VPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
             H   A+ TS+  A  + G   G S+ GA++   L   +  ++
Sbjct: 477 GTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/302 (18%), Positives = 117/302 (38%), Gaps = 19/302 (6%)

Query: 347 GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS-SLSNWFC 405
           GG    +     IG  ++  +    F   E   A+DP+LP + +KDR V  +  +S    
Sbjct: 313 GGTSSKWNHGNVIGPFILGFVLIPFFALWEKFFARDPLLPAKLVKDRGVWSAMGISFLID 372

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVIS 465
            +  M   Y   +    V     +      + +F ST      A Y  + +    W ++ 
Sbjct: 373 FIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFALYLTRCSRLKPWIMLG 432

Query: 466 FCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524
            C L  +    + + +            + + G+G ++      +++ AAV H + A  T
Sbjct: 433 -CSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPVTVSVQAAVSHENMATVT 491

Query: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQ---S 581
           + +Y     G  +G ++ GAI+ ++L   L          +H +D  +     +S    +
Sbjct: 492 AANYTLYRIGSAIGAAVSGAIWTQTLYKQLY---------KHLQDIALATAAYSSPYTFT 542

Query: 582 TEWVQNSSPSFIKQTLIDCYHFACK-NVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDNE 640
           T +   + P   ++ ++  Y +  +    +  + C     FS+  +++ RL + +   N 
Sbjct: 543 TNYAWGTPPE--REAVVQAYRYVQRLETVVALVFCVPLIAFSLC-LRDARLTDEVAHGNI 599

Query: 641 NE 642
            E
Sbjct: 600 AE 601

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 112/294 (38%), Gaps = 21/294 (7%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178
           R+ I+  S++L  +   L   +  T      S +++   ++ V     + SA  Q  Y +
Sbjct: 54  RVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQCINQVISAAGQIWYAR 113

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
            SDIFGR  +LI   + +F+G+LI   +       AG  I                 D  
Sbjct: 114 ASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVLVTQVLVSDYS 173

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQ---LPIAFFSTILIIL 295
            L+ R +   +    F               D    W+  F +     P+A    +  + 
Sbjct: 174 TLKWRLVSSTVL---FLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPLASIPLLCCLA 230

Query: 296 FLRL----PKE------SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITAS 345
            ++      KE      SK R +    + +     +L   D +G   LV F    ++  +
Sbjct: 231 HMKYLAIKNKEDVKLTISKPRSISWARHLYDIFFWKL---DMLGLILLVAFFALILVPLT 287

Query: 346 LG-GKEIPYTSHKFIGLCVVTVIGAL-IFGYTELKIAKDPILPLRFLKDRSVLG 397
           L  G    + S KFI   V+    AL +F   ELK A +PI PL  +KDR + G
Sbjct: 288 LAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGIYG 341

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 114 ELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATF 172
           + ST  L + +  ++LG  +  ++ + + +L+  ++++++      SW  T+Y ++ A F
Sbjct: 21  QTSTVNLNVNVALIFLGCSIDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGF 80

Query: 173 QPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGR 216
               G++ DI G   +       F + SL+CGL P+FE     R
Sbjct: 81  IAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMPNFEAFAVMR 124

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 96/460 (20%), Positives = 176/460 (38%), Gaps = 36/460 (7%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  ++I   I + VG++I   + +      G                    D   L  
Sbjct: 133 FGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298
           R L   I    F              S     W+     +   LP+A     + +L +R 
Sbjct: 193 RLLALFIPALPFIINTWISGDVT---SAIGTNWKWGIGMWAFILPLACIPLGICMLHMRY 249

Query: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASLGG--K 349
           L ++     L+ +    + +K +   +D   W    IG   + +F    ++  +L G  K
Sbjct: 250 LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLK 309

Query: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS------NW 403
           E   ++H  +   +  V+   ++   E+K ++ P+ P   +KDR +  + L       NW
Sbjct: 310 EEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNW 369

Query: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYM---KKTGKYY 460
           +     M   Y   +    V     +      + +F S   G++  G+ +   ++T  + 
Sbjct: 370 Y-----MQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTI-LGFILIKVRRTKPFI 423

Query: 461 WFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIA-AVPHN 518
            F IS C + S G L  V  + D          + + G GA     V   ++ A A  H 
Sbjct: 424 IFGIS-CWIVSFGLL--VHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 519 HQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
             AV TS+  A  + G   G S+ GA++   L   +  ++
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 73/150 (48%), Gaps = 19/150 (12%)

Query: 282 QLPIAFFS-TILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV--LFLF 338
           Q P AF++ TI  I+ L L   S    +  +  +FS        +DWIG+   V  L L 
Sbjct: 230 QWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS--------MDWIGSALGVIGLVLM 281

Query: 339 SFMIT-ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLG 397
           +F+   A + G +  Y     I L V++V+  ++F   E + AK P+LP   LKDR ++ 
Sbjct: 282 NFVWNQAPISGWDQAY----IIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQ 337

Query: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMK 427
             L+ +F   +    ++Y   YF   LN++
Sbjct: 338 IMLALFFGWGSFGIFTFY---YFQFQLNIR 364

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 148 IASEF--NELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGL 205
           IA+ F  NE  R +W+  ++ L S +F  I G++ DI+G K +L    +   + SLICGL
Sbjct: 97  IANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155

Query: 206 S 206
           +
Sbjct: 156 T 156

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 86/424 (20%), Positives = 155/424 (36%), Gaps = 56/424 (13%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWL---V 213
           ++SW A AY L+  TF  I G++ D++G K   I     + + SL+ G S     +    
Sbjct: 84  QLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQIFFDC 143

Query: 214 AGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGI------CNFYFXXXXXXXXXXXXW 267
              F                    VP R +A+   +        F              W
Sbjct: 144 CRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFGATAPAGFVLGAVFSSIFGQLTW 203

Query: 268 FSDRSVGWRMSFLIQLPIAFF---STILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSA 324
                  W  ++     + FF   + IL+I  + LP+      L    + +  + +  S 
Sbjct: 204 -------WPWAYWAMGIVCFFLAVAGILVIPRMPLPE------LDTSVSTYQRLDIPGSV 250

Query: 325 VDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPI 384
              IG   LVL  F++     + G + PYT      L +V+ +   +F + E + A  P+
Sbjct: 251 TGVIG---LVLLNFAWN-QGPVVGWQTPYTYS----LLIVSAVFLCVFAFIESR-APHPL 301

Query: 385 LPLRFLKDRS--VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFST 442
           LPL  L   +  VLG   + W      +   YY  ++   +    P     +  P   S 
Sbjct: 302 LPLSALSSDAAFVLGCVGAGWSSFGIWI---YYFWLFLEELRGHSPLLTSAQFAPVAISG 358

Query: 443 AFGSLGAGYYMKKTGK-------YYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFI 495
              +L  G+ + +             F +   ++A+    Q+ W Q  +S+      + +
Sbjct: 359 LCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSI------IVM 412

Query: 496 PGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI---FRESLDN 552
           P  G  +    A + +  ++PH HQ +  S+     +   ++G+ + G +         N
Sbjct: 413 P-WGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGAN 471

Query: 553 LLKS 556
           LLK 
Sbjct: 472 LLKG 475

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 122 IIMLSMYLGI--FLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSS----ATFQPI 175
           II+L+    I  F+   D   +ST L  I ++ +    +++    ++ ++    A    I
Sbjct: 119 IIILTFVTSISGFMFGYDTGYISTALISIGTDLDH-KELTYGNKEFITAATSLGALISSI 177

Query: 176 YGKIS-DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           +  IS DIFGRK  ++  N+ F +G++I   + +F  +V GRFI
Sbjct: 178 FAGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFI 221

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEW--LVAGRFIA 219
           KI DI+GRK+ +IF N+ + +G LIC  S   +W     GR I+
Sbjct: 210 KIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIIS 253

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 132 FLAALDNTIVSTLLAHIASEFNE-LPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           F+     +I++     +A EF+  L  IS++    +L+ A    I    + IFG+++V +
Sbjct: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYL 152

Query: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIA 219
              I FF GS+ C +S ++E L+A R ++
Sbjct: 153 VGIIIFFFGSIGCAVSQNYESLLASRIVS 181

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 106/241 (43%), Gaps = 16/241 (6%)

Query: 324 AVDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAK 381
           A+DWIG+   V  L L +F+      G  + + +   I L VV+V    +F   E+K A+
Sbjct: 264 AMDWIGSVLAVIGLILLNFVWNQ---GPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAE 320

Query: 382 DPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFS 441
            P+LP+   K+R ++    + +    +    S+Y   YF+ +LN++           F  
Sbjct: 321 SPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFY---YFSFLLNLRHYSALWAGTTYFMF 377

Query: 442 TAFGSLGA---GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFK-QYTLMFIPG 497
             +G++ A   G ++KK    +   +S     +IG + +     D + F+     M I  
Sbjct: 378 AIWGTVAAVIVGAFIKKISAAFILFMSMVAF-NIGIIMLSVTPVDQTYFRMNLGTMIILS 436

Query: 498 LGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRE---SLDNLL 554
            G  +    A + +   +   +Q +  S++    +   +L + +G  + R+   S ++LL
Sbjct: 437 FGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLL 496

Query: 555 K 555
           K
Sbjct: 497 K 497

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 46/126 (36%), Gaps = 3/126 (2%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           +S+ FGRKV L+   I + +G ++C  +     + AGRF+                 + V
Sbjct: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R     +  F               F D   GWR      L    FSTIL +    
Sbjct: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGWRYMLGSSL---VFSTILFVGLFF 268

Query: 299 LPKESK 304
           LP+  +
Sbjct: 269 LPESPR 274

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           SW+  ++ L S +F  I G++ DIFG K +L+   +   + SLICGL+
Sbjct: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 10/112 (8%)

Query: 319 KVRLSAVDWIGATTLVLFLFSFMITASLGGKEIP---YTSHKFIGLCVVTVIGALIFGYT 375
            V   ++DWIG+   V+ L    +  +L   + P   +     I L +++V+  ++FG  
Sbjct: 270 NVHRFSMDWIGSGLGVIGL----VLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVY 325

Query: 376 ELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK 427
           E+  AK P+LP   +KDR ++   LS +F   +    ++Y   YF   LN++
Sbjct: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFY---YFQFQLNIR 374

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 101/242 (41%), Gaps = 51/242 (21%)

Query: 325 VDWIGATTLV--LFLFSFMIT-ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAK 381
           +DWIG+   V  L LF+F+   A + G    + S   I L +V V+  + F   E++ AK
Sbjct: 246 MDWIGSAIGVFGLILFNFVWNQAPIAG----WGSAYIIVLLIVAVVALIAFITYEIRFAK 301

Query: 382 DPILPLRFLKDRS---VLGSSLSNW--------FCMMALMTVSYYLPIYFAGVLNMKPTD 430
            P+LP   L +R    +L S    W        + M  ++ + +Y P++  G        
Sbjct: 302 QPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY------ 355

Query: 431 IGKRIIPNFFSTAFG---SLGAGYYMKKTGKYYWFVISFCVLASI--GCLQIVWIQPDIS 485
                   F    +G   SL  GY + KTG     VI F  + +   GC+ +  + P   
Sbjct: 356 --------FMFAIWGIVASLLVGYTIHKTGPA---VILFLSMVAFDCGCIMLA-VTPVHQ 403

Query: 486 VFKQYTL--MFIPGLGASVLITVALLAMIAAVPHNHQA-----VTTSISYAFRSTGCTLG 538
            + + TL  M I   G  +    A + +   +P  +Q      V+T ISY   S    LG
Sbjct: 404 TYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISY---SMSLCLG 460

Query: 539 VS 540
           +S
Sbjct: 461 IS 462

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKIS 180
           I +LS  L   L     T  + L   ++ + N ++ +  W+  ++ L S +F  + GK+ 
Sbjct: 52  IFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVG 111

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLS 206
           DI+G K  L+   +   + SLICGLS
Sbjct: 112 DIYGLKKTLLGGYVVVVIWSLICGLS 137

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 99/466 (21%), Positives = 180/466 (38%), Gaps = 48/466 (10%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGR  ++I   I + +G++I   + +      G                    D   L  
Sbjct: 133 FGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFS-------DRSVGWRMS-FLIQLPIAFFSTILII 294
           R L   I    F            W S       D +  W +  +   LP+A     + +
Sbjct: 193 RLLALFIPALPFIINT--------WISGNVTSAIDANWKWGIGMWAFILPLACIPLGICM 244

Query: 295 LFLRL--PKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITAS 345
           L +R    K +K R L+ +    + +K +   +D   W    IG   + +F    ++  +
Sbjct: 245 LHMRYLARKHAKDR-LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFT 303

Query: 346 LGG--KEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLS-- 401
           L G  KE   T+H  +   +  V+   ++   E+K ++ P+ P   ++DR +  + L   
Sbjct: 304 LAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALLIAF 363

Query: 402 ----NWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYM---K 454
               NW+     M   Y   +    V     +      + +F S   G++  G+ +   +
Sbjct: 364 FINFNWY-----MQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTI-LGFILIKVR 417

Query: 455 KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIA 513
           +T  +  F IS C + S G L  V  + D          + + G GA     V   ++ A
Sbjct: 418 RTKPFIIFGIS-CWIVSFGLL--VHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA 474

Query: 514 -AVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV 558
            A  H   AV TS+  A  + G   G S+ GA++   L   +  ++
Sbjct: 475 SAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 70/182 (38%), Gaps = 1/182 (0%)

Query: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQP 174
           ST +L + +  ++LG     L+   + +L+  +A +++      SW  T+Y ++ A F  
Sbjct: 23  STYQLNVNVALIFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIA 82

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
             G++ DI G  ++       F + SL+C + P+F      R I                
Sbjct: 83  FMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPAFAVFRAIQGISAAGLVPCAYALI 142

Query: 235 XDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILII 294
             + P      Y  I +  F             F+   +G++  F +   + F  +I+  
Sbjct: 143 PMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAF 202

Query: 295 LF 296
            F
Sbjct: 203 FF 204

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D+FGRK  L+F N+ F VG+++   S +F  + AGR I
Sbjct: 198 GTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLI 239

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 104 ESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVAT 163
           ES  ISS+   L T R+ +I+ + +L  F  +LD T+ ST   +  + + E   +S +  
Sbjct: 43  ESELISSQFNSL-TYRI-LILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQV 100

Query: 164 AYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAG 215
              + S   Q ++ ++SD FGR  +    +I + +G+++   + S     AG
Sbjct: 101 INAVVSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAG 152

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 58/294 (19%), Positives = 112/294 (38%), Gaps = 27/294 (9%)

Query: 121 KIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS 180
            + + ++++  F   LD+ I    + +  + +     +S V    ++ SA  Q  + ++S
Sbjct: 70  SLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLS 129

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPL 240
           D+FGR  + I   + + VG++I   +   +   AG                    D   L
Sbjct: 130 DVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGLVGAMFQVTLILSDCSTL 189

Query: 241 RNRALYQGICNFYFXXXXXXXXXXXXWFSDRSV---------GWRMS-FLIQLPIAFFST 290
           + R  Y  +  +              W S   V          W ++ +    P++    
Sbjct: 190 KWRLFYNFVPAW--------PAIITVWISGNVVHVANPLENWSWGIAMWAFIFPVSCIPF 241

Query: 291 ILIILFLR--LPKESKGRGLQVDGNYFSTIKVRLSAV------DWIGATTLVLFLFSFMI 342
           I  IL +R  +    + R LQ + +++ T  +  + V      D +G   L +F     +
Sbjct: 242 IACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILLSVFTGCICV 301

Query: 343 TASL-GGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395
             ++ GG    + S K I   V+       F Y E ++A+ P+ P   LKDR +
Sbjct: 302 PLTVAGGVSTEWRSGKVIAPFVLGFSLIPAFVYWESRLARFPLAPFLMLKDRGI 355

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 71/180 (39%), Gaps = 13/180 (7%)

Query: 132 FLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATF------QPIYGKISDIFGR 185
           FL   D   +S+ L  I ++ +   R+       ++++AT         + G  +D++GR
Sbjct: 132 FLFGYDTGYISSALISIGTDLD--GRVLTYGNKEIVTAATSLGALISSTMAGTAADMYGR 189

Query: 186 KVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRAL 245
           K  ++F NI F VG+++   +  F  + AGR I                 +I P   R  
Sbjct: 190 KPCIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGR 249

Query: 246 YQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTIL-IILFLRLPKESK 304
              I + +              F+  + GWR    I + ++   T+L    FL LP   +
Sbjct: 250 LTVINSLWLTGGQLIAYGLGAAFNHVNNGWR----ILVGLSLVPTVLQFCFFLFLPDTPR 305

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           ++  S++L  +   LD ++  T  A   S +++   +S V     + +A  Q  Y + SD
Sbjct: 76  MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITTVIAAAGQICYARASD 135

Query: 182 IFGRKVVLIFCNITFFVGSLI 202
           IFGR  +LI   + + VG++I
Sbjct: 136 IFGRMTILIIGLVFYAVGTII 156

>TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {ON}
           Anc_5.469 YDR387C
          Length = 549

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 9/100 (9%)

Query: 128 YLGIFLAAL----DNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI---- 179
           YLG  L  L    D  ++S +L  I  E      I+      + S       +G I    
Sbjct: 55  YLGACLCGLLFGYDTGVISGVLLKIRPEDISREVITNFDKELITSVTCLGSFFGSILGFP 114

Query: 180 -SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
            SD +GR+  L FC+  F VG +   LS S   L+ GR +
Sbjct: 115 LSDTYGRRKTLAFCSAIFIVGGIWMALSKSLSLLIMGRLV 154

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  A+ L S +F  I G+I DI+G K  L+   +   V SLICGL+
Sbjct: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 108/298 (36%), Gaps = 38/298 (12%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           ++  S++L  +   LD  I  T  A   S ++E   +S V     + +A  Q  + + SD
Sbjct: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASD 127

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           IFGR  +L    I + +G++I   + +     AG                    D   L 
Sbjct: 128 IFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLN 187

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVG-----WRMS---FLIQLPIAFFSTILI 293
            R L   I    F            W S          W+     +    P+A       
Sbjct: 188 WRLLALFIPALPF--------IINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACC 239

Query: 294 ILFLRL--PKESKGRGLQ--------VDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMIT 343
           +L +R    K +K R +             YF  I V    +D IG   +V F    +I 
Sbjct: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--IDVFFWRLDMIGLLLIVCFFGCVLIP 297

Query: 344 ASLGG--KEIPYTSH----KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395
            +L G  KE   T+H    + IG CV   +  L     E+K ++ P+ P   LKDR V
Sbjct: 298 FTLAGGMKEQWRTAHIIVPEVIGWCVALPLYIL----WEIKFSRHPLTPWELLKDRGV 351

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 69/182 (37%), Gaps = 22/182 (12%)

Query: 133 LAALDNTIVST----------LLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           L+ +D +I+S           L  H AS  + L  +  VA + LL+           S+ 
Sbjct: 113 LSGIDQSIISGASIGMNKMLHLSTHEASLVSSLMPLGAVAGSILLT---------PFSEY 163

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGRK  L    + + VG+++C  + +   + AGRF+                 + VP   
Sbjct: 164 FGRKKSLAISCVFYTVGAIVCAAASNHHEMYAGRFLIGIGVGLEGGGIGVYIAESVPSSV 223

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R     +  F               F D   GWR  +++   +  FST L I  L LP+ 
Sbjct: 224 RGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWR--YMVGSSLV-FSTTLFIGLLFLPES 280

Query: 303 SK 304
            +
Sbjct: 281 PR 282

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 125 LSMYLGIFLAA----LDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKIS 180
           ++++  IFL A    LD  I  T  A+  S +++   IS V     + +A  Q  + + S
Sbjct: 52  VALFFSIFLVAYAYGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARAS 111

Query: 181 DIFGRKVVLIFCNITFFVGSLI 202
           D+FGR  +LI   + + VG++I
Sbjct: 112 DVFGRLSILIIAVLFYVVGTVI 133

>TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {ON}
           Anc_5.469 YDR387C
          Length = 574

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 5/94 (5%)

Query: 129 LGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI-----SDIF 183
           LG  L   D  I+S +L+ +  +     R++      + S  +    +G I     +D F
Sbjct: 61  LGGLLFGYDTGIISGILSSLKPQDLSRTRLTDFDKELVTSMTSIGSFFGSILGFPLADKF 120

Query: 184 GRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRF 217
           GRK  L  CN  F   SL   LS +   L+ GRF
Sbjct: 121 GRKKTLTICNFLFIFASLWMALSINLPLLILGRF 154

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 51/102 (50%), Gaps = 1/102 (0%)

Query: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYG 177
           R  I ++ +    F+     +++++  + +++E    L +IS++    +LS         
Sbjct: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIA 219
             + +FG+++V +   + F +GS+ C  S SF WL+  R ++
Sbjct: 173 PTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVS 214

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G ++DIFGRK V +  N+ F +G+++   + SF  + AGR +
Sbjct: 139 GTLADIFGRKPVTMSSNVMFLIGAILQACTRSFWQMAAGRLL 180

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 127 MYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGR 185
           ++LG     L+   + +L+  +A ++N      SW  T+Y ++ A F    G++ DI G 
Sbjct: 34  IFLGCTFDLLNVASMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGN 93

Query: 186 KVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
            V+       F + SL+C + P+F      R I
Sbjct: 94  SVLFTISCSCFAILSLLCAVMPNFPAFAVFRAI 126

>Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON}
           complement(10929..12629) [1701 nt, 567 aa]
          Length = 566

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           ++D +GRK  L  C++ F + ++   LS S   L+ GRF+                 +I 
Sbjct: 115 LADKYGRKTTLAVCSVGFIISAVWLALSMSLTILILGRFLVGIAVGIAAQCVPIYLSEIS 174

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P R R     + +                 SD S  WR  F        FS I  ILF+ 
Sbjct: 175 PTRIRGTILALNSIAITSGQLIAYIVSYLISDFSQSWRFLF-------GFSAIPAILFIL 227

Query: 299 L 299
           L
Sbjct: 228 L 228

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 3/105 (2%)

Query: 115 LSTARLK--IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSAT 171
           LST + K  + + S +  + + A D  IVS  +  IA + N    +++W  T  L++   
Sbjct: 36  LSTVKPKTWLFVASAFFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTI 95

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGR 216
              +YG I D FG+K   +       +  L+ G + +F + +A R
Sbjct: 96  GAVLYGYIGDQFGQKASFMINIGMISILQLLTGFATTFPYFIACR 140

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 127 MYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGR 185
           ++LG     L+   + +L+  +A  +N      SW  T+Y ++ A F    G++ DI G 
Sbjct: 34  IFLGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGN 93

Query: 186 KVVLIFCNITFFVGSLICGLSPSF 209
            V+       F V SL+C + P+F
Sbjct: 94  SVLFTISCSCFAVLSLLCAVMPNF 117

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 9/104 (8%)

Query: 122 IIMLSMY--LGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIY--- 176
           I+ML+    L  FL   D   +S+ L  + ++     ++++    Y+ S+ +   +    
Sbjct: 66  IVMLTFVASLSGFLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAAL 123

Query: 177 --GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
             G  +D+FGR+  ++F NI F VG+++   + +F  +V GR +
Sbjct: 124 GAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLV 167

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 35.8 bits (81), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 167 LSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           L S +F  + GK+ DI+G K  L+F   T  V S ICGL+
Sbjct: 41  LVSGSFILVSGKVGDIYGLKNTLLFGYATVIVWSFICGLT 80

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D++GRK  ++F N+ F VG+++   + SF  +  GR I
Sbjct: 149 GTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGRLI 190

>KLTH0A06336g Chr1 (528991..530520) [1530 bp, 509 aa] {ON} highly
           similar to uniprot|P16120 Saccharomyces cerevisiae
           YCR053W THR4 threonine synthase
          Length = 509

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 387 LRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGS 446
           + F K  +V   +  NW  ++A MT  YY   YF    N  P+ + K ++P   S  FG 
Sbjct: 224 VEFNKKHNVGAVNSINWARILAQMT--YYFYAYFQAT-NGSPSKV-KFVVP---SGNFGD 276

Query: 447 LGAGYYMKKTG 457
           + AGYY KK G
Sbjct: 277 ILAGYYAKKMG 287

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 105/544 (19%), Positives = 211/544 (38%), Gaps = 45/544 (8%)

Query: 126 SMYLGIFLAA----LDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +++  IFL A    LD  +  T  ++  S + +   +S V     + +A  Q  Y + SD
Sbjct: 72  ALFFSIFLVAYAYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASD 131

Query: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLR 241
           IFGR  +L+   I + +G++I   + +     AG                    D   L 
Sbjct: 132 IFGRMTILVIGVIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLN 191

Query: 242 NRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR 298
            R L   +    F              S  +  W+     +   LP++       +L +R
Sbjct: 192 WRLLASFVPALPFIINTWISGNVT---SAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMR 248

Query: 299 -LPKESKGRGLQVDGNYFST-------IKVRLSAVDWIGATTLVLFLFSFMITASL-GGK 349
            L K++ G  L  + +   T       +++    +D+IG   L +     +I  +L GG 
Sbjct: 249 YLAKKNAGDRLLKEASLIGTLGWKKFIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGL 308

Query: 350 EIPY-TSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNW---FC 405
           +  + T+H  +   +   +   +F   E+K ++ P+ P   +KDR ++ +    +   FC
Sbjct: 309 QSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFC 368

Query: 406 MMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVIS 465
               M   Y   +    V     +      + +F S   G++  G ++ K  +   F++ 
Sbjct: 369 WY--MQGDYMYTVLIVSVHESVKSATRITSLYSFVSVITGTI-LGMFITKIRRTKPFIVF 425

Query: 466 FCVLASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIA-AVPHNHQAVT 523
             V   I    +V  + D +        + + G GA         ++ A A  H+  AV 
Sbjct: 426 GVVCWFIAFGLLVHYRGDNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVI 485

Query: 524 TSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTE 583
           T++  A  + G ++G ++ GAI+     N+L  ++ K        +E +  +  +S  + 
Sbjct: 486 TALYLATYNIGSSVGAAVSGAIW----TNILPKEISK-----RLNNETLAALAYSSPYSF 536

Query: 584 WVQNSSPSFIKQTLIDCYHFA----CKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639
            +  +  +  +  ++  Y +     C     FC    I+A F    ++ H+L +++  D 
Sbjct: 537 IIDYTWGTPERDAVVLAYRYTQRILCIVGLCFCTTLLISALF----LRNHKLVSSVSIDK 592

Query: 640 ENEE 643
           E  +
Sbjct: 593 EQTK 596

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKIS 180
           + +L+  L   L     T  ++ +  I S FN +    +W+  ++ L S +F  + G+I 
Sbjct: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLS 206
           DI+G K  +I   I   + SLICG +
Sbjct: 143 DIYGLKRTMIGGLIVMIIWSLICGFA 168

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 132 FLAALDNTIVSTLLAHIASEFNELPRISW----VATAYLLSSATFQPIY-GKISDIFGRK 186
           F+   D   +S+ L  I ++ +    +S+    + TA     A    I+ G  +D+FGRK
Sbjct: 110 FMFGYDTGYISSALISIGTDLDN-KVLSYGDKEIVTAATSLGALISSIFAGTAADVFGRK 168

Query: 187 VVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
             L+F N+ F +G+++   +  F  + AGR I
Sbjct: 169 PCLMFSNVMFIIGAILQISAHKFWQMAAGRLI 200

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 124/558 (22%), Positives = 207/558 (37%), Gaps = 66/558 (11%)

Query: 122 IIMLSMYLGIFLAA----LDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYG 177
           I  + +Y  IFL A    LD+ +  T      S+F +  ++  V     +     Q  + 
Sbjct: 76  IYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNCIKTVMGTAGQFGFA 135

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           + SDIFGR  VL F  I + +G++I   +       AG  +                 D 
Sbjct: 136 RCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLGLIGIQIMLGVIASDF 195

Query: 238 VPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMS---FLIQLPIAFFSTILII 294
             L  R     +    F               DR   W+     F   +P A       +
Sbjct: 196 SDLNWRLFASFVPALPFVINIWICGFITQLIGDR---WQWGIGMFAFIMPCACIPLAFCL 252

Query: 295 LFLRLPKESKGRG-LQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASL 346
           L +R       RG +Q +   +  +  R   VD   W    +G   L       +I   L
Sbjct: 253 LHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLCALFGCILIPLVL 312

Query: 347 -GGKEIPYTSHKFIGLCVVTVIGAL-IFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404
            GG    + + + I   VV  +  L IF   E K AK P+L   F++DR +L + +  ++
Sbjct: 313 AGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDRGILAALIIAFY 372

Query: 405 CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIP--NFFSTAFGSLGAGYYMKKTGKYYWF 462
                  +  YL       L+ +      RI    +F     G+L  G  + +  +   F
Sbjct: 373 INFVYHLLGDYLFTVLMITLD-QSVLASTRITSSYSFVCIICGTL-IGLVIIRARRTKPF 430

Query: 463 VISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPG---------LGASVLITVALLAMIA 513
           +I       IGC    ++   + V       F+PG         LGA         ++ A
Sbjct: 431 II-----FGIGCW---FLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASIQA 482

Query: 514 AVP-HNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSE---- 568
           A+  H   AV T++  +  S G  +G +I GAI+     NLL  K+  F++  HS+    
Sbjct: 483 AIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIW----TNLLPRKI--FRTMNHSDATAA 536

Query: 569 ---DELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAI 625
               +L  + +          N + S++++ L       C     FC+    AA F    
Sbjct: 537 YDSPQLFILNNPWGSPARNGLNEAYSYVQKML-------CVVALCFCVPLLAAALF---- 585

Query: 626 IKEHRLHNTLDRDNENEE 643
           ++ H+L +T+  +N +E+
Sbjct: 586 LRNHKLQSTVALENVDEK 603

>TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {ON}
           Anc_1.432
          Length = 559

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 59/144 (40%), Gaps = 7/144 (4%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           IS+ FGR+V L  C   + +G++I   S +   LV GR I+                +I 
Sbjct: 93  ISEAFGRRVSLHLCATFWIIGAVIQCASHNVAMLVCGRLISGIGVGFGSSAAPVYCSEIA 152

Query: 239 PLRNRALYQGICNF--YFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILF 296
           P + R L   +  F   F             F D S  +R+++ +Q+   F   IL++  
Sbjct: 153 PPKIRGLIGSLFQFSVTFGIMILFYIGYGCSFLDSSASFRITWGLQMVPGF---ILLVCT 209

Query: 297 LRLPKESKGRGLQVDGNYFSTIKV 320
             +P+    R L   GN+   I V
Sbjct: 210 FFIPESP--RWLGNKGNWDECINV 231

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 72/182 (39%), Gaps = 22/182 (12%)

Query: 133 LAALDNTIVS----------TLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           L+ +D +I+S           L +H AS  + L  +  +A + +++          +++ 
Sbjct: 116 LSGIDQSIISGASIGMNKSLKLTSHEASLVSSLMPLGAMAGSMIMT---------PLNEW 166

Query: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRN 242
           FGRK  +I   + + VG+++C  S     + AGRF+                 + VP   
Sbjct: 167 FGRKASIIISCVWYTVGAILCAASHDHHLMYAGRFMLGVGVGIEGGCVGIYISESVPSSV 226

Query: 243 RALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKE 302
           R     +  F               F D   GWR  F++   + F + +LI LF  LP+ 
Sbjct: 227 RGNLVSLYQFNIALGELFGYIIGVIFFDVKGGWR--FMVGSSLVFSTALLIGLFF-LPES 283

Query: 303 SK 304
            +
Sbjct: 284 PR 285

>AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 3/105 (2%)

Query: 115 LSTARLK--IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSAT 171
           LS  +LK  + + S +L + + A D  +VS  +  IA + +    +++W  T  L++   
Sbjct: 36  LSNVKLKTWLFIASAFLALTVEATDFFLVSLNVVKIAEDLHVREDKVTWGITVALMTRTI 95

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGR 216
              +YG + D FG++   +       V  L+ G + SF + +A R
Sbjct: 96  GAIVYGYVGDRFGQRTSFLINIGMISVLQLVTGFATSFPYFLACR 140

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 154 ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSF 209
           E    SW  TAY ++ A F    G++ DI G  V+ +     F + SLIC +  +F
Sbjct: 58  EFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNF 113

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  ++ L S +F  + GK+ DI+G K  L+       + SLICGLS
Sbjct: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 115 LSTARLK--IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSAT 171
           L   +LK  + + S +L + + A D  +VS  +  IA + N     ++W  T  L++   
Sbjct: 36  LKNVKLKTWLFIASAFLALTVEATDFYLVSLNVVSIAQDLNVREDTVTWGITVALMTRTI 95

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGR 216
              +YG I D FG++   +       V  L+ G + SF + +A R
Sbjct: 96  GAIVYGYIGDRFGQRTSFLINVGMISVLQLVTGFATSFPYFLACR 140

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           SW+  ++ L S +F  I G++ DI+G K +L+   +   + SLICG++
Sbjct: 111 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 158

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           SW+  ++ L S +F  I G++ DI+G K +L+   +   + SLICG++
Sbjct: 108 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 155

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 148 IASEFNE-LPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +A  FN    + +W+  ++ L S +F  + G+I DI+G K  LI   +   + SLICG +
Sbjct: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 324 AVDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAK 381
            +DW G+   V  + LF+F+      G    +     I L +V+V   + F   E+K AK
Sbjct: 270 GMDWTGSAIGVVGMILFNFVWNQ---GPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326

Query: 382 DPILPLRFLKDRSV 395
            P+LP   +K+R +
Sbjct: 327 SPLLPPEVIKNRHI 340

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 13/102 (12%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAH--IASEFNELP----------RISWVATAYLLSS 169
           II L +  G F+   D   +S  LA       F EL           R   V + + L  
Sbjct: 59  IICLMVAFGGFVFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGC 118

Query: 170 ATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEW 211
           A    ++ K+ D +GR++ L+   + + VG +IC +S + +W
Sbjct: 119 AIGGILFSKLGDTYGRRIALVIVTLVYMVGIVIC-ISANSKW 159

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 13/102 (12%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAH--IASEFNELP----------RISWVATAYLLSS 169
           II L +  G F+   D   +S  LA       F EL           R   V + + L  
Sbjct: 56  IICLMVAFGGFVFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGC 115

Query: 170 ATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEW 211
           A    ++ K+ D +GR++ L+   + + VG +IC +S + +W
Sbjct: 116 AIGGILFSKLGDTYGRRIALVIVTLVYMVGIVIC-ISANSKW 156

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 132 FLAALDNTIVSTLLAHIASEFNELPRI---SWVATAYLLSSATFQPIYGKIS-DIFGRKV 187
           F+   D   +S+ L  I ++ +          + TA     A    ++  IS DIFGRK 
Sbjct: 73  FMFGYDTGYISSALVSIGTDLDNKALTYGDKEIITAATSLGALISAVFAGISADIFGRKP 132

Query: 188 VLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
            L+F NI F +G+ +   + SF  +  GR I
Sbjct: 133 CLMFSNILFVIGAALQVSAHSFWQMAVGRLI 163

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 129 LGIFLAALDNTIVSTLLAHIASEFNELP-RISWVATAYLLSSATFQPIYGKISDIFGRKV 187
           +G FL+ +  T V + +  +A E +    R  W+  A+ L       I G++ DIFG K 
Sbjct: 131 IGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKK 190

Query: 188 VLIFCNITFFVGSLICGLS 206
           VL+   I   + +LICG S
Sbjct: 191 VLLLGYIITTIWTLICGFS 209

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           +  S++L  +   LD  + S+L A+  S +     ++ +     + +A  Q  + + SDI
Sbjct: 66  LFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARASDI 125

Query: 183 FGRKVVLIFCNITFFVGSLI 202
           FGR  +L    + + VG++I
Sbjct: 126 FGRMTILALAVVLYAVGTII 145

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +DIFGRK  L+F N+ F +G+++   +  F  + AGR I
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAGRLI 189

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++SW A++Y L+  TF  I G++ DIFG +   I     + + SL+ G S
Sbjct: 82  QLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 140/340 (41%), Gaps = 30/340 (8%)

Query: 319 KVRLSAVDWIGATTLVLFLFSFMITASL-GGKEIPYTSHKFIGLCVVTVIGALI----FG 373
           ++ L  +D+IG    V F    ++  +L GG    + + + I   V  V+G ++    F 
Sbjct: 270 EIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARII---VPEVLGWVVAFPAFL 326

Query: 374 YTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMAL-MTVSYYLPIYFAGVLNMKPTDIG 432
             E+K AK P+ P + +KDR V  + +   F   A  M  +Y   I    V   K +   
Sbjct: 327 TWEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATR 386

Query: 433 KRIIPNFFSTAFGSLGAGYYMK--KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQY 490
              +  F +   G+L     +K  +T ++ +F I+   L S G L+  +     +     
Sbjct: 387 INSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWFL-SFGLLE-RYTGGTNAYAGII 444

Query: 491 TLMFIPGLGASVLITVALLAMIA-AVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRES 549
             + + G G   +      +M A A+ H   A+ TS+  A  + G ++G S+ GAI+   
Sbjct: 445 AALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIW--- 501

Query: 550 LDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVF 609
             N+L  K+ K  +     +       K      W    SP   +Q +++ Y    K + 
Sbjct: 502 -TNVLPDKIEKGLNNSTLANFAYNSPTKFILQYNW---ESPE--RQIVVNAYKHVEK-IL 554

Query: 610 IFCLLCTIAATFSMA-IIKEHRLHNTLDRD-----NENEE 643
           I   LC +      A +++  RL + +  D     NE +E
Sbjct: 555 IIVGLCFLVPLLGGAFLLRNQRLEDAVALDKVEPKNEKKE 594

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%)

Query: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPI 175
           S  R  I+ L ++   +   LDN + S       S + +   +S V     + SA  Q  
Sbjct: 60  SPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIW 119

Query: 176 YGKISDIFGRKVVLIFCNITFFVGSLI 202
           + + SD+FGR  +LI   + + VG+++
Sbjct: 120 FARASDLFGRGTILIVAVMFYVVGTIV 146

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 13/102 (12%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAH--IASEFNELP----------RISWVATAYLLSS 169
           II L +  G F+   D   +S  LA       F EL           R   V + + L  
Sbjct: 57  IICLMVAFGGFVFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGC 116

Query: 170 ATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEW 211
           A    ++ K+ D +GR++ L+   + + VG +IC +S + +W
Sbjct: 117 AIGGILFSKLGDTYGRRIALVIVTLVYMVGIVIC-ISANSKW 157

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           R +W+ +++ L+  +F  + G++ DI+G K +L+   I   V S+ICGLS
Sbjct: 112 RQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D+FGR+  L+F N+ F +G+++   +  F  + AGR I
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLI 211

>TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432
          Length = 554

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDI 237
           K SD FGR+V L  C   + +G++I   S +   LVAGR I+                ++
Sbjct: 91  KFSDAFGRRVSLHLCAAFWIIGAIIQCASQNVGMLVAGRVISGIGIGFGSSTAPVYCSEV 150

Query: 238 VPLRNRALYQGICNF 252
            P + R    GI  F
Sbjct: 151 SPPKIRGTIAGIFQF 165

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +I  S++   +   LDN++  T      S +N+   +S V+    + SA  Q  + + +D
Sbjct: 62  LIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSAD 121

Query: 182 IFGRKVVLIFCNITFFVGSLI 202
           +FGR  +L+   + + VG+++
Sbjct: 122 MFGRTTILMISIVFYVVGTVV 142

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 56/325 (17%)

Query: 347 GGKEIPYTSHKFIGLCVVTVIGAL-IFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFC 405
           GG+E  +++ + I   V+    AL +F   E+K A+ P+ P   LK+R ++ + +   F 
Sbjct: 295 GGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFL 354

Query: 406 MMALMTVSYYL-PIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVI 464
             A    S YL  +    V   K +      + +F S   G L +G+ + K  +   F  
Sbjct: 355 QFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFL-SGFVVAKVRRTKEF-- 411

Query: 465 SFCVLASIGCLQIVWIQPDISVFKQYTLM--FIPGLGASVLITVA--------------L 508
              +   IG    VW       F  + LM  +  GL + V I VA               
Sbjct: 412 ---IFFGIG----VW-------FISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPA 457

Query: 509 LAMIAAVPHNHQ--AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEH 566
            A I A  ++H+  AV TS+  A  S G   G ++ G+I+     N+L  K+ +  + E 
Sbjct: 458 RASIQASAYSHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWT----NVLPGKISEGITNET 513

Query: 567 SEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACK--NVFIFCLLCTIAATFSMA 624
             D       K     +W    +P   +Q +++ Y    +  N+   CLL  +    S  
Sbjct: 514 LADYAYGSPTKFILKYKW---DTPE--RQAVVEAYKVIGRLLNIVGICLLVPL--LISAF 566

Query: 625 IIKEHRLHNTLDRD------NENEE 643
            +K  RL + +  D      +EN E
Sbjct: 567 FLKNRRLEDVVSFDKFDKMNSENAE 591

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++SW + AY L+  TF  I G++ D+FG K + +   + + + SL+ G S
Sbjct: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D+FGR+  L+F N+ F +G+++   +  F  + AGR I
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLI 213

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D+FGR+  L+F N+ F +G+++   +  F  + AGR I
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLI 219

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 1/118 (0%)

Query: 132 FLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           F ++L + I    L  +  +FN +  +++     YLL       I G ++D++GR+ V++
Sbjct: 101 FWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVIL 160

Query: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQG 248
              + F V S+    +PS+  +V  R I                 D    R R  + G
Sbjct: 161 GGMLIFVVASIGIAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTFVG 218

>ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {ON}
           similar to uniprot|Q04162 Saccharomyces cerevisiae
           YDR387C Hypothetical ORF
          Length = 538

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 61/182 (33%), Gaps = 6/182 (3%)

Query: 117 TARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIY 176
           T R  II +   +G  L   D  ++S +L  +  +   L  ++      + S       +
Sbjct: 45  TFRNLIIFVGATVGGLLFGYDTGVISGVLLMLKPQDISLDVVTDFQKELITSVTCLGSFF 104

Query: 177 GKI-----SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXX 231
           G I     +D +GRK  +  C   F V ++   LS S  +LV GR I             
Sbjct: 105 GSIIAFPTADKYGRKSTMALCCTVFVVAAIWMALSTSLTFLVIGRLIVGVAVGVAAQCVP 164

Query: 232 XXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSF-LIQLPIAFFST 290
               +I P   R L   +                    +    WR  F L  LP   F  
Sbjct: 165 VYLSEISPASTRGLVLALNTLAITGGQLISYVVSLSMQNVQHSWRYLFGLAALPAIIFLL 224

Query: 291 IL 292
           IL
Sbjct: 225 IL 226

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 129 LGIFLAALDNTIVSTLLAHIASEF-NELPRISWVATAYLLSSATFQPIYGKISDIFGRKV 187
           +G  L     T   +++  IA +F +E  + +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145

Query: 188 VLIFCNITFFVGSLICGLS 206
           +L+       + S+ICGL+
Sbjct: 146 MLLLGYAILTIWSIICGLT 164

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 132 FLAALDNTIVSTLLAHIASEFNELPRISW-----VATAYLLSSATFQPIYGKISDIFGRK 186
           F+   D   +S+ L  I ++ +    +S+     +  A  L +     + G  +DIFGR+
Sbjct: 122 FMFGYDTGYISSALVSIGTDLDN-KVLSYGDKEIITAATSLGALITSTMAGTAADIFGRR 180

Query: 187 VVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
             L+F N+ F +G+++   +  F  +  GR I
Sbjct: 181 PCLMFSNVMFVIGAILQITAHKFWQMAVGRLI 212

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 122 IIMLSMYLGI--FLAALDNTIVSTLLAHIASEFNE---LPRISWVATAYLLSSATFQPIY 176
           II+L+    I  F+   D   +S+ L  I ++ +      R   + TA     A    I+
Sbjct: 86  IIILTFVASISGFMFGYDTGYISSALISIGTDLDNKVLTYREKEIVTAATSLGALITSIF 145

Query: 177 -GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
            G  +D+FGRK  L+  N+ F +G+++   + +F  + AGR I
Sbjct: 146 AGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGRLI 188

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  ++ L + +F  I G+I DI+G K  LI   I   + SLICG +
Sbjct: 89  TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFT 136

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 148 IASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           ++  FN E    +W+  ++ L++ +F  I G++ DI+G K +LI   +   V S+I GLS
Sbjct: 97  LSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLS 156

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 120 LKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPR----ISWVATAYLLSSATFQPI 175
           L II++S  L   + A+    ++   A++   +   P     + W   +Y+L SA    I
Sbjct: 41  LVIILISSQLVTLIGAVQGVPIA---AYLRERYRIEPAKGGLVGWANASYMLGSAVMVLI 97

Query: 176 YGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
            GK+ D+ G K +++F  I   + SLI G S
Sbjct: 98  AGKLGDLNGHKRMVVFGWIWLTIWSLITGFS 128

>Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar to
           Saccharomyces cerevisiae YDR387C
          Length = 557

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 44/125 (35%), Gaps = 4/125 (3%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           ++D +GRK +L+         S+I  LS S E LV GR I+                +I 
Sbjct: 124 LTDRYGRKPILLSSGFVIVFSSVIMALSNSLEVLVCGRLISGVAVGVAAQCTPAYWGEIS 183

Query: 239 PLRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLR 298
           P   R                       +F  + V WR  F     I     ++++LFL 
Sbjct: 184 PASLRGSIMASQTVALAGAQVIAYLISVYFMSKDVAWRYLF----GIGVVPAMILLLFLA 239

Query: 299 LPKES 303
              ES
Sbjct: 240 FIPES 244

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 26/42 (61%)

Query: 177 GKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           G  +D+FGR+  L+F N+ F +G+++   +  F  + AGR +
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLV 211

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           ++  +SD++GRKV   F    + + ++ C L+P+   L+A RFI                
Sbjct: 233 LWSPVSDLYGRKVAYFFSMGLYTIFNIPCALAPNLGCLLACRFICGIFASSGLCLVGGSI 292

Query: 235 XDIVPLRNR---------ALYQGIC 250
            D+ P  +R         A Y G C
Sbjct: 293 ADMFPSNSRGKAIAFFAWAPYAGPC 317

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  ++ L S +F  I G++ DI+G K  L+  NI F + +LI G +
Sbjct: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155

>KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} similar
           to uniprot|Q04162 Saccharomyces cerevisiae YDR387C
           Putative transporter protein
          Length = 537

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 180 SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           +D  GRK+ L  C+I F + ++I  LS S   LV GR +
Sbjct: 109 ADYLGRKIALALCSIIFCISAVIMALSTSLFTLVTGRLV 147

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181
           +I  S++L  +   LD    +T +    S + E   +S V     + SA  Q  + + SD
Sbjct: 67  MIFFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARASD 126

Query: 182 IFGRKVVLIFCNITFFVGSLI 202
           IFGRK++     I + +G++I
Sbjct: 127 IFGRKLIFGLSVIFYVIGTVI 147

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 54/135 (40%), Gaps = 17/135 (12%)

Query: 517 HNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIID 576
           H   A+ TS+  A  S G  +G ++ GAI+   L   ++S++        +       I 
Sbjct: 473 HEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNVLPGQIESRISNATIAASAYSSPTTFIK 532

Query: 577 KASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLD 636
           K    TE+         +  ++  Y +  K + I  L+  +    S   +++ +L + L 
Sbjct: 533 KYKWGTEY---------RTAVVSAYGYVWKILNITGLVLVLPLLISALFLRDRKLESVLA 583

Query: 637 RD--------NENEE 643
            D        +ENE+
Sbjct: 584 FDEVTDTEGYSENEK 598

>Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON}
           complement(3711..5390) [1680 nt, 560 aa]
          Length = 559

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 3/78 (3%)

Query: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXX 231
             PIY   SD +GR+V L  C + + +GS +   +     LV GR IA            
Sbjct: 91  LSPIY---SDAYGRRVSLHVCAVLWLIGSTLQCAAQDVAMLVVGRLIAGIGIGFGVGTAP 147

Query: 232 XXXXDIVPLRNRALYQGI 249
               +I P + R    GI
Sbjct: 148 VYCAEIAPPKIRGAIAGI 165

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 75/185 (40%), Gaps = 10/185 (5%)

Query: 127 MYLGIF--LAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI----- 179
           + LG+F   A + + I  ++++  + E N++  +S    + + S      + G I     
Sbjct: 95  LMLGVFASFAGILSGIDQSIISGASIEMNKMLHLSSHEASLVSSLMPLGAVAGSILLTPF 154

Query: 180 SDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVP 239
           S++ GRK  L+     + +G++IC  + + + + AGRF                  + VP
Sbjct: 155 SEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFFIGVGVGLEGGGIGVYIAECVP 214

Query: 240 LRNRALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRL 299
              R     +  F               F +   GWR  F++   +  FST+L I  L L
Sbjct: 215 STVRGRLVSLYQFNIALGELFGYIVGVIFFEVHGGWR--FMVGSSL-IFSTLLFIGLLFL 271

Query: 300 PKESK 304
           P+  +
Sbjct: 272 PESPR 276

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%)

Query: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182
           I   M+  +   A    ++ST+     S  +++   +W+  ++ L S +F  I G+I DI
Sbjct: 44  IFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDI 103

Query: 183 FGRKVVLIFCNITFFVGSLICGLS 206
           +G K  +I   I   + +L+CG +
Sbjct: 104 YGLKKTMIGGYIFMIIWTLLCGFA 127

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 132 FLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190
           F ++L + I    L  +  EFN +  +++     YLL       + G ++D+FGR+ +++
Sbjct: 112 FWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIIL 171

Query: 191 FCNITFFVGSLICGLSPSF 209
              + + V S+    +PS+
Sbjct: 172 GGMVIYVVASIGLACAPSY 190

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 114 ELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATF 172
            L  +R  + +LS +  + + A D  IV+  +  ++ +FN +   I+W  T  L++    
Sbjct: 37  RLINSRTWLFVLSAFGSLTIEATDFFIVALNVKKLSGDFNVKTASITWGITLALMTRTIG 96

Query: 173 QPIYGKISDIFGRKVVLIFCNITFFVG-SLICGLSPSFEWLVAGR 216
             I+G + D +G+K   +  N++  +   +I G + SF + +A R
Sbjct: 97  AVIFGYVGDRYGQKTSFL-VNLSIMMALQIIIGFATSFRYFLACR 140

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 70/180 (38%), Gaps = 18/180 (10%)

Query: 129 LGIFLAALDNTIVSTLLA--HIASEFNELPR------ISWVATAYLLSSATFQPIYGKIS 180
           LG+FL   D  ++S  L   +  + FN   R      +S +    L+SS     + G++ 
Sbjct: 114 LGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGALVSSL----LVGRLG 169

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPL 240
           + +GR+  + + ++ F +G L  G +     L+ GR I+                +I P 
Sbjct: 170 EKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLLSTIVPIYQSEISPP 229

Query: 241 RNRALYQGICNFYFXXXXXXXXXXXXW---FSDRSVGWRMSFLIQLPIAF--FSTILIIL 295
            NR     I  F              +   F + +  WR+  L+Q  I F  F    +IL
Sbjct: 230 HNRGKLACI-EFTGNIVGYAASVWIDYGCSFIEGNASWRIPLLLQSVIGFALFCGTFVIL 288

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 92/226 (40%), Gaps = 31/226 (13%)

Query: 357 KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGS---SLSNWFCMMALMTVS 413
           + IG CV   +    F   E K A+ P+ P   LKDR V+ +   +    FC+   M   
Sbjct: 306 EVIGWCVALPL----FVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIHFCVY--MQAD 359

Query: 414 YYLPIYFAGVLNMKPTDIGKRIIP--NFFSTAFGSLGAGY---YMKKTGKYYWFVISFCV 468
           Y   +    V   +     +RI    NF S   G+L  G+   Y+K+T K+  F +  CV
Sbjct: 360 YMYTVLVIAV--HESVKAAQRITTLFNFVSIITGTL-LGFVIVYVKRTKKFILFGV--CV 414

Query: 469 -LASIGCLQIVWIQPDISVFKQYT-LMFIPGLGASVLITVALLAMIAA-VPHNHQAVTTS 525
              + G L  V  + D S        + + G G       A ++M A+   H   AV TS
Sbjct: 415 WFVAFGLL--VHFRGDESSHSGIIGALCLLGFGGGFFNYSAQVSMQASTAAHQDLAVVTS 472

Query: 526 ISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKV-------LKFKSP 564
           +  A  + G     +I GAI+   L   L  ++       L + SP
Sbjct: 473 LYLACYNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLAYSSP 518

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 141 VSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGS 200
           + T L H A  + +   I+   +   L S+ F    G  +DI+GRK  L+F N+ F VG+
Sbjct: 128 IGTDLDHRALTYGDKEIITAATSLGALISSIFA---GTSADIWGRKPCLMFSNLLFTVGA 184

Query: 201 LICGLSPSFEWLVAGRFI 218
           ++   + SF  +  GR I
Sbjct: 185 VLQISARSFWQMAVGRLI 202

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 140 IVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVG 199
           ++ST+     S  ++  + +W+  ++ L S +F  I G+I DI+G K  +I   I   + 
Sbjct: 83  VLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 200 SLICGLS 206
           SL+CG +
Sbjct: 143 SLLCGFA 149

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 153 NELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +E  + +W+  ++ L S +F  I G+I DI+G K  LI   + F + SLI G +
Sbjct: 109 SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 31/70 (44%)

Query: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXX 234
           I+  +SD++GR+V   F    + + ++ C L+P+   L+A RF+                
Sbjct: 237 IWSPVSDLYGRQVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSI 296

Query: 235 XDIVPLRNRA 244
            D+ P   R 
Sbjct: 297 ADMFPSETRG 306

>ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conserved
           hypothetical protein
          Length = 682

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 70/180 (38%), Gaps = 18/180 (10%)

Query: 129 LGIFLAALDNTIVSTLLA--HIASEFNELPR------ISWVATAYLLSSATFQPIYGKIS 180
           +G+FL   D  ++S  L   +    F++  R      +S +    L+SS     +  ++ 
Sbjct: 117 IGVFLFGYDQGVMSGCLTGKYFKRHFHDPSRAAIGIMVSILEIGALVSSL----VTSRLG 172

Query: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIVPL 240
           +  GR+  + + ++ F +G L    +    +L+AGR I+                +I P 
Sbjct: 173 EKLGRRRTIKYGSLVFIIGGLFQAFAGGIGYLIAGRLISGVGVGLLSTIVPIYQSEISPP 232

Query: 241 RNR---ALYQGICNFYFXXXXXXXXXXXXWFSDRSVGWRMSFLIQLPIAF--FSTILIIL 295
            NR   A  +   N               +F + +  WR+   IQ  I F  FS   +I+
Sbjct: 233 HNRGKLACIEFTGNIVGYATSVWIDYACSYFENNAA-WRLPLFIQSVIGFMLFSGSFVIV 291

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206
           +W+  ++ L S +F  I G++ DI+G K ++I   I   + SLICG +
Sbjct: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFT 162

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 325 VDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKD 382
           +DWIG+   V  L LF+F+      G  + +     I L +V+VI  + F   E+K AK 
Sbjct: 272 MDWIGSVLGVIGLILFNFVWNQ---GPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKV 328

Query: 383 PILPLRFLKDRSVL 396
           P+LP    ++  +L
Sbjct: 329 PLLPKAVTQNGHIL 342

>Kwal_23.6233 s23 (1500534..1501562) [1029 bp, 342 aa] {ON} YCR053W
           (THR4) - threonine synthase [contig 16] PARTIAL
          Length = 342

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 387 LRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGS 446
           + F K  +V   +  NW  ++A MT  YY   YF    + +     K ++P   S  FG 
Sbjct: 57  VEFNKKHNVGAVNSINWARILAQMT--YYFYAYFQATNDTQSK--VKFVVP---SGNFGD 109

Query: 447 LGAGYYMKKTG 457
           + AGYY KK G
Sbjct: 110 ILAGYYAKKMG 120

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 82/439 (18%), Positives = 154/439 (35%), Gaps = 46/439 (10%)

Query: 212 LVAGRFIAXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFYFXXXXXXXXXXXXWFSDR 271
           L+ GR +A                 +V  R+R L   I +  F             F+  
Sbjct: 4   LIVGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH 63

Query: 272 SVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDG-----NYFSTIKVR----- 321
            V WR  F I LPI   + I+ +L  +   E+KG   Q+       + F+  K R     
Sbjct: 64  -VTWRWCFYINLPIGGLAIIMFLLTYK--AENKGILQQIKDAIGTISSFTFSKFRHQVNF 120

Query: 322 -------LSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGY 374
                  +   D+ G       L  F++  + GG +  + S + I      V+G L+F +
Sbjct: 121 KRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYL---VLGVLLFIF 177

Query: 375 TEL--------------KIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYF 420
           + +               I+  P+L  R +   +++  ++  +           Y   +F
Sbjct: 178 SLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFF 237

Query: 421 AGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWI 480
             +        G  +IP   +    ++ +G   KK G     +I   VL  IG   +  +
Sbjct: 238 QLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLM 297

Query: 481 QPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV------TTSISYAFRSTG 534
               +   Q  ++ +PG      +  +L++    +  +           T+ +   +S G
Sbjct: 298 TNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLG 357

Query: 535 CTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIK 594
            TLG  +   +F  S  N +    L+    +  +D ++  +     S   + N     IK
Sbjct: 358 TTLGGVLSTTVFSASFHNKVSRAHLEPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIK 417

Query: 595 QTL-IDCYHFACKNVFIFC 612
               +D   +A    F+FC
Sbjct: 418 NVFWMDLGFYALG--FLFC 434

>ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON}
           similar to uniprot|O43081 Schizosaccharomyces pombe
           SPBC947 SPBC947.06c protein and weakly similar to
           YHR048W uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 508

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 129 LGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIY-GKISDIFGRKV 187
           L  F A  ++T  S  ++H+   FN     + +AT+  +    F P++   +S+++GRK+
Sbjct: 72  LATFSAQFNSTTTSPSVSHLGEYFNVSREKALLATSLYVLGIAFGPMFFAPLSEMYGRKI 131

Query: 188 VLIFCNITFFVGSLICGLSPSFEWLVAGRFIA 219
            +    +   V +L    S  F  L+A RF A
Sbjct: 132 AIFGSLLVSMVFTLGSASSKDFASLLATRFFA 163

>SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {ON}
           similar to uniprot|Q04162 Saccharomyces cerevisiae
           YDR387C Hypothetical ORF
          Length = 537

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 129 LGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKI-----SDIF 183
           +G  L   D  ++S +L  +  +  +L  ++      + S  +    +G +     +D +
Sbjct: 47  IGGLLFGYDTGVISGVLISLKPQDLQLTELTNFQKELITSITSAGSFFGSLLAFPTADHW 106

Query: 184 GRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFI 218
           GRK  L FC   F V ++I  LS S   LV GR I
Sbjct: 107 GRKYTLAFCCTIFAVAAIIMALSNSIHMLVFGRSI 141

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 403 WFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRIIPNFFSTAFGS----LGAGYYMKK 455
           W  +     + +  PIY  G+ N+    P +  KR++ NF +TA  S    +G   Y+  
Sbjct: 362 WNVVQTKKLMDFSSPIYIDGIPNLNSLPPKEQSKRLLENFRATALSSVTGLIGLNDYLDI 421

Query: 456 TGKYY 460
             KYY
Sbjct: 422 ADKYY 426

>Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar to
           Ashbya gossypii AEL042C
          Length = 555

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%)

Query: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAXXXXXXXXXXXXXXXXDIV 238
           ISD FGR+V L  C+  + VG+++   S     L+AGR IA                +I 
Sbjct: 92  ISDTFGRRVSLHACSSFWIVGAILQCASQGQAMLIAGRVIAGMGIGFGSSVAPIYCSEIS 151

Query: 239 PLRNRALYQGI 249
           P + R    GI
Sbjct: 152 PPKIRGAIGGI 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,032,907
Number of extensions: 2354860
Number of successful extensions: 10087
Number of sequences better than 10.0: 351
Number of HSP's gapped: 10055
Number of HSP's successfully gapped: 432
Length of query: 643
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 527
Effective length of database: 40,180,143
Effective search space: 21174935361
Effective search space used: 21174935361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)