Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.438.271ON86686640490.0
Skud_12.1608.271ON89381827180.0
YLR092W (SUL2)8.271ON89381827140.0
NCAS0B050508.271ON92384527070.0
Smik_12.1518.271ON89381926900.0
KNAG0G020708.271ON89981426800.0
Suva_10.1768.271ON89381826670.0
NDAI0B020208.271ON90582926600.0
YBR294W (SUL1)na 1ON85980126280.0
Skud_2.424na 1ON86380026250.0
Smik_2.435na 1ON86381226050.0
Suva_4.554na 1ON85080226000.0
KAFR0B027508.271ON83479925910.0
TPHA0J008008.271ON91785725850.0
TDEL0F039808.271ON86780025830.0
CAGL0L12342g8.271ON89186725640.0
TPHA0A017608.271ON89383625090.0
KLLA0F19338g8.271ON89179825040.0
SAKL0H16830g8.271ON86279324710.0
KLTH0G13486g8.271ON90283124270.0
ZYRO0C01452g8.271ON90684523880.0
Kwal_56.237598.271ON86180423220.0
AGR077C8.271ON84879822680.0
Ecym_42998.271ON87484921730.0
TBLA0F030508.271ON89750712721e-161
Ecym_7084na 2ON6894642692e-23
TBLA0C052708.99ON7764622674e-23
NCAS0B048008.99ON7245192576e-22
NDAI0B022108.99ON7065132541e-21
TPHA0H007208.99ON7874692497e-21
YPR003C8.99ON7544662452e-20
AGR213Cna 2ON6894412423e-20
Suva_16.3228.99ON7424622424e-20
Kpol_467.118.99ON7444942424e-20
ZYRO0F04796g8.99ON7354662414e-20
Skud_16.2868.99ON7455292399e-20
KLLA0E14059g8.99ON7064612245e-18
CAGL0L09207g8.99ON7254052093e-16
SAKL0H08800gna 2ON6204371825e-13
KNAG0D023908.99ON7161521593e-10
Smik_16.2418.99ON7441481584e-10
TDEL0C012808.99ON7271571512e-09
Kwal_27.110398.99ON7261471504e-09
SAKL0B03124g8.99ON7441401479e-09
KLTH0G16764g8.99ON7101451432e-08
KAFR0C019103.485ON1020172771.6
KLLA0E04731g3.485ON1060116762.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.43
         (866 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1564   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1051   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1050   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1047   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1040   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1036   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1031   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1029   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1016   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1015   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1008   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1006   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1002   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1000   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   999   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   992   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   971   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   969   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...   956   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   939   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   924   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   899   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   878   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   841   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   494   e-161
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   108   2e-23
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   107   4e-23
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   103   6e-22
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   102   1e-21
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   100   7e-21
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    99   2e-20
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    98   3e-20
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    98   4e-20
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    98   4e-20
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    97   4e-20
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    97   9e-20
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    91   5e-18
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    85   3e-16
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    75   5e-13
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    66   3e-10
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    65   4e-10
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    63   2e-09
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    62   4e-09
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    61   9e-09
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    60   2e-08
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    34   1.6  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    34   2.0  

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1564 bits (4049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 778/866 (89%), Positives = 778/866 (89%)

Query: 1   MSFXXXXXXXXXXXYNQYKTVEEQXXXXXXXXXXXXXXXXXXXXLTKDSKFVFEKDLGYT 60
           MSF           YNQYKTVEEQ                    LTKDSKFVFEKDLGYT
Sbjct: 1   MSFDLDDLEDLELEYNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYT 60

Query: 61  DDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLP 120
           DDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLP
Sbjct: 61  DDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLP 120

Query: 121 FYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVC 180
           FYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVC
Sbjct: 121 FYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVC 180

Query: 181 IGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVE 240
           IGPVAVMSLQTAKVIQHVNSSLTEEQK               CGIISAGVGLLRLGFLVE
Sbjct: 181 IGPVAVMSLQTAKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVE 240

Query: 241 LISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFG 300
           LISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFG
Sbjct: 241 LISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFG 300

Query: 301 LIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWS 360
           LIPLVILYFWKWWFSSMGPKLVDRYYPNS            GNAMRSGIIIIVMTSISWS
Sbjct: 301 LIPLVILYFWKWWFSSMGPKLVDRYYPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWS 360

Query: 361 VTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSF 420
           VTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSF
Sbjct: 361 VTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSF 420

Query: 421 GRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCV 480
           GRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCV
Sbjct: 421 GRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCV 480

Query: 481 LLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVF 540
           LLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVF
Sbjct: 481 LLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVF 540

Query: 541 ASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYS 600
           ASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYS
Sbjct: 541 ASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYS 600

Query: 601 TVLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTE 660
           TVLMNP                  YHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTE
Sbjct: 601 TVLMNPEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTE 660

Query: 661 SFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXX 720
           SFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFL          
Sbjct: 661 SFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKNK 720

Query: 721 XXDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHF 780
             DDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHF
Sbjct: 721 NKDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHF 780

Query: 781 SGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSS 840
           SGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSS
Sbjct: 781 SGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSS 840

Query: 841 YYIHAGTGTNFPFFHIEIPDFSKWNI 866
           YYIHAGTGTNFPFFHIEIPDFSKWNI
Sbjct: 841 YYIHAGTGTNFPFFHIEIPDFSKWNI 866

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/818 (63%), Positives = 609/818 (74%), Gaps = 39/818 (4%)

Query: 77  NVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGIT 136
           +V ++ E  V+LKEYYNHSIR +LT K  G+YL S+FPII WLP YN+ W I+DLIAGIT
Sbjct: 87  SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGIT 146

Query: 137 IGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQ 196
           IGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY YS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 197 HVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSAL 256
            V +   +                  CGIISA VG LRLGFLVELISLNAV GFMTGSA 
Sbjct: 207 EVQAKYPDGD-TTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 257 NIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSS 316
           NI+ GQVPALMGY   VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY WKWW  +
Sbjct: 266 NILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325

Query: 317 MGPKLVDRY-YPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISIL 375
            GP+L DRY   N+              A R+GIIIIV T I W++TRGKS SERPISIL
Sbjct: 326 YGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISIL 385

Query: 376 GTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELI 435
           G+VPSGL+EVGVF  P+GL++K+ P LPSSIIVLLLEHIAI+KSFGR+NDYKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQELI 445

Query: 436 AIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIP 495
           AIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFYIP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 496 KATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSA 555
           KATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIYF MCWS 
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565

Query: 556 AILLFKVAFPAGKFLGYVKIAEIVNPEI-VDSD---YLVE--------------KAETSV 597
           A+LL KVAFPAGKFLG V+IAE+ +  +  DSD   Y+ E              + E S 
Sbjct: 566 AMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISA 625

Query: 598 QYST-----VLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDG 652
           +Y T     +  N                   YH KW+P+DH YT+E+NP+V + PPP+ 
Sbjct: 626 KYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHILPPPES 685

Query: 653 VIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXX 712
           V+VYRL+ES+TY+NCSR+Y  + D+VK  TR GQ++ H KKSDRPWNDPG W+ P FL  
Sbjct: 686 VLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFLKN 745

Query: 713 ----XXXXXXXXXXDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAI 768
                          + P    +   D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+AI
Sbjct: 746 LKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAI 805

Query: 769 NKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNP 828
           N+YADRQVEFHF GI+SPWVK+GL++ GFGT+N+EYSDESI+ GHTSYHV +    + NP
Sbjct: 806 NQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARVPRNKENP 865

Query: 829 MTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
                       Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 866 ----------DKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/818 (63%), Positives = 616/818 (75%), Gaps = 39/818 (4%)

Query: 77  NVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGIT 136
           +V ++ E TV+LKEYY+HSIR +LT K   +YL S+FPII WLP YN+ W  +DLIAGIT
Sbjct: 87  SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGIT 146

Query: 137 IGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQ 196
           IGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY+YS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 197 HVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSAL 256
            V +   +                  CGIISA VG LRLGFLVELISLNAV GFMTGSA 
Sbjct: 207 DVTAKYPDGDSAITGPVIATTLALL-CGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 257 NIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSS 316
           NI+ GQVPALMGY S VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY WKWW  +
Sbjct: 266 NILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325

Query: 317 MGPKLVDRY-YPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISIL 375
            GP+L DRY   N               A R+GIIIIV T I W++TRGKSKSERPISIL
Sbjct: 326 YGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISIL 385

Query: 376 GTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELI 435
           G+VPSGL+EVGVF  P GL++K+ P LP+SIIVLLLEHIAI+KSFGR+NDYKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 445

Query: 436 AIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIP 495
           AIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFYIP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 496 KATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSA 555
           KATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIYF MCWS 
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565

Query: 556 AILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSD---YLVEK--------------AETSV 597
           A+L+ KVAFPAGKFLG V++AE+ +  +  DSD   Y+ E                E+S 
Sbjct: 566 AMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESST 625

Query: 598 QYST-----VLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDG 652
           +Y T     +  N                   YH KWIP+DH YT+E+NP+V++ PPPDG
Sbjct: 626 KYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDG 685

Query: 653 VIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXX 712
           V+VYRL+ES+TY+NCSR+Y  + ++VK++TR GQL+ H KKSDRPWNDPG W+ P FL  
Sbjct: 686 VLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKN 745

Query: 713 ----XXXXXXXXXXDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAI 768
                         ++ P+T  +   D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+AI
Sbjct: 746 LKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAI 805

Query: 769 NKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNP 828
           N+YADRQVEFHF GI+SPWVK+GL++ GFGT+N+EYSDESI+ GHTSYHV +    E NP
Sbjct: 806 NQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQGEENP 865

Query: 829 MTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
                       Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 866 ----------EKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/845 (60%), Positives = 635/845 (75%), Gaps = 42/845 (4%)

Query: 56  DLGYTDDSNELTRESFLNSSEN---VPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISI 112
           D+ +++ +N    +  + S+ N   +P Y E+TV++K+YY+HSIR  +T     +Y +SI
Sbjct: 87  DVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSI 146

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSL 172
           FPI +WLP YN  W  SDLIAGIT+GCVLVPQSMSYAQIATLP QYGLYSSF+GA+ YSL
Sbjct: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSL 206

Query: 173 FATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGL 232
           FATSKDVCIGPVAVMSL+TAKV+  V +   +                  CGI++AGVG+
Sbjct: 207 FATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLL-CGIVTAGVGV 265

Query: 233 LRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPD 292
           LRLGFLVELISLNAVTGFMTGSALNI+ GQVP LMGY S+VNTR A YKVII TLKHLPD
Sbjct: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325

Query: 293 TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYP---NSXXXXXXXXXXXXGNAMRSGI 349
           TK+DA+FGLIPL +LY WKWW  +MGPKLVD+++P   N               A ++ I
Sbjct: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAI 385

Query: 350 IIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVL 409
           IIIV T+ISWS+TRGK+K++RPISILGTVP GL+EVGV   P+GLL+K+APELP+S+IVL
Sbjct: 386 IIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVL 445

Query: 410 LLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKT 469
           LLEHIAIAKSFGR+NDYKVVPDQELIAIG++NLIGTFFN+YP TGSFSRSALKAKC V+T
Sbjct: 446 LLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRT 505

Query: 470 PLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFI 529
           PLSGIFTG+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASYK TW+FWKMNPLD +
Sbjct: 506 PLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCL 565

Query: 530 CFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYL 589
           CF+ TVFITVF+SIE+GIYF +CWS AILL KV FPAGKFLG +++AE+++  + +S   
Sbjct: 566 CFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNS--- 622

Query: 590 VEKAETS------------------VQYSTVLM--NPXXXXXXXXXXXXXXXXXXYHIKW 629
           +E A T+                  +Q ++ +                       Y+ KW
Sbjct: 623 IESATTAEYSSASSPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKW 682

Query: 630 IPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMT 689
           +P+DHAYT+E+NP+V + PPP GVIVYRLT+SFTYINCSR+Y+ ++D+VK  TR GQL+ 
Sbjct: 683 VPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLR 742

Query: 690 HIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPT---TFDNKVVDTRPILKIICLD 746
           H KK+DRPWNDPG+W+ P+FL            D+E     + ++ + D RP+LKI+CLD
Sbjct: 743 HRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLD 802

Query: 747 FSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSD 806
           FSQVAQ D++A+QSL+DLR++IN+YADRQVEFHF+GI+SPWVK+GL+N GFGT+N E+SD
Sbjct: 803 FSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSD 862

Query: 807 ESIIIGHTSYHVVKTE-----DLENNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDF 861
            SII GH+SYH+ +T      DLE+N   T       S Y++ A TGTN PFFHI+IPDF
Sbjct: 863 ASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSR----SQYHVFAATGTNLPFFHIDIPDF 918

Query: 862 SKWNI 866
           SKW++
Sbjct: 919 SKWDL 923

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/819 (62%), Positives = 613/819 (74%), Gaps = 41/819 (5%)

Query: 77  NVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGIT 136
           +V ++ E TV+LKEYY+HSIR +LT K   +YL S+FPII WLP YN+ W  +DLIAGIT
Sbjct: 87  SVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGIT 146

Query: 137 IGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQ 196
           IGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY+YS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 197 HVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSAL 256
            V +   +                  CGIISA +G LRLGFLVELISLNAV GFMTGSA 
Sbjct: 207 DVTAKYPDGDPAITGPVIATTLALL-CGIISAAIGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 257 NIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSS 316
           NI+ GQVPALMGY S VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY WKWW  +
Sbjct: 266 NILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325

Query: 317 MGPKLVDRY-YPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISIL 375
            GP L DRY   N               A R+G+II+V T I W++TRGKSKSERPISIL
Sbjct: 326 YGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISIL 385

Query: 376 GTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELI 435
           G+VPSGL+EVGVF  P+GL++K+ P LP+SIIVLLLEHIAI+KSFGR+NDYKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 445

Query: 436 AIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIP 495
           AIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFYIP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 496 KATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSA 555
           KATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIYF MCWS 
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565

Query: 556 AILLFKVAFPAGKFLGYVKIAEIVNPEI-VDSDYLVEKAE-----------------TSV 597
           A+LL K+AFPAGKFLG V+IAE+ +  I  +SD +   +E                 +S 
Sbjct: 566 AMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSST 625

Query: 598 QYST-----VLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDG 652
           +Y T     +  N                   YH KW+P+DH YT+E+NP++++ PPP+G
Sbjct: 626 KYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEG 685

Query: 653 VIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXX 712
           V+VYRL+ES+TY+NCSR+Y  + +KVKE+TR GQL+ H KKSDRPWNDPG W+ P FL  
Sbjct: 686 VLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKN 745

Query: 713 ----XXXXXXXXXXDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAI 768
                         ++ P        D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+ I
Sbjct: 746 LKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVI 805

Query: 769 NKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNP 828
           N+YADRQVEFHF GI+SPWVK+GLV+ GFGT+N+EYSDESI+ GHTSYHV +        
Sbjct: 806 NQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVAR-------- 857

Query: 829 MTTVEEPNQNSSYY-IHAGTGTNFPFFHIEIPDFSKWNI 866
              V +  +NS  Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 858 ---VPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/814 (62%), Positives = 610/814 (74%), Gaps = 35/814 (4%)

Query: 73  NSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLI 132
           + ++ +P Y+E  VT  E++NHS+R   T  +  NY++SIFPII WLP YN  W I DLI
Sbjct: 101 DGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLI 160

Query: 133 AGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTA 192
           AGIT+GCVLVPQSMSYAQIATLPPQYGLYSSF+GA+ YSLFATSKDVCIGPVAVMSL+TA
Sbjct: 161 AGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETA 220

Query: 193 KVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMT 252
           K+I  V      +                 CG I+AGVG LRLGFLVELISLNAV GFMT
Sbjct: 221 KIIARVMKRFPNDPDVQGPIIATTTALL--CGGIAAGVGFLRLGFLVELISLNAVAGFMT 278

Query: 253 GSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKW 312
           GSALNIISGQVPALMGY   VNTR ATYKVI+NTLKHLPDTK+DA+FGLIPL ILYFW+W
Sbjct: 279 GSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRW 338

Query: 313 WFSSMGPKLVDRYYPN-SXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERP 371
           W +  GPKL DRYYP  S              A RSGIIIIV T+ISWS+TR     ER 
Sbjct: 339 WCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERR 398

Query: 372 ISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPD 431
           ISILGTVP GL++VG    P  L AK+APELP+++IVLLLEHIAI+KSFGR+NDYKVVPD
Sbjct: 399 ISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPD 458

Query: 432 QELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAF 491
           QELIAIG++NLIGTFF++YP TGSFSRSALKAKCNVKTPLSG+FTGSCVLLALYCLTGAF
Sbjct: 459 QELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAF 518

Query: 492 FYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTM 551
           FYIPKATLSAVIIH+VSDLVASY TTW+F+KMNPLDF+CF+TT+ ITVF+SIE+GIYF +
Sbjct: 519 FYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAI 578

Query: 552 CWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSV-------QYSTVLM 604
           CWS A+LLFKVAFPAGKFLG V+IAE+V+ EI++ + +V   +  V       ++S   +
Sbjct: 579 CWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKL 638

Query: 605 N-------PXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYR 657
           N                          Y+ KW+P+DHAYT+E+NP+V + PPP GVIVYR
Sbjct: 639 NGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYR 698

Query: 658 LTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXX 717
           +++S+TYIN S +Y+ + D++K +TR GQL+ H KKSDRPWNDPG+WKPPKFL       
Sbjct: 699 MSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWR 758

Query: 718 XXXXXD---DEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADR 774
                +   D  +     V D RP+LK++CLDFSQVAQ DST+LQSL+DLR+A+N YADR
Sbjct: 759 KNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADR 818

Query: 775 QVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTE--DLENNPMTTV 832
           QVEFHF+GI+SPW+K+GLV +GFGTVN+E+SDESII GH+SYH+VK    D+EN      
Sbjct: 819 QVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIEN------ 872

Query: 833 EEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
                   Y +   TGTN PFFHI+IPDF KW+I
Sbjct: 873 -------GYQVKTATGTNLPFFHIDIPDFKKWDI 899

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/818 (62%), Positives = 608/818 (74%), Gaps = 39/818 (4%)

Query: 77  NVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGIT 136
           +V ++ E TV+ KEYY+HSIR +LT K+ GNYL S+FPII WLP YN  W I+DLIAGIT
Sbjct: 87  SVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGIT 146

Query: 137 IGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQ 196
           IGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY YS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 197 HVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSAL 256
            V +    +                 CGIISA VG LRLGFLVELISLNAV GFMTGSA 
Sbjct: 207 DVTARY-PDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 257 NIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSS 316
           NI+ GQVPALMGY   VNTR ATYK++I++LKHLPDT +DA FGLIPL ILY WKWW  +
Sbjct: 266 NILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCGT 325

Query: 317 MGPKLVDRYYPNSXXXXXXXX-XXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISIL 375
            GP+L DR+                   A R+GIIIIV T I+W++TRGKS ++RPISIL
Sbjct: 326 YGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRGKSSADRPISIL 385

Query: 376 GTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELI 435
           G+VPSGL+EVGVF  P GL++K+ P LP+SIIVLLLEHIAI+KSFGRVNDYKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELI 445

Query: 436 AIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIP 495
           AIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFYIP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 496 KATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSA 555
           KATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVF+SIE+GIYF MCWS 
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSC 565

Query: 556 AILLFKVAFPAGKFLGYVKIAEIVNPEI-VDSDYLVEKAETSVQYSTV------------ 602
           AI + KVAFPAGKFLG V+IAE+ +  +  DSD +   +E + + ST+            
Sbjct: 566 AIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTLEEDGVGEKEGPT 625

Query: 603 --LMNPXXXXXXXXXXXXXXX--------XXXYHIKWIPYDHAYTKEMNPNVEVTPPPDG 652
             ++N                           YH KW+P+DH YTKE+NP+V + PPP+G
Sbjct: 626 NYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKELNPDVNILPPPEG 685

Query: 653 VIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXX 712
           V+VYRL+ES+TYINCSR+Y  + D++K++TR GQL+ H KKSDRPWNDPG W+PP F   
Sbjct: 686 VLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWEPPTFFKN 745

Query: 713 ----XXXXXXXXXXDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAI 768
                         ++      + V D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+AI
Sbjct: 746 LKFWKKKETDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAI 805

Query: 769 NKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNP 828
           N+YADRQVEFHF GI+SPWVK+GL++ GFGT+N+EYSDESI+ GHTSYHV +    E  P
Sbjct: 806 NQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQNEETP 865

Query: 829 MTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
                       Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 866 ----------DKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1029 bits (2660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/829 (60%), Positives = 619/829 (74%), Gaps = 33/829 (3%)

Query: 63  SNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFY 122
           ++++   +F   S  +P + E  ++ K+YY HS++   + KS   Y +SIFPII+WLP Y
Sbjct: 85  NHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHY 144

Query: 123 NYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIG 182
           N  W  SDLIAGIT+GCVLVPQSMSYAQIATLPPQYGLYSSF+GA+TYSLFATSKDVCIG
Sbjct: 145 NLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIG 204

Query: 183 PVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELI 242
           PVAVMSL+T KVI  V +   E                  CG+I+AG+G LRLGFLVELI
Sbjct: 205 PVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFL-CGVITAGIGFLRLGFLVELI 263

Query: 243 SLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLI 302
           SLNAVTGFMTGSALNI+ GQ+PALMGY S+VNTR +TYKVII +LKHLPDTK+DA+FGLI
Sbjct: 264 SLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLI 323

Query: 303 PLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXX-XGNAMRSGIIIIVMTSISWSV 361
           PL ILY WKWW  +MGP++ D+++ N+               A ++ +IIIV T+I+WS+
Sbjct: 324 PLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSI 383

Query: 362 TRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFG 421
           T+GK+K ERPISILG+VP GL+EVGV   P+GL +K+APELP+S+IVLLLEHIAIAKSFG
Sbjct: 384 TKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFG 443

Query: 422 RVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVL 481
           R+NDYKVVPDQELIAIG++NLIGTFFN+YP TGSFSRSALKAKC V+TPLSG+FTGSCVL
Sbjct: 444 RINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVL 503

Query: 482 LALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFA 541
           LALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTW+FWKMNPLD   FI TVFITVF+
Sbjct: 504 LALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFS 563

Query: 542 SIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDS--------------- 586
           SIE+GIYF MCWS AIL+ KVAFPAGKFLG V+IAE+VN  + DS               
Sbjct: 564 SIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLSLS 623

Query: 587 -DYLVEKAETSVQYSTVLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVE 645
            D +    +  + +  +L                     Y+ KW+P+DHAYTKE+NPNV 
Sbjct: 624 ADTINHNKKLKILHIPLLKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNPNVI 683

Query: 646 VTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWK 705
           + PPP GVIVYRLT+SFTY+NCS++Y+ +++++K+ T+ GQL+ H KKSDRPWNDPG+W+
Sbjct: 684 ILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWE 743

Query: 706 PPKF---LXXXXXXXXXXXXDDEPTTFDNKVV---DTRPILKIICLDFSQVAQTDSTALQ 759
            P F                D+E T   +  V   D RP+LK++CLDFSQVAQ D+TALQ
Sbjct: 744 APNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQ 803

Query: 760 SLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVV 819
           SL+DLR+AINKYADRQVEFHF+GI+SPW+KKGL+N+GFGT+N+EYSDESII GHTSYH+ 
Sbjct: 804 SLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLA 863

Query: 820 KT--EDLENNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
           +   +DLE   M       +  +Y ++  TGTN PFFHI+IPDF +W++
Sbjct: 864 RIPGDDLELPTM-------RGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/801 (62%), Positives = 610/801 (76%), Gaps = 21/801 (2%)

Query: 76  ENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGI 135
           +++P Y E TVTLKEYY+HSI++ LT KS G+YL+S+FPIIKW P YN+ W  +DL+AGI
Sbjct: 70  DSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGI 129

Query: 136 TIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVI 195
           T+GCVLVPQSMSYAQIA+L P+YGLYSSF+GA+ YSLFATSKDVCIGPVAVMSLQTAKVI
Sbjct: 130 TVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 189

Query: 196 QHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA 255
             V     E+Q                CGI++ G+G+LRLGFLVELISLNAV GFMTGSA
Sbjct: 190 AEVLKKYPEDQ-TEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSA 248

Query: 256 LNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFS 315
            NII GQ+PALMGY S VNTREATYKV+INTLKHLP+TK+DA+FGLIPLVILY WKWW  
Sbjct: 249 FNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCG 308

Query: 316 SMGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISI 374
           + G  L DRYY N                AMR+ ++I+V T+ISWS+TR KS  +RPISI
Sbjct: 309 TFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISI 368

Query: 375 LGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQEL 434
           LGTVPSGL EVGV   P+GLL+ ++ E+P+SIIVL+LEHIAI+KSFGR+NDYKVVPDQEL
Sbjct: 369 LGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQEL 428

Query: 435 IAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYI 494
           IAIG++NLIGTFF+SYP TGSFSRSALKAKCNV+TP SG+FTG CVLLALYCLT AFF+I
Sbjct: 429 IAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFI 488

Query: 495 PKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
           PKATLSAVIIHAVSDL+ SYKTTW+FWK NPLD I FI TVFITVF+SIE+GIYF MCWS
Sbjct: 489 PKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWS 548

Query: 555 AAILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSDYLVEKAETSVQYSTVLMNPXXXXXXX 613
            A+LL K AFPAGKFLG V++AE++NP +  D D ++   E        L N        
Sbjct: 549 CAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNE--------LPNELNKQVKS 600

Query: 614 XXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYET 673
                      + +KW+P+DH Y++E+N N  V PPP GVIVYRL +SFTY+NCSR+Y+ 
Sbjct: 601 TVEVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDI 660

Query: 674 LYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXX--XXXXXXXXXXDDEPTTFDN 731
           ++D++KE TR GQL+T  KKSDRPWNDPG+WK P  L               D P +  +
Sbjct: 661 IFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNGS 720

Query: 732 KVVDT--RPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVK 789
              +T  +P+LK++CLDFSQVAQ DSTA+QSL+DLR+A+N+YADRQVEFHF+GI+SPW+K
Sbjct: 721 SNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWIK 780

Query: 790 KGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSY----YIHA 845
           + L+++ FGT N+EYSD+SII GH+S+HV K   L+++   T E+   ++SY     + A
Sbjct: 781 RSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKV--LKDDVDYTDEDSRISTSYSNYETLCA 838

Query: 846 GTGTNFPFFHIEIPDFSKWNI 866
            TGTN PFFHI+IPDFSKW++
Sbjct: 839 ATGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/800 (62%), Positives = 606/800 (75%), Gaps = 19/800 (2%)

Query: 76  ENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGI 135
           +++P Y E TVTLKEYY+HSI+  LT KS G+YL S+FPIIKWLP YN+ W  +DL+AGI
Sbjct: 74  DSIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLVAGI 133

Query: 136 TIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVI 195
           T+GCVLVPQSMSYAQIA+L P+YGLYSSF+GA+ YSLFATSKDVCIGPVAVMSLQTAKVI
Sbjct: 134 TVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 193

Query: 196 QHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA 255
             V     E Q                CG++S  +G+LRLGFLVELISLNAV GFMTGSA
Sbjct: 194 AEVLKKYPEGQ-TEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTGSA 252

Query: 256 LNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFS 315
            +II GQ+PALMGY S VNTREATYKV+INTLKHLP+TK+DA+FGLIPLVILY WKWW  
Sbjct: 253 FSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCG 312

Query: 316 SMGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISI 374
           + G  L DRYY N                AMR+ ++IIV T+ISW +TR KS  ERPISI
Sbjct: 313 TFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPISI 372

Query: 375 LGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQEL 434
           LGTVPSGL EVGV   P GLL+ ++ ELP+SIIVL+LEHIAI+KSFGR+NDYKV+PDQEL
Sbjct: 373 LGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQEL 432

Query: 435 IAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYI 494
           IAIG++NLIGTFF+SYP TGSFSRSALKAKCNV+TP SGIFTG+CVLLALYCLT AFF+I
Sbjct: 433 IAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFFFI 492

Query: 495 PKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
           PKATLSAVIIHAVSDL+ SYKTTW FWK NPLD I FI TVFITVF+SIE+GIYF MCWS
Sbjct: 493 PKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMCWS 552

Query: 555 AAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYSTVLMNPXXXXXXXX 614
            A+LL K AFPAGKFLG V++AE++NP        V++   +V  S  L N         
Sbjct: 553 CAMLLLKQAFPAGKFLGRVEVAEVLNPT-------VQEGINAVTSSNELPNELSKQVKST 605

Query: 615 XXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETL 674
                     + +KWIP+DH Y++E+N   +V PPP GVIVYRL +SFTY+NCSR+Y+ +
Sbjct: 606 VDVLPAPEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDII 665

Query: 675 YDKVKELTRPGQLMTHIKKSDRPWNDPGDWK-PPKFLXXXXXXXXXXXXDDE---PTTFD 730
           +D++KE TR GQL++  KKSDRPWNDPG+WK P  F             D+E    +  +
Sbjct: 666 FDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRN 725

Query: 731 NKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKK 790
           N+    +P+LK++CLDFSQVAQ DSTA+QSL+DLR+A+NKYADRQVEFHF+GI+SPW+K+
Sbjct: 726 NQESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKR 785

Query: 791 GLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYY----IHAG 846
            L+++ FGT N+EYSD+SII GH+S+HV K   L+++   T E+   ++SY     + A 
Sbjct: 786 SLLSVKFGTTNEEYSDDSIIAGHSSFHVAKV--LKDDVDYTEEDSRISTSYSNYETLCAA 843

Query: 847 TGTNFPFFHIEIPDFSKWNI 866
           TGTN PFFHI+IPDFSKW++
Sbjct: 844 TGTNLPFFHIDIPDFSKWDV 863

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/812 (61%), Positives = 614/812 (75%), Gaps = 20/812 (2%)

Query: 63  SNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFY 122
           +N    E F +S   +P Y E TVTLK+YY+H+I+  LT KS G+YL S+FPIIKWLP Y
Sbjct: 64  TNSKVSEVFYDS---IPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHY 120

Query: 123 NYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIG 182
           N+ W  +DL+AGIT+GCVLVPQSMSYAQIA+L P+YGLYSSF+GA+ YSLFATSKDVCIG
Sbjct: 121 NFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIG 180

Query: 183 PVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELI 242
           PVAVMSLQTAKVI  V     E+Q                CG+++ G+G+LRLGFLVELI
Sbjct: 181 PVAVMSLQTAKVIAEVLKKYPEDQ-VEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELI 239

Query: 243 SLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLI 302
           SLNAV GFMTGSA +II GQ+PALMGY   VNTREATYKV+INTLKHLP+TK+DA+FGLI
Sbjct: 240 SLNAVAGFMTGSAFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLI 299

Query: 303 PLVILYFWKWWFSSMGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIIIVMTSISWSV 361
           PLVILY WKWW  S G KLVDR+Y N                AMR+ ++IIV T+IS+ +
Sbjct: 300 PLVILYLWKWWCGSFGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRI 359

Query: 362 TRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFG 421
           TR KSK +RPISILGTVPSGL EVGV   P+GLL+ ++ ELP+SIIVL+LEHIAI+KSFG
Sbjct: 360 TRNKSKEKRPISILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFG 419

Query: 422 RVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVL 481
           R+NDYKV+PDQELIAIG++NLIGTFF+SYP TGSFSRSALKAKCNV+TP SG+FTG+CVL
Sbjct: 420 RINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVL 479

Query: 482 LALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFA 541
           LALYCLT AFFYIPKATLSAVIIHAVSDL+ASY+TTW+FWKMNPLD I FI TV ITVF+
Sbjct: 480 LALYCLTSAFFYIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFS 539

Query: 542 SIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDS-DYLVEKAETSVQYS 600
           SIE+GIYF MCWS A+LL K AFPAGKFLG V++AE++NP I    D +V   E+  ++S
Sbjct: 540 SIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVSPNESPNEFS 599

Query: 601 TVLMNPXXXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTE 660
             + +                   + +KW+P+DHAYT+E+N    V PPP GVIVYR ++
Sbjct: 600 KQVKS--------SVDALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSD 651

Query: 661 SFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWK-PPKFLXXXXXXXXX 719
           SFTY+NCSR+Y+ ++D++KE TR GQL++  KKSDRPWNDPG+WK P  F          
Sbjct: 652 SFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGL 711

Query: 720 XXXDDE-PTTFDNKVVDT--RPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQV 776
              + E P   DN   ++  +P+LK++CLDFSQVAQ DSTA+QSL+DLR+A+NKYADRQV
Sbjct: 712 ATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQV 771

Query: 777 EFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPN 836
           EFHF+GI+SPW+K+ L+++ FGT+N+E+SD SII GH+S+H+ K    E +        +
Sbjct: 772 EFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPIS 831

Query: 837 QNSSYY--IHAGTGTNFPFFHIEIPDFSKWNI 866
              S Y  + A TGTN PFFHI+IPDFSKW++
Sbjct: 832 VTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/802 (61%), Positives = 603/802 (75%), Gaps = 22/802 (2%)

Query: 74  SSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIA 133
           S +++PRY E TVTLKEYY HSI++ LT KS GNY+ S+FPI+KWLP YN+ W  +DL+A
Sbjct: 62  SYDSIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVA 121

Query: 134 GITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAK 193
           GIT+GCVLVPQSMSYAQIA+L P+YGLYSSFVGA+ YSLFATSKDVCIGPVAVMSLQTAK
Sbjct: 122 GITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAK 181

Query: 194 VIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTG 253
           VI  V     ++Q                CGI++  +G+LRLGFLVELISLNAV GFMTG
Sbjct: 182 VIAEVLKKYPQDQ-TEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTG 240

Query: 254 SALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWW 313
           SA +II GQVPALMGY   VNTRE+TYKV+INTLKHLP+TK+DA+FGLIPLVILY WKWW
Sbjct: 241 SAFSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWW 300

Query: 314 FSSMGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPI 372
             + G  L +R+Y N                AMR+ ++I+V T+ISWS+TR K+  +RPI
Sbjct: 301 CGTYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPI 360

Query: 373 SILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQ 432
           SILGTVPSGL EVGV   P GLL+ ++ ELP+SIIVL+LEHIAI+KSFGR+NDYKVVPDQ
Sbjct: 361 SILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQ 420

Query: 433 ELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFF 492
           ELIAIG++NL+GTFF+SYP TGSFSRSALKAKCNV+TP SG+FTG CVLLALYCLT AFF
Sbjct: 421 ELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFF 480

Query: 493 YIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMC 552
           +IPKATLSAVIIHAVSDL+ SY+TTW+FWK NPLD + FI TVFITVF+SIE+GIYF MC
Sbjct: 481 FIPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMC 540

Query: 553 WSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYSTVLMNPXXXXXX 612
           WS AILL K AFPAG+FLG V++AEI+NP + ++   V           V +N       
Sbjct: 541 WSCAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAV-----------VSLNESNKQVK 589

Query: 613 XXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYE 672
                       +  KW+P+DH Y++E+N   ++ PPP GVIVYRL++SFTY+NCSR+Y+
Sbjct: 590 TTVDVLRSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYD 649

Query: 673 TLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPTTFDNK 732
            ++D VKE TR GQL+   KKSDRPWNDPG+WK P  L            ++E  +  N 
Sbjct: 650 IIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSVSNG 709

Query: 733 VVDT----RPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWV 788
             +     +P+LK+ICLDFSQVAQ DSTA+QSL+DLR+A+NKYADRQVEFHF+GI+SPW+
Sbjct: 710 STNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWI 769

Query: 789 KKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSY----YIH 844
           K+ L ++ FGTVN+EYSDES+I GH+S HV K    +++   T EE + ++ Y     + 
Sbjct: 770 KRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSS-DDDADYTDEESHISAPYSNYGTLC 828

Query: 845 AGTGTNFPFFHIEIPDFSKWNI 866
           A TGTN PFFHI+IPDFSKW+I
Sbjct: 829 AATGTNLPFFHIDIPDFSKWDI 850

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/799 (60%), Positives = 595/799 (74%), Gaps = 32/799 (4%)

Query: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131
           L   + VP Y E ++T+ +YY +S+R Y TFK+  +Y+ S+FPI  WLP YN  W ISDL
Sbjct: 64  LTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDL 123

Query: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191
           IAGIT+GCVLVPQSMSYAQIATL PQ+GLYSSF+GA++YSLFATSKDVCIGPVAVMSLQT
Sbjct: 124 IAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQT 183

Query: 192 AKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFM 251
           AKVI  V   L  +                 CGII+ GVGLLRLGFLVELISLNAV GFM
Sbjct: 184 AKVIARVQDKLPSDTDITASEIATTLALL--CGIIATGVGLLRLGFLVELISLNAVAGFM 241

Query: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311
           TGSALNIISGQVP LMGY SEVNTR +TYKVII+TLKHLPDTK+DA+FGLIPL +L+ WK
Sbjct: 242 TGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWK 301

Query: 312 WWFSSMGPKLVDRYYPNSXXXXXXXXXXXX---GNAMRSGIIIIVMTSISWSVTRGKSKS 368
           W    +GP+L +R++ N                    ++ IIIIV T ISW++TRGK+  
Sbjct: 302 WVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSE 361

Query: 369 ERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKV 428
            RPIS+LG+VP GL++V  FT P+GL+AK+APELP+SIIVLLLEHIAIAKSFGR+NDYK+
Sbjct: 362 TRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKI 421

Query: 429 VPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLT 488
           VPDQE++AIGI+NL+GTFF++YP TGSFSRSALKAKCNV+TPLSG+F+G+CVLLALYCLT
Sbjct: 422 VPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLT 481

Query: 489 GAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIY 548
           GAFFYIPKATL AVIIHAVS+L+ASYK T +FWKMNPLD  CF+ TV ITVFASIEDGIY
Sbjct: 482 GAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIY 541

Query: 549 FTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSDYLVEKAETSVQYSTVLMNPX 607
           F MCWS A+LLFKVAFP GKFLG ++I E+++ ++V DS  L    E S      ++   
Sbjct: 542 FAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENS-----EILPTT 596

Query: 608 XXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINC 667
                            Y+ KW+P+D +YTKE+NP+  + PPP GVIVYR+ +SFTY+NC
Sbjct: 597 KAGYSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNC 656

Query: 668 SRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPT 727
           SR+++ L+D++K  T+ G+L   ++KSDRPWNDPG W+P  F+            D++  
Sbjct: 657 SRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFI---KKYLRRENYDEDNV 713

Query: 728 TFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPW 787
             +++V+D RP LKIICLDFSQV+Q D+TA+Q L DLR+++NKYADRQVEFHF GI+SPW
Sbjct: 714 DIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPW 773

Query: 788 VKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAGT 847
           +KK L N GFGT+N EYSDESII+GH+SYH+ K  D                   I A T
Sbjct: 774 IKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD------------------GIKAAT 815

Query: 848 GTNFPFFHIEIPDFSKWNI 866
           GTN PFFHI+IP+F+KW+I
Sbjct: 816 GTNLPFFHIDIPNFNKWDI 834

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/857 (57%), Positives = 622/857 (72%), Gaps = 40/857 (4%)

Query: 45  LTKDSKFVFEKDLGYTDDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKS 104
           +T + K+   K L + D S       +L++   +P + E  +T KEYYNHS++ Y TF +
Sbjct: 66  VTSNPKYEEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNA 125

Query: 105 FGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSF 164
             NY +SIFPII WLPFYN+ W ISDLIAGITIGCVLVPQSMSYAQIATL PQYGLYSSF
Sbjct: 126 AKNYALSIFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSF 185

Query: 165 VGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCG 224
           +GA+ Y+LFATSKDVCIGPVAVMSL+TAKVI  V+S    +                 CG
Sbjct: 186 IGAFVYALFATSKDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALL--CG 243

Query: 225 IISAGVGLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVII 284
            I+A VG LRLGFLVELISLNAVTGFMTGSA NI+ GQVP LMGY+  VNTR+ATYKV+I
Sbjct: 244 GIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVI 303

Query: 285 NTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYP-NSXXXXXXXXXXXXGN 343
           +TLKHLPDTK+DA+FGLIPL ILY  KWW ++ G +L ++ +  N              N
Sbjct: 304 DTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTN 363

Query: 344 AMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELP 403
           AMR+ ++II+ T+ISWS+TR KS SERPI++LGTVPSGL+++GVF P   ++ K+ P+LP
Sbjct: 364 AMRNAVVIIIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLP 423

Query: 404 SSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKA 463
           +SIIVLLLEHIAIAKSFGR+NDYK+VPDQELIAIGISNL+GTFF++YP TGSFSRSAL A
Sbjct: 424 ASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNA 483

Query: 464 KCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKM 523
           KCNVKTPLSGIFTG CVLLALYCLTGAFFYIPKATLSAVIIHAVSDL+ASY+TT SFW M
Sbjct: 484 KCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNM 543

Query: 524 NPLDFICFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEI 583
           NPLD +CF+ TV ITVF+SIE+GIYF MC+S A+ +F+ AFPAGKFLG ++IAE++N   
Sbjct: 544 NPLDTLCFLVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATP 603

Query: 584 VDSDYLVEK---AETSVQYSTVLMNPX-----XXXXXXXXXXXXXXXXXYHIKWIPYDHA 635
            D D+ ++     ETS +Y+    +                        ++ KW+P+DH 
Sbjct: 604 KD-DFQMDNFNGFETS-EYNNFPADQSYGKFDIANKNTHKYNSPHCSKNFYTKWVPFDHT 661

Query: 636 YTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSD 695
           YTKE+N +VE+  PP GVIVYRL++SF Y+NCSR+++T++D+VK  T+ G+ + +IKKS 
Sbjct: 662 YTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQ 721

Query: 696 RPWNDPGDWKPPKFLX----------XXXXXXXXXXXDDEPTTFD---NKVVDT--RPIL 740
           RPWNDPG+W+ P ++                      +D  T  D   NK +D   RP+L
Sbjct: 722 RPWNDPGEWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVL 781

Query: 741 KIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTV 800
           ++ICLDFSQV+QTD+TALQSL DLR+++N YADRQVEFHF GI+SPWVK+GL+ LGFGTV
Sbjct: 782 QVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTV 841

Query: 801 NKEYSDESIIIGHTSYHVVKTEDLENNPMTT-----------VEEPNQNSSYYIHAGTGT 849
           N+ YSD S I+GH SYH+VK     N   ++           +E  + N +Y I A +GT
Sbjct: 842 NEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYN-NYSIEAASGT 900

Query: 850 NFPFFHIEIPDFSKWNI 866
           N+PFFHI+IP+FSKW++
Sbjct: 901 NYPFFHIDIPNFSKWDV 917

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/800 (61%), Positives = 597/800 (74%), Gaps = 17/800 (2%)

Query: 77  NVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGIT 136
           N+P + E TV++K+YYN  IR  LT  S G+Y+ S+FPI+KW P YN  W  +DL+AGIT
Sbjct: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134

Query: 137 IGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQ 196
           +GCVLVPQSMSYAQIA+LPPQYGLYSSF+GA+ YSLFATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 197 HVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSAL 256
            V++   E                  CGI++ GVGLLRLGFLVELISLNAV GFMTGSA 
Sbjct: 195 QVSAKYPENDPIVTAPVIATALSLL-CGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAF 253

Query: 257 NIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSS 316
           NI+ GQVPALMGY+S+VNTR +TYKV+I++LKHLPDTK+DA+FGL+PL +LY WKWW  +
Sbjct: 254 NILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGT 313

Query: 317 MGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISIL 375
            GPKL DR   +S              NAMR+ +IIIV T+ISW +T+ K K  RPI +L
Sbjct: 314 YGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373

Query: 376 GTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELI 435
           GTVPSGL++VGV   P GLLAK+AP++P+SIIVLLLEHIAI+KSFGR+NDYKVVPDQELI
Sbjct: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433

Query: 436 AIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIP 495
           AIG +NLIGTFFN+YP TGSFSRSALKAKC V+TP SG+FTG CVL+A+YCLT AFF+IP
Sbjct: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493

Query: 496 KATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSA 555
            ATLSAVIIHAVSDL+ASYKTTW+FWKMNPLD   FI TV ITVF+SIE+GIYF MCWS 
Sbjct: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553

Query: 556 AILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLV---EKAETSVQYSTVLMNPXXXXXX 612
           A+LL K AFPAG+FLG V++AE++NP +V+    +   ++ E SV  S  L         
Sbjct: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSL-----KADK 608

Query: 613 XXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYE 672
                       +H KW+   +AY +E+NP+V++ PPP GV+VYR+++SFTYINCSR+Y+
Sbjct: 609 GAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYD 668

Query: 673 TLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWK----PPKFLXXXXXXXXXXXXDDEPTT 728
           T++D +K+ TR GQL+   KKSDRPWNDPG+W+      KF              DE   
Sbjct: 669 TIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVA 728

Query: 729 FDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWV 788
            DN   D RP+LKIICLDFSQV Q DSTA+QSL+DLR+A++KYADRQVEFHF+GI+S WV
Sbjct: 729 IDN-TRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWV 787

Query: 789 KKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTT--VEEPNQNSSYYIHAG 846
           K+ L+++GFGTVN  YSDESII GH+SYH+ KT     +  TT          S  I+A 
Sbjct: 788 KRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAA 847

Query: 847 TGTNFPFFHIEIPDFSKWNI 866
           TGTN PFFH++IPDFSKW++
Sbjct: 848 TGTNMPFFHLDIPDFSKWDL 867

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/867 (57%), Positives = 619/867 (71%), Gaps = 57/867 (6%)

Query: 48  DSKFVFEKDLGYTDDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGN 107
           D+K  FE+ +  TD+S      ++   S ++P Y E+T+TLK+YY+ ++R Y T+ S  +
Sbjct: 34  DTKKYFERSI--TDNS------TYGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVD 85

Query: 108 YLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGA 167
           Y+ S+FP++ WLPFYN KW +SDLIAGIT+G VLVPQSMSYAQIATLPP+YGLYSSF+GA
Sbjct: 86  YIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGA 145

Query: 168 YTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIIS 227
             YS FATSKDVCIGPVAVMSLQTAKVI  V      +                 CGII+
Sbjct: 146 LVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEK-HPDLDPSITGPIIATVLAFICGIIA 204

Query: 228 AGVGLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTL 287
            GVGLLRLGFLVELISLNAV GFMTGSA NII GQ+P LMGY+ +VNTR +TY V+I++L
Sbjct: 205 TGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSL 264

Query: 288 KHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXXXG---NA 344
           KHLPDTK+DA FGLIPL  L+FWKWW +SMGPKL DRY+P +                 A
Sbjct: 265 KHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQA 324

Query: 345 MRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPS 404
            R+GIIII+ T++S+ +T+G +K +R IS+LGTVP GL+  GV   P+G+L  +A E+PS
Sbjct: 325 SRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPS 384

Query: 405 SIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAK 464
           SIIVLLLEHIAI+KSFGRVNDYK+ P+QE+IAIG+SNL+GTFFN+YP TGSFSRSALKAK
Sbjct: 385 SIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAK 444

Query: 465 CNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMN 524
           CNV TPLSGIF+ +CVLLA+YCLTGAFFYIPKATLSAVIIHAV DL+ASY TTWS WKMN
Sbjct: 445 CNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMN 504

Query: 525 PLDFICFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIV 584
             DFI FITTVFITVF+SIE+GIYF +CWS AILL+  AFPAGKFLG ++IAE+VNP+IV
Sbjct: 505 VFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIV 564

Query: 585 -DSDYLVEKAETSVQYSTVLMNPXXXXXXXXXXX----------------------XXXX 621
            D D+  E +  S     +  +                                      
Sbjct: 565 DDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSS 624

Query: 622 XXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKEL 681
              Y+ KW+P+DHAY+KE+NP+V +TPPP GVIVYRL++S+TYINCSR+Y+ ++D++K +
Sbjct: 625 DIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRV 684

Query: 682 TRPGQLMTHIKKSDRPWNDPGDWKPP---KFLXXXXXXXXXXXXDDEPTTFDNKV----- 733
           TR GQL+ H  K DRPWNDPG+W+ P   KF               +  TF+N+      
Sbjct: 685 TRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFFNVKKFVSVFKRKVTDVDTFENENEIEHI 744

Query: 734 ----------VDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGI 783
                      D RP+L+++CLDFSQVA TD+TALQSL DLR+A+NKYADRQVEFHF GI
Sbjct: 745 HDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGI 804

Query: 784 LSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLEN---NPMTTVE-EPNQNS 839
            SPW+K+GL NLGFGT N+EYSDESII GH+SYH+ +  + E    N + ++E + N  S
Sbjct: 805 YSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGS 864

Query: 840 SYYIHAGTGTNFPFFHIEIPDFSKWNI 866
              + A +GTN PFFH++IPDFSKW+I
Sbjct: 865 KTKVLAASGTNLPFFHVDIPDFSKWDI 891

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/836 (57%), Positives = 596/836 (71%), Gaps = 41/836 (4%)

Query: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131
           +NSS ++P Y E+ VT+K++Y   I  Y +      YL S+FP++KWLP YN  WLI DL
Sbjct: 58  VNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDL 117

Query: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191
           IAGIT+GCVLVPQSMSYAQIATL PQYGLYSSF+GA+ YS FATSKDVCIGPVAVMSLQT
Sbjct: 118 IAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQT 177

Query: 192 AKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFM 251
           AKVI+ V S LT +++               CGIIS G+G LRLGFL+E ISLNAV GFM
Sbjct: 178 AKVIERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFM 237

Query: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311
           TGSA NII GQVPALMGY  +VNTR +TY+V+INTLKHLPDTK+DA+FGLIPL ILY  K
Sbjct: 238 TGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCK 297

Query: 312 WWFSSMGPKLVDRYYPNSXXXXXXXXXXXX-------GNAMRSGIIIIVMTSISWSVTRG 364
           W+FSS+GP+ +++                         NAMR+G++IIV T+ISW++TRG
Sbjct: 298 WFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRG 357

Query: 365 KSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVN 424
           KS +  PISILGTVP GL+EV VF  P GL  K+AP+LPSSII+LLLEHIAI+KSFGRVN
Sbjct: 358 KSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVN 417

Query: 425 DYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLAL 484
           DYK+VPDQELIAIG++NLIGTFF +YP TGSFSRSALKAKC+VKTPLSG+F+G+CVLLAL
Sbjct: 418 DYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLAL 477

Query: 485 YCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIE 544
           YCLTGAF+YIPKATLSAVIIHAVSDL+ASYKTT +F+KMNPLDF+CFITTVFITVF+SIE
Sbjct: 478 YCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIE 537

Query: 545 DGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLV-------------E 591
            GIYF +C+S A L+FK  FP G FLGY+KIAE++NP +  +DY +              
Sbjct: 538 YGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENT 597

Query: 592 KAETSVQYSTVLMNPXXXXXX-------XXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNV 644
           K ++         NP                         Y+++W+P  + Y +E+NP +
Sbjct: 598 KDDSVKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLI 657

Query: 645 EVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDW 704
           ++TPPP G+IVYR  +SFTY+NCSR+Y+ +YD+VK+ TR G    + +K DRPWND G+W
Sbjct: 658 KITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEW 717

Query: 705 KPPK--FLXXXXXXXXXXXXDDEPTTFDNKV--------VDTRPILKIICLDFSQVAQTD 754
           + PK                 DE    +  +         D +P LKIIC DFSQV QTD
Sbjct: 718 ECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTD 777

Query: 755 STALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHT 814
           +TA+QSL DLR+A+N+Y+++Q+E+HFSGI+S WVKK L+ +GFGTVN  YSD+SIIIGH 
Sbjct: 778 ATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQ 837

Query: 815 SYHVVKTEDLENNPMTTVEE----PNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866
           SYHV K  + E+     + E    P+ +  Y+I   TGTN+PFFHI+IPDFS W +
Sbjct: 838 SYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/798 (58%), Positives = 590/798 (73%), Gaps = 18/798 (2%)

Query: 75  SENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAG 134
           S  VP Y E  V  K+ Y+  +R YLTF +   YL S+FP++KW+  YN+ WL +DL+AG
Sbjct: 106 SLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAG 165

Query: 135 ITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKV 194
           IT+GCVLVPQSMSYAQIATLP QYGLYSSFVGA+ YS FATSKDVCIGPVAVMSL+TAKV
Sbjct: 166 ITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKV 225

Query: 195 IQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGS 254
           I  V   + E+                 CG ++ GVGLLRLGFLVE ISLNAV GFMTGS
Sbjct: 226 IARVLEKVGEDNPEITAPIIATTLSLI-CGGVALGVGLLRLGFLVEFISLNAVAGFMTGS 284

Query: 255 ALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWF 314
           A+NI+SGQVP LMGY+  VNTR++TYKVIINTLKHLPDTK+DA+FGLIPL ILY WK++ 
Sbjct: 285 AINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFC 344

Query: 315 SSMGPKLVDRYYPNSXXXXXXXXXXXXG--NAMRSGIIIIVMTSISWSVTRGKSKSERPI 372
            ++GPKLVDRY   S                A+R+  +II+ T ISW +TR K+K + PI
Sbjct: 345 GTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLISWGITRHKAKEDLPI 404

Query: 373 SILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQ 432
           S+LGTVPSGL+ VGV   P+GL++ +A ELPS+II+L+LEHIAI+K+FGRVN YKVVPDQ
Sbjct: 405 SLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPDQ 464

Query: 433 ELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFF 492
           ELIAIG++NLI TFFN+YP TGSFSRSALKAKCNVKTPLSGIFTG+CVLL+LYCLT AF+
Sbjct: 465 ELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAFY 524

Query: 493 YIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMC 552
           +IPKA LSA+IIHAVSDLVASYKTTW+FW MNPLDF+CFI TV IT+F+SIE+GIYF +C
Sbjct: 525 FIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAVC 584

Query: 553 WSAAILLFKVAFPAGKFLGYVKIAEIVNPEI---VDSDYLVEKAE-TSVQYSTVLMNPXX 608
           WS A+LL KV FP G+FLGYV+I ++ N E+   +D   L E ++  +++ +    N   
Sbjct: 585 WSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRIVLSEDSQPKTIEDNVTKNNTAV 644

Query: 609 XXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCS 668
                           YH KW+P ++ Y +E+NP+V V  PP GVIVYR +ES+TY+NCS
Sbjct: 645 KVGVVANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCS 704

Query: 669 RNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPTT 728
           R Y+T++D+VKELTRPG+L+ H+ K D+ WNDPG+W+PP  +            +     
Sbjct: 705 RQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVKKLFKLGNKHDLE----- 759

Query: 729 FDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWV 788
              +V+D RP+LKI+ +D+SQV Q DST +Q+L+DLR+AINKYA+RQVEFHFSGI+SPW+
Sbjct: 760 -GGEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWI 818

Query: 789 KKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAGTG 848
           K+ L+N GFGTVN+E+SDESII+GHTSY +VK      +P   + EP       +H   G
Sbjct: 819 KRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALPEP-----IALHTALG 873

Query: 849 TNFPFFHIEIPDFSKWNI 866
            N PFFH+E+P+F KW++
Sbjct: 874 VNLPFFHLEMPEFHKWHL 891

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/793 (58%), Positives = 594/793 (74%), Gaps = 20/793 (2%)

Query: 78  VPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITI 137
           +P Y E+TV  K+YY+ S+   ++F SF  YLIS+FP+I+W+P YN+ W+  D++AG+T+
Sbjct: 86  IPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGVTV 145

Query: 138 GCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQH 197
           GCVLVPQSMSYAQIA+LP QYGLYSSF+GA+ YS FATSKDVCIGPVAVMSL+TAKVI  
Sbjct: 146 GCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 205

Query: 198 VNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALN 257
           V   L ++ +               CG I+ G+G+LRLGFLVELISLNAV GFMTGSA +
Sbjct: 206 VTEHLPDDTEITGPIIATALSLL--CGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFS 263

Query: 258 IISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSM 317
           II+GQ+PALMGY  +VNTR+ TYKV+INTLKHLPDTK+DA+FGLIPL+ILY WK+  +++
Sbjct: 264 IITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTI 323

Query: 318 GPKLVDRYY-PNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILG 376
           GP  VDR   P+S              A+R+  +I++ T I+W +TR K K   PIS+L 
Sbjct: 324 GPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKK--HPISLLN 381

Query: 377 TVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIA 436
           TVPSGL+ VGV   P+ L   +APELP++ I+LLLEHIAIAK+FGR+NDYKVVPDQELIA
Sbjct: 382 TVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQELIA 441

Query: 437 IGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPK 496
           IG++NL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+FTG+CVLLALYCLT AF+YIPK
Sbjct: 442 IGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPK 501

Query: 497 ATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAA 556
           ATLSAVIIHAVSDL+ASY+TTW+FWKMNPLD +CF+ TVFIT+F+SIE+GIYF +CWS A
Sbjct: 502 ATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCA 561

Query: 557 ILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAET-SVQYSTVLMNPXXXXXXXXX 615
           ILLFK+AFP+GKFLG V+++E++NP + +   +VE  ++ ++  ++              
Sbjct: 562 ILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSADNSS 621

Query: 616 XXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLY 675
                    +H KWIP ++ Y +E N  + V PPP GVIVYR +ES+TYINCSR Y+ ++
Sbjct: 622 ISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIF 681

Query: 676 DKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPTTFDNKVVD 735
           D+VK LTR G ++ H KKSDRPWNDPG W+PP FL            +  P        D
Sbjct: 682 DEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFKRGKRLEQELSPELGR----D 737

Query: 736 TRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNL 795
            RP+LKI+ +D+SQV Q D+T +Q+L+DLR+AINKYADRQVEFHFSGI+SPW+K+ LV +
Sbjct: 738 ERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAV 797

Query: 796 GFGTVNKEYSDESIIIGHTSYHVVKT--EDLENNPMTTVEEPNQNSSYYIHAGTGTNFPF 853
           GFGTVN E++DES+I+GH+SYH+VKT  +D EN+             Y I A +GTN PF
Sbjct: 798 GFGTVNDEFADESLILGHSSYHIVKTRPQDEENHI--------GQGRYNISAASGTNMPF 849

Query: 854 FHIEIPDFSKWNI 866
           FH+E+PDFSKW++
Sbjct: 850 FHVEMPDFSKWSL 862

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/831 (56%), Positives = 586/831 (70%), Gaps = 66/831 (7%)

Query: 77  NVP----RYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLI 132
           NVP     + E  VT+ E+Y+ ++R   T  +F NYL S+ PI++WLP YN +WL  DL+
Sbjct: 93  NVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLV 152

Query: 133 AGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTA 192
           AGIT+GCVLVPQSMSYAQIATL PQYGLYSSFVGA+ YS FATSKDVCIGPVAVMSLQTA
Sbjct: 153 AGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTA 212

Query: 193 KVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMT 252
           K I HV SSL E+ +               CGIIS G+G+LRLGFLVELIS  AV GFMT
Sbjct: 213 KAISHVVSSLPEDTEITSPMIATALALL--CGIISLGLGVLRLGFLVELISSTAVAGFMT 270

Query: 253 GSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKW 312
           GSALNII+GQVPALMGY   VNTR +TYKVIIN+L+HLPDTK+DA+FGL+PLVILY WKW
Sbjct: 271 GSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKW 330

Query: 313 WFSSMGPKLVDRYYPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRG--KSKSER 370
             S+ GP+LV RY   S              A+R+ ++I+V T+I+W ++    K     
Sbjct: 331 GCSTGGPRLVQRY--GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSA 388

Query: 371 PISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVP 430
            IS+LGTVPSGL++VGV   P+GLL+K+APELP+S+IVL+LEHIAI+K+FGRVNDY+VVP
Sbjct: 389 RISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVP 448

Query: 431 DQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGA 490
           DQELIAIG +NLIGTFFN+YP TGSFSRSALKAKCNV TPLSG+F+G+CVLLA+YCLT A
Sbjct: 449 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSA 508

Query: 491 FFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFT 550
           F +IPKATLSAVIIHAVSDL+ASYKTTWSFW+++P D +CF+ TV ITVF+SIE+GIYF 
Sbjct: 509 FKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFA 568

Query: 551 MCWSAAILLFKVAFPAGKFLGYVKIAE--IVNP---------------EIVDSDYLVEKA 593
           MCWS A+LLF+ AFPAGKFLG V+IAE  + N                  V+ +   E  
Sbjct: 569 MCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNREKERETT 628

Query: 594 ETSVQYSTVLMN---PXXXXXXXXXXXXXXXXXXYHI-------------KWIPYDHAYT 637
            T+V  S+  ++   P                   H+             KW+P+D  YT
Sbjct: 629 FTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YT 687

Query: 638 KEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRP 697
           +E+NP V V PPP GVIV+R +ES+TY+NCSR Y+ ++D+V  LTR G+     K S RP
Sbjct: 688 RELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRP 747

Query: 698 WNDPGDWKPPKFLXXXXXXXXXXXXDDEPTTFDNKVV--DTRPILKIICLDFSQVAQTDS 755
           WNDPG+W PPKFL                   +N+ V  D RP+L++I +D+SQVAQ DS
Sbjct: 748 WNDPGEWHPPKFL--------RKLFKSSSEDLENRAVARDERPVLRVIAMDWSQVAQVDS 799

Query: 756 TALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTS 815
           T LQ+L DLR+A+NKYADRQVEFHF+GI+ PWVK+GL+N GFGTVN E++DES+++GH S
Sbjct: 800 TGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKS 859

Query: 816 YHVVKTEDLENNPMTTVEEPNQN-SSYYIHAGTGTNFPFFHIEIPDFSKWN 865
            H+ ++            EP ++  S   H  TGTN PFFH+E+PDFS+W+
Sbjct: 860 CHIARS-----------AEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/845 (55%), Positives = 594/845 (70%), Gaps = 46/845 (5%)

Query: 54  EKDLGYTDDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIF 113
           E +L Y + +N  T  + L     VP Y E  V   + + H ++  +T  +  +Y  S F
Sbjct: 76  ETELEYWNSTNGTT--NLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAF 133

Query: 114 PIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLF 173
           PIIKWLPFYN+KW  +DL+AGIT+GCVLVPQSMSYAQIATLPPQYGLYSSFVGA+ YS F
Sbjct: 134 PIIKWLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFF 193

Query: 174 ATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLL 233
           ATSKDVCIGPVAVMSL+TAKVIQ       +E                 CGI++ G G+L
Sbjct: 194 ATSKDVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALL-CGIVAMGAGVL 252

Query: 234 RLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDT 293
           RLGFLVELISLNAV GFMTGS+LNIISGQVPALMG+   V+TR++TYK+IIN+LK+L  T
Sbjct: 253 RLGFLVELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHT 312

Query: 294 KIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNS-XXXXXXXXXXXXGNAMRSGIIII 352
           ++DA+FGLIPLV+LY WKWW SS GPKL DR++ N+               AMRS +III
Sbjct: 313 QLDAVFGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIII 372

Query: 353 VMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLE 412
           V T+IS+ +T+G+ K+ R IS+LG VP GL++V V   P GLL+K+   +PS+II+LLLE
Sbjct: 373 VFTAISYGITKGR-KTPR-ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLE 430

Query: 413 HIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLS 472
           HI+IAKSFGRVN+YKVVPDQELIAIG +NLIGTFFN+YP TGSFSRSALKAKCNV+TPLS
Sbjct: 431 HISIAKSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLS 490

Query: 473 GIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFI 532
           G+F+G+CVLLALYCLT  F+YIP ATLSAVIIHAVSDL ASYKT+W+F+KMNP DFI FI
Sbjct: 491 GVFSGACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFI 550

Query: 533 TTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVE- 591
            TVFITVF+SI+ GIYF MCWSAA+ L K  F  G+FLG V++AE+VN ++   D  VE 
Sbjct: 551 VTVFITVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQV---DPNVES 607

Query: 592 ------------KAETSVQYSTVLMNPXXXXXXXXX-------------XXXXXXXXXYH 626
                       +A++S++ S+  ++P                               YH
Sbjct: 608 VSESAGSHLDGFQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYH 667

Query: 627 IKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQ 686
            KWI YD +Y++E NP V + PPP GVIVYR  +S+TY+NCSR+Y+ +YD+V+  TR GQ
Sbjct: 668 TKWISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQ 727

Query: 687 LMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXX-----XXDDEPTTFDNKVVDTRPILK 741
           +++ +KK DRPWNDPG+W+ P++                    E    + K+ D RP+LK
Sbjct: 728 MISAVKKVDRPWNDPGEWEAPRWFKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLK 787

Query: 742 IICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVN 801
           IICLDFSQ +QTD+TA+Q+L DLR+ +N+YADRQVEFH  G+ +PWVK+ LVN GFGTVN
Sbjct: 788 IICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVN 847

Query: 802 KEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDF 861
           +EYSDES++ GH SYHV +       P +  +     + Y ++  +GTN PFFH+EIPDF
Sbjct: 848 EEYSDESLLAGHRSYHVARA------PTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDF 901

Query: 862 SKWNI 866
           SKW++
Sbjct: 902 SKWDL 906

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/804 (57%), Positives = 570/804 (70%), Gaps = 45/804 (5%)

Query: 81  YIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCV 140
           Y E+ VT +EYY+ +IR  LT  +   YL  + P+I WLP YN +W   D++AGIT+GCV
Sbjct: 81  YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCV 140

Query: 141 LVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNS 200
           LVPQSMSYA IATLPPQ+GLYSSFVGA  YS FATSKDVCIGPVAVMSLQTAK +  V +
Sbjct: 141 LVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMA 200

Query: 201 SLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNIIS 260
            L  +                 CG+IS G+G+LRLGFLVELIS  AV GFMTGSALNIIS
Sbjct: 201 ELPADTDITAPVVATALAFL--CGLISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIS 258

Query: 261 GQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPK 320
           GQ+PALMGY   VNTR +TYKVII TLKHLPDTK+DA+FGLIPLV+LY WKW  +S GP+
Sbjct: 259 GQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPR 318

Query: 321 LVDRY-YPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVP 379
           LV+RY    S              A+R+ +IIIV T+I+WS++  K K+  PIS+LG VP
Sbjct: 319 LVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA--PISLLGPVP 376

Query: 380 SGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGI 439
           SGL++VGV   P+GL AK+APELP+S+IVLLLEHIAIAK+FGRVNDY+VVPDQELIAIG 
Sbjct: 377 SGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGA 436

Query: 440 SNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATL 499
           +NL+GTFFN+YP TGSFSRSALKAKCNV TPLSG+F+G+CVLLA+YCLT AF YIPKATL
Sbjct: 437 TNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATL 496

Query: 500 SAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAAILL 559
           SAVIIHAVSDL+ASYKTTWS W++NPLD +CF+ TVFI VF+SIE+GIYF MCWS A+LL
Sbjct: 497 SAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLL 556

Query: 560 FKVAFPAGKFLGYVKIAEIVNPEIVDS---------DYLVEKAETSVQYSTVLMNPXXXX 610
           FKVAFP  +FLG V+IAE+   E V +         D+  EK +  V Y++  ++     
Sbjct: 557 FKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDF--EKGK-GVSYASGSVSSESFN 613

Query: 611 XXXXXXXXXXX---------XXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTES 661
                                  +H KW+P++  YT+E+NP V V  PP GVIV+R +ES
Sbjct: 614 AKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQPPPGVIVFRPSES 672

Query: 662 FTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXX 721
           +TY+NC+R Y  ++D+V   TR G++     KS RPWNDPG+W PPKFL           
Sbjct: 673 WTYVNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPPKFLRKWFGKKYSES 731

Query: 722 XDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFS 781
            +         V D RP+L++I +D+SQVAQ DST LQ+L DLR+A++KYADRQVEFHFS
Sbjct: 732 LE------QGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFS 785

Query: 782 GILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSY 841
           GI+SPW+K+GL+N GFGTVN+E++DES+++GH +Y V +         T  EE     + 
Sbjct: 786 GIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVAR------GGATGDEE-----AL 834

Query: 842 YIHAGTGTNFPFFHIEIPDFSKWN 865
                TG N PFFH E+PDFSKW+
Sbjct: 835 LPQPATGVNMPFFHAEMPDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/798 (54%), Positives = 564/798 (70%), Gaps = 33/798 (4%)

Query: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131
           +NS E VP Y E  V++K+YYN+ +R +++  +  +Y +S+FP+ +W+  YN  W+ +D+
Sbjct: 77  VNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADM 136

Query: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191
           +AGIT+GCVLVPQSMSYAQ+A+L PQYGLYSSFVGA+ YS FATSKDVCIGPVAVMSL+T
Sbjct: 137 VAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLET 196

Query: 192 AKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFM 251
           AKVI  V  +L E+                 CG I+  +G+LRLGFLVE IS+ AVTGFM
Sbjct: 197 AKVIARVTENLPEDTNITGPIIATALTLL--CGAIAMVIGILRLGFLVEFISITAVTGFM 254

Query: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311
           TGSAL+IISGQVP+LMGY+ +VNTR  TYKVII +LKHL DT ++A FGL+PLV+L+ WK
Sbjct: 255 TGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWK 314

Query: 312 WWFSSMGPKLVDRYYP-NSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSER 370
           W   S+GP+LVDRY                   A+R+ +II+V T+ISW ++R K + + 
Sbjct: 315 WICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KP 373

Query: 371 PISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVP 430
           PIS+LG VPSGL+ VG    P GL+ K+ PELP++ I+LLLEHIAIAKSFGR+N+YKVVP
Sbjct: 374 PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVP 433

Query: 431 DQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGA 490
           DQELIAIG++NL  TFFN+YP TGSFSRSALKAKCNVKTPLSG+FTG+CVLLALYCLT A
Sbjct: 434 DQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEA 493

Query: 491 FFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFT 550
           F++IPKATLSAVIIHAV+DL+ASYK TW FW+ NPLDF  FI TV ITVF+SIE GIYF+
Sbjct: 494 FYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFS 553

Query: 551 MCWSAAILLFKVAFPAGKFLGYVKIAEIVNPE---IVDSDYLVEKAETSVQYSTVLMNPX 607
           + WS A+LL KVAFP GKFLGY+ +AE++ P     ++S+  +   + S  +  +  +  
Sbjct: 554 ISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQI--DKD 611

Query: 608 XXXXXXXXXXXXXXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINC 667
                            +H +WIP DHAY++E+NP   V PPP GVIVYR T+S+TY+NC
Sbjct: 612 GGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNC 671

Query: 668 SRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPT 727
           SR+++ + D VKE TRPGQL+ H+   +R W DPG W+PP+               D+ T
Sbjct: 672 SRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFIA--------DKRT 723

Query: 728 TFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPW 787
              + V D RP+L+++ +D+SQV+Q DST +Q+L+DLR A+NKYADR VEFHF+GI+SPW
Sbjct: 724 --GSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPW 781

Query: 788 VKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAGT 847
           +K+ LVN GFG      +D  +I    SYH+V+   L  +P      P+    + +    
Sbjct: 782 IKRALVNTGFGI-----ADPPLISSRVSYHLVR---LPADP------PHIVHGHSVVFAL 827

Query: 848 GTNFPFFHIEIPDFSKWN 865
           GTN PFFH+++PDF  W 
Sbjct: 828 GTNTPFFHLDMPDFETWR 845

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/849 (50%), Positives = 570/849 (67%), Gaps = 64/849 (7%)

Query: 54  EKDLGYTDDSNELTRESFLNSSEN----------------VPRYIEETVTLKEYYNHSIR 97
           E   GY+   NE +R    +S  +                 P Y E TVT  EYY+ +IR
Sbjct: 54  EDSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIR 113

Query: 98  HYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQ 157
             +    F +Y +S+FPIIKW+  YN+ W+ SD IAGIT+GCVLVPQSMSYAQ+A L P+
Sbjct: 114 SRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPE 173

Query: 158 YGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXX 217
           YGLYSSF+GA+ YS FATSKDVCIGPVAVMS+Q +KVI HV   L E             
Sbjct: 174 YGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASAL 233

Query: 218 XXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTRE 277
                  +I   +GLLRLGF++ELIS+ AV GFMTGSAL+I++ Q+P+L+G   ++NTR 
Sbjct: 234 ALFSSILVIP--IGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLG-IQKINTRV 290

Query: 278 ATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYY-PNSXXXXXXX 336
            TY+V+I+TLKHL  + I+A FGLI L +L+FWKW    +GPKL+ +Y  PNS       
Sbjct: 291 ETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQ 350

Query: 337 XXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLA 396
                  A+R+  ++ + T +SW V  G+ K +  IS+LGTVPSGL+ VGV T P+GL+ 
Sbjct: 351 SFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVH 409

Query: 397 KVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSF 456
           K+ P+LP ++I+LLLEHI IAKSFGR+N+YK+VPDQELIAIG++NLIG+FFN+YP TGSF
Sbjct: 410 KLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSF 469

Query: 457 SRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKT 516
           SRSALKAKCNVKTPLSG+F+G+CVLLALY LT AF+YIPKA LSAVIIHAV DL+ASYK 
Sbjct: 470 SRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKL 529

Query: 517 TWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIA 576
           ++  W  NP D I F+ T+ +T+F+SIE+GIYF + +S A LL K AFP+GKFLGYVKI 
Sbjct: 530 SFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT 589

Query: 577 EIVN-----------------PEIVDSDYLVEKAETSVQYSTVLMNPXXXXXXXXXXXXX 619
           E+ N                 P+ +  D  + K +  V  S  LM               
Sbjct: 590 EVSNLNVFEDLDSIGNNDPELPQEISKDSKLAK-DPDVHASANLM-------------AS 635

Query: 620 XXXXXYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVK 679
                +H KW+P D+ Y++E+NP + V  PP GVIVYR TES+ Y+NCSR ++ + D+VK
Sbjct: 636 KLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVK 695

Query: 680 ELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPTTFDNKVVDTRPI 739
            LTRPG+L+ H++KS++ W +PGDW PP FL              E      + VD RP+
Sbjct: 696 TLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVV----EQVDNRPV 751

Query: 740 LKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGT 799
           LKI+ +D++QV   DST++QSL+DLR+ IN+YADRQV FHFSGI+SPW+K+ LV+ GFGT
Sbjct: 752 LKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGT 811

Query: 800 VNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNS--SYYIHAGTGTNFPFFHIE 857
           +N+ YS++ +++ +++YHVV+      N ++  EE  QNS  S  +   +GTNFPFFHI+
Sbjct: 812 INENYSNDPLLLKYSTYHVVQ------NVLSADEENQQNSEISASLDVASGTNFPFFHID 865

Query: 858 IPDFSKWNI 866
           +PDF+KW+I
Sbjct: 866 MPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  494 bits (1272), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 346/507 (68%), Gaps = 23/507 (4%)

Query: 81  YIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCV 140
           Y E+ VTL E +NH +    T++S   YL+S+ PI KW+  YN +W ISD+IAGIT+GCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 141 LVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNS 200
           LVPQSMSYAQIATL PQYGLYSS +G + Y++FATSKD+CIGPVA+MSLQTAK I HV+ 
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVH- 121

Query: 201 SLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNIIS 260
               ++                CG I+ G+G+LRLGF ++LI + AV GF +GSA NI+ 
Sbjct: 122 ----QKHPDIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILW 177

Query: 261 GQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPK 320
           GQ+P LMGY+ +VNTR+ TYKV+++TLK LP T I+A+ GLIPL  L+ WK+       +
Sbjct: 178 GQIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDYALRR 237

Query: 321 LVDRYYPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPS 380
              + +P                ++R  I+II+ ++ ++     K+ S   + +LG +P 
Sbjct: 238 GNLKPWPKRIVFYLL--------SLRVTIVIIICSAAAYG---AKNPS---LKVLGKIPK 283

Query: 381 GLQEVG---VFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAI 437
           G        + + P+ L++ +  E+P+S+IVL+LEH++IAKSF RVN+Y+V  DQEL AI
Sbjct: 284 GFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAI 343

Query: 438 GISNLIGT-FFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPK 496
           G+SN++G     +YPVTGSFSR+ALKA+C V+TPL  IF+G CV++A+  LT A  +IPK
Sbjct: 344 GVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPK 403

Query: 497 ATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAA 556
           ATLSAVIIHAVS L++SYK T   +KM PLD + F+ T+FITVF+ IE G+YF +CW+  
Sbjct: 404 ATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACF 463

Query: 557 ILLFKVAFPAGKFLGYVKIAEIVNPEI 583
           +L+ ++AFP G FLGYV++ EI    I
Sbjct: 464 LLMIRIAFPYGAFLGYVRVREISRSSI 490

 Score =  193 bits (490), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 122/183 (66%), Gaps = 15/183 (8%)

Query: 626 HIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPG 685
            I WIPY H +T+E+NP+V++ PPP GV+VYR ++S TYINCSRNY+ + D +K+ T+PG
Sbjct: 685 EIIWIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPG 744

Query: 686 QLMTHIKKSD----RPWNDPGDWKPPKFLXXXXXXXXXXXXDDEPTTFDNKVVDTRPILK 741
           ++      SD    +PWN+PG W+ PK               D       ++ D RP L+
Sbjct: 745 EIDV---LSDALYVKPWNNPGPWEKPKL--------KFWEHADPEIARKKRMADKRPTLR 793

Query: 742 IICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVN 801
           I+CLDFSQVAQ DSTALQ+L+DLR  +N Y    VE+HF GI+SPWV++ L+ +GFG +N
Sbjct: 794 ILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKIN 853

Query: 802 KEY 804
           KE+
Sbjct: 854 KEF 856

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 114/464 (24%), Positives = 198/464 (42%), Gaps = 60/464 (12%)

Query: 107 NYLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVG 166
           +Y+    PI+KW P Y+ K L  DL+AGI++    +P ++S + +A + P  GL+S  + 
Sbjct: 42  SYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVIP 101

Query: 167 AYTYSLFATSKDVCIGPVAVMSL---QTAKVIQH--VNSSLTEEQKXXXXXXXXXXXXXX 221
              Y++F +   + +GP  V+SL   Q+ +   H  V+S +T                  
Sbjct: 102 PLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHKSVDSLVT------------VAVIAC 149

Query: 222 XCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA-LNIISGQVPALMG---YASEV---N 274
             G I   +GL R+GF+   IS   + GF+   A + +I+  +P L     Y  EV   N
Sbjct: 150 TSGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGN 209

Query: 275 TREATYKVIINTLKHLPD------TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPN 328
               T+      LK+ P+       K+  I   I +V  Y  K++    G KL  R++P+
Sbjct: 210 AGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKYFTEKRGSKLC-RFFPD 268

Query: 329 SXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVF 388
                         N               WS T G         I+G +P        F
Sbjct: 269 LLLVVAGFIYLSYYN--------------DWSSTMGTR-------IIGNLPPNKNH---F 304

Query: 389 TPPNGLLAKVAPELPSSIIVLLLEHIAIAKSF---GRVNDYKVVPDQELIAIGISNLIGT 445
             P     +       S +V +L     A +F   G   D  +  ++EL+++G+ N++ +
Sbjct: 305 KVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSS 364

Query: 446 FFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIH 505
            F++ P  G + RS L   C+ +TP++GI      +  +  + GAF Y+P   L+ +I +
Sbjct: 365 VFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISY 424

Query: 506 AVSDLVASYKTTWSF-WKMNPL-DFICFITTVFITVFASIEDGI 547
              +L+    +   F W +    + + F+  V  T+  S + G+
Sbjct: 425 IAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGV 468

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 112/462 (24%), Positives = 191/462 (41%), Gaps = 53/462 (11%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P + WLP Y    L+ DL+AGITI    +P ++SYA  IA + P  GLY+  V  + Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F ++  + +GP   +SL   + +Q       ++                  G I    G
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSC-----KKHNPDLDPILIVIAVTLISGTILLISG 224

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLP 291
           + RLG+L  +++   + GF+         G V  +M   S +N  +    ++ +T +H  
Sbjct: 225 IFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLINELKLG-DILADTPEH-- 272

Query: 292 DTKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXXXGNAMRSGI-- 349
                  +    L I++ WK+ F +        + P +              A +  +  
Sbjct: 273 -------YNTPFLKIVFLWKYAFQNF-------HVPTTLISFISIIILLIVRAFKKVLMH 318

Query: 350 ----------IIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPP-----NGL 394
                     I+IV+T++     +        I ILG   S   E  +F  P      GL
Sbjct: 319 RHRWLIFIPEILIVLTTVLILSYKLDFADTYDIDILGDFKS--NENSIFHNPLSNKNRGL 376

Query: 395 LAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTG 454
           +  V      + I    E    +K+ G  ++  V  ++EL+A+G+SN++ +   + P  G
Sbjct: 377 IHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFG 436

Query: 455 SFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASY 514
            + RS + A    KT LSG+F G   +LA+  L     YIP   LS +       L+   
Sbjct: 437 GYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEI 496

Query: 515 KTTWSF-WKMNPLDFICFITTVFIT-VFASIEDGIYFTMCWS 554
               SF W+    + +  I   F+T +F S+E  +Y    +S
Sbjct: 497 PKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYS 538

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 122/519 (23%), Positives = 214/519 (41%), Gaps = 56/519 (10%)

Query: 60  TDDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFK-----SFGNYLISIFP 114
           T + +  T     +   +  + +     L++  +  +R +LT +     SF + L    P
Sbjct: 23  TPEMHNTTESHLFHRQSDSSKSLTSPSELQDVNSSPMRSFLTSEQLVKMSFYDRLKYYLP 82

Query: 115 IIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYSLF 173
              WLP Y  K    D+IAGIT+    +P ++SYA  +A + P  GLYS  +  + Y +F
Sbjct: 83  CFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYCVF 142

Query: 174 ATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLL 233
            +   + +GP + +SL   + ++ +   +T  +K                G I    G+ 
Sbjct: 143 GSVPQMIVGPESAISLVVGQAVEKL---VTHNEKVGTINISVVVTFLS--GAILLIFGIT 197

Query: 234 RLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHL--- 290
           RLGFL  ++S   + GF++   L ++   +   +     + T    Y      ++ L   
Sbjct: 198 RLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFKY 257

Query: 291 -PDT--KIDAIFGLIPLVILYFWKWWFSSMGPKLVDRY-----YPNSXXXXXXXXXXXXG 342
            P+   K  AI  L   +IL   ++    +  KL+ RY     +P               
Sbjct: 258 GPENLHKPTAILSLCSFIILMTLRF----LKKKLMKRYKSVIFFPE-------------- 299

Query: 343 NAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVP-SGLQEVGVFTPPNGLLAKVAPE 401
                 I++IV++S+  SV     K +  IS+LG    SG  ++    P       +  E
Sbjct: 300 ------ILLIVISSLIISVNFNLKK-DFDISMLGDFSTSGFDKLN--NPLGKDNRSLCHE 350

Query: 402 LPS----SIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFS 457
           L S      I+   E    +KS G + D  +  ++EL+A+G  NL+G+ F + P  G + 
Sbjct: 351 LLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGYG 410

Query: 458 RSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTT 517
           RS + A    +T +SG   G   L  +  L     Y P   LS +       L+    + 
Sbjct: 411 RSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSD 470

Query: 518 WSFW-KMNPLDFICFITTVFI-TVFASIEDGIYFTMCWS 554
             F  + +  + +   T +F+ T+  S+E GI     +S
Sbjct: 471 IRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYS 509

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 123/513 (23%), Positives = 205/513 (39%), Gaps = 69/513 (13%)

Query: 69  ESFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLI 128
           E+    +E+   Y +E V  +   N+  R  LT  +  +YL   FP   W+P Y     +
Sbjct: 18  EAISQHNEDGLVYNQEDVQDRIAINN--RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFL 75

Query: 129 SDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVM 187
            DL AG+++    +P ++SYA  +A + P  GLYS  +  + Y++F +   + +GP + +
Sbjct: 76  GDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAIFGSVPQMIVGPESAI 135

Query: 188 SLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAV 247
           SL      Q V   +  +++                G     +G+ RLGFL  ++S   +
Sbjct: 136 SLVVG---QAVEPMVNHDER--ISTISISIVVTFISGSFLLFLGIFRLGFLGNILSRALL 190

Query: 248 TGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKI------------ 295
            GF+      +I   + + +     + T    Y        H P  KI            
Sbjct: 191 RGFICSVGFVMIINSLISELKLDKVLATSPEHY--------HTPFEKILFLIKYGQHNYH 242

Query: 296 --DAIFGLIPLVILYFWKWWFSSMGPKLVDR-----YYPNSXXXXXXXXXXXXGNAMRSG 348
              AI  L   +IL   K     M  +L+ R     + P                     
Sbjct: 243 APTAILSLYSFIILMLMKV----MKKRLMKRFKWVIFVPE-------------------- 278

Query: 349 IIIIVMTSISWSVTRGKSKSERPISILGTVP-SGLQEV-GVFTPPNGLLAKVAPELPSSI 406
           I+I+++ +I +S      K +  ISI+G    +G   +       N LL K  P L + I
Sbjct: 279 ILIVIVGTIMFSF-HFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLK--PLLDAGI 335

Query: 407 IVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKA 463
           +  +L   E    +K+ G   D  V  ++EL+A+G  N++G+ F + P  G + RS + A
Sbjct: 336 VCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINA 395

Query: 464 KCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKM 523
               +T +SG+  GS  L  +          P   LS V       L+    T   F+  
Sbjct: 396 LSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQ 455

Query: 524 NPL--DFICFITTVFITVFASIEDGIYFTMCWS 554
           +    + I    T   T+F S+E GI    C+S
Sbjct: 456 SHGYNELIVLGLTFITTIFYSVEVGICVGCCYS 488

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 113/469 (24%), Positives = 190/469 (40%), Gaps = 56/469 (11%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P ++WLP YN     SD I+GI++    +P ++SYA  IA + P  GLYS  +    Y 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSS--LTEEQKXXXXXXXXXXXXXXXCGIISAG 229
           +  +   + +GP   +SL   + +  ++ S  L+ ++                 G++   
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 230 VGLLRLGFLVELIS-------LNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKV 282
            GLLRLGFL  ++S       +++V G M   AL I   ++  ++            ++ 
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDAL-ITEMKLNCIL--IDNDRHYHTAFEK 290

Query: 283 IINTLKHLPDT--KIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXX 340
           I+  +K+ P+   K   +  ++   ILYF ++       K + ++               
Sbjct: 291 IMFIIKYAPNNFHKPTTVLSVVCFSILYFVRYC----KKKYIIKH--------------- 331

Query: 341 XGNAMRSGI----IIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEV--GVFTPP--- 391
                +S I    I+IV+ S          K    ISI+G V S    +  G    P   
Sbjct: 332 -----KSLIFLPEILIVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSS 386

Query: 392 -NGLLAKVAPELPSSIIVL-LLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNS 449
            N  L  +      +I  L   E    +KS G   +  +  ++EL+A+G+ NL  +    
Sbjct: 387 SNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGG 446

Query: 450 YPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IH 505
            P  G + RS + A    KT +SG+  G   +L +  L     +IP   LS +     + 
Sbjct: 447 LPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLS 506

Query: 506 AVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
            + +     K  W     N L  I F  T   T+F S+E GI     +S
Sbjct: 507 LIEEAPGEVKFHWRCKGYNEL--IIFFMTACGTIFFSVEVGIIIGCSYS 553

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 194/466 (41%), Gaps = 61/466 (13%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSY-AQIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y +  L  D+IAGI++    +P ++SY   IA +PP  GLYS  +  + Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +  +   + +GP + +SL   + ++ +        K                G I    G
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESIT-----LHKENVSLIDISTVITFVSGTILLFSG 219

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLP 291
           + R GFL  ++S   + GF++   L +I   +       SE+   +  + V +    H P
Sbjct: 220 ISRFGFLGNVLSKALLRGFISSVGLVMIINSL------ISELKLDK--FLVSLPQHYHTP 271

Query: 292 DTKI--------------DAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXX 337
             KI               AIF    L++L+  +     +  KL+ +Y+ ++        
Sbjct: 272 FEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRL----LKRKLM-KYHKSAIFF----- 321

Query: 338 XXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVP-SGLQEVGVFTPPNGLLA 396
                      I+++V+ +I  S+ +   K    ISI+G        E+    P      
Sbjct: 322 ---------PDILLVVIVTILISM-KFNLKHRYGISIIGDFSMDNFDELK--NPLTRPRR 369

Query: 397 KVAPEL-PSSIIVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPV 452
           K+ P+L  +S+IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F + P 
Sbjct: 370 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPA 429

Query: 453 TGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IHAVS 508
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +     I  + 
Sbjct: 430 FGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLE 489

Query: 509 DLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
           ++    K        + L    F  T   T+F SIE GI     +S
Sbjct: 490 EVPGDIKFHLRCGGFSEL--FVFAVTFCTTIFYSIEAGICIGCVYS 533

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 103/441 (23%), Positives = 191/441 (43%), Gaps = 61/441 (13%)

Query: 85  TVTLKEY----YNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCV 140
           T++L+ Y     +  +RH    KS+ +Y +   PI++WLP Y++  +  D++AG+T+   
Sbjct: 21  TMSLRSYRAIKVDKPLRH--DTKSYVSYYL---PILRWLPEYSWGKMAKDMLAGLTLTSF 75

Query: 141 LVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNS 200
            +P ++S   +A + P  GLY+  +    Y++F +   + +GP  V SL        V  
Sbjct: 76  QIPLAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASLV-------VGQ 128

Query: 201 SLTEEQKXXXXXXXXXXXXXXXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA-LNII 259
           S                      G++   +G+ RLGF+   IS   + GF +  A + +I
Sbjct: 129 SCDAWAHKSLEPLMTVAVIGCISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVMLI 188

Query: 260 SGQVPALM------GYASEVNTREATYKVIINTLKHLPD------TKIDAIFGLIPLVIL 307
           +  +P L           E     A +  ++  L++  +       K+      I L+  
Sbjct: 189 TELLPQLQIDDRYKQALKEGKVGSAAWDKLVFALENAREYSNPFSVKLSVAAFSILLLSK 248

Query: 308 YFWKWWFSSMG-PKLVDRYYPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRG-K 365
           Y  K+  +  G  KL   ++P+                    ++++V+ SI  S      
Sbjct: 249 YLKKYLTAKYGWTKLT--FFPD--------------------LLLVVLGSILLSFYYDWD 286

Query: 366 SKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVN- 424
           +K   P  I+G +P     + V   P     +      +S +V +L     A +F  ++ 
Sbjct: 287 NKYNLP--IVGDLPPNKDHIKV---PIQSFQEFKDLFDASFLVAILGLFESATAFKSISA 341

Query: 425 --DYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLL 482
             D  V  ++EL+++G+ N++G+ F+S P  G + RS L   C  +TP++GIF     + 
Sbjct: 342 TFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIF 401

Query: 483 ALYCLTGAFFYIPKATLSAVI 503
            +  L G F Y+P   L+ +I
Sbjct: 402 CMRFLMGVFHYLPLCILAVII 422

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 110/462 (23%), Positives = 190/462 (41%), Gaps = 53/462 (11%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSY-AQIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y +  L  D+IAGI++    +P ++SY   IA +PP  GLYS  +  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +  +   + +GP + +SL   + ++ +        K                G I    G
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESIT-----LHKDNVSLIDISIVITFVSGAILLFSG 209

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLP 291
           + R GFL  ++S   + GF++   L +I   + + +     + +    Y      +  L 
Sbjct: 210 ISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLI 269

Query: 292 D------TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDR-----YYPNSXXXXXXXXXXX 340
           D       K  AIF     +IL   +     +  KL+ R     ++P+            
Sbjct: 270 DYAPAQYHKPTAIFSGCCFIILIVMRL----LKKKLMKRHKSAVFFPD------------ 313

Query: 341 XGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAP 400
                   I+++V+ +I  S+ +   K    ISI+G       +  +  P      K+ P
Sbjct: 314 --------ILLVVIVTILISM-KLSLKQRYGISIVGDFSMDNFD-KLKNPLTHSRRKLMP 363

Query: 401 EL-PSSIIVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSF 456
           +L  +S+IV +L   E    +KS G   +  V  ++EL+A+G  N+  + F + P  G +
Sbjct: 364 DLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGY 423

Query: 457 SRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IHAVSDLVA 512
            RS + A    ++ +SG+F G   L+ +  L     YIP   LS +     I  + ++  
Sbjct: 424 GRSKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPG 483

Query: 513 SYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
             K        + L    F  T  +T+F SIE GI     +S
Sbjct: 484 DIKFHLQCGGYSEL--FVFAVTFGVTIFYSIESGICIGCVYS 523

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 126/494 (25%), Positives = 212/494 (42%), Gaps = 49/494 (9%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   W+P Y +  LISD +AGI++    +P ++SYA  IA + P  GLYS  +  + Y+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   + ++     L +                   G     +G
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVE-----LLKSHDSALEIINISVVLTFISGAALLILG 203

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNIISGQV-------PALMGYASEVNTREATYKVII 284
           +LRLGFL  ++S + + GF++   L +I   +         L G     +T     + +I
Sbjct: 204 ILRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFLI 263

Query: 285 N---TLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXXX 341
               T  H P   + AI  +    I    K W +        R+                
Sbjct: 264 KYAPTNYHKPTALLSAIAFVTLFSIRLLKKRWMAK------HRWL--------------- 302

Query: 342 GNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPE 401
             A    I+++V+ SI  S T  + K +  I I+G   +   +  +  P +    K+ P+
Sbjct: 303 --AFIPEILMVVIISIYLSAT-WEFKKQYGILIVGDFNTHAID-KLKNPISKENRKIMPQ 358

Query: 402 LPSSIIVLLL----EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFS 457
           L ++ +++ L    E +  +KS G   D  +  ++EL+A+G  N+I + F + P  G + 
Sbjct: 359 LLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYG 418

Query: 458 RSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVI-IHAVSDL-VASYK 515
           RS + A    KT +SG+F GS  L+ +  L     YIP   LS +  I  +S L  A  +
Sbjct: 419 RSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSE 478

Query: 516 TTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVK- 574
             + F      +   F  TV  T+  S+E GI     +S   ++   A    + LG V+ 
Sbjct: 479 LKFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQG 538

Query: 575 IAEIVN-PEIVDSD 587
             E  N  E +DSD
Sbjct: 539 TREFANIDEYLDSD 552

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 115/466 (24%), Positives = 191/466 (40%), Gaps = 61/466 (13%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   WLP YN    I DLIAG+++    +P ++S+A  +A + P  GLYS     + Y+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGV- 230
           +  +   + +GP + +SL   + ++ + S   +                     IS G  
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTLQLSAVIT---------FISGGFL 200

Query: 231 ---GLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTL 287
              GL RLGFL  ++S   + GF++   L +I             +N+  + +K +   L
Sbjct: 201 FFFGLCRLGFLGNVLSRALLRGFISSVGLVMI-------------INSMISEFK-LDKIL 246

Query: 288 KHLP---DTKIDAIFGLI---------PLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXX 335
           K LP    T  + I  L+         P   L    ++   M   +  +  P        
Sbjct: 247 KDLPVHYHTPFEKILFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLMPRCRWI--- 303

Query: 336 XXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPS-GLQEVGVFTPPNGL 394
                        I+++++ +I  S+ + + K    IS +G   + GL ++    P +  
Sbjct: 304 --------VFVPDILLLIIGTIFLSI-KYRFKHNYSISTVGDFNTKGLDKL--LNPLSAE 352

Query: 395 LAKVAPELPSS--IIVLL--LEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSY 450
              + P+L S+  I  +L   E    +KS G   D  +  ++EL+A+G  NL  +   S 
Sbjct: 353 NRGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSL 412

Query: 451 PVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDL 510
           P  G + RS + A    +T +SG F G  VLL +  L     YIP   LS V       L
Sbjct: 413 PAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISL 472

Query: 511 V--ASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
           +  A     + F      + + F  TV  T+F S+E GI     +S
Sbjct: 473 LEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYS 518

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 118/529 (22%), Positives = 213/529 (40%), Gaps = 55/529 (10%)

Query: 48  DSKFVFEKDLGYTDDSNELTRESFLNSSENVPRYIEETVTLKEYYNHSIRH------YLT 101
           D   VF  +  Y  DS++    + + +S +        V+  E +N    +         
Sbjct: 28  DQHEVFPDNFDYDKDSSKYQSRTHVGTSNSASEVFPVNVSRFESFNSMSNNDSVYDNNTI 87

Query: 102 FKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSY-AQIATLPPQYGL 160
           F++   YL    P   WLP Y +  L  D+IAGI++    +P ++SY   IA +PP  GL
Sbjct: 88  FETVPYYL----PCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGL 143

Query: 161 YSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXX 220
           YS  +  + Y +  +   + +GP + +SL   + ++ +        K             
Sbjct: 144 YSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESIT-----LHKDNVSLIDISVVIT 198

Query: 221 XXCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATY 280
              G I    G+ R GFL  ++S   + GF++   L +I   + + +     + +    Y
Sbjct: 199 FVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHY 258

Query: 281 KVIINTLKHLPD------TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDR-YYPNSXXXX 333
                 +  L D       K  AIF    L++L+  +     +        ++P+     
Sbjct: 259 HTPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPD----- 313

Query: 334 XXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNG 393
                          I+++V+ +I  S+ +   K    I+I+G       +  +  P   
Sbjct: 314 ---------------ILLVVIVAIFISM-KFSLKHRYGITIIGDFSMDNFD-KLKNPFTH 356

Query: 394 LLAKVAPEL-PSSIIVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNS 449
              K+ P+L  +S+IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F +
Sbjct: 357 SRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGA 416

Query: 450 YPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IH 505
            P  G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +     I 
Sbjct: 417 LPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGIS 476

Query: 506 AVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
            + ++    K        + L    F  T  +T+  SIE GI     +S
Sbjct: 477 LLEEVPGDIKFHLRCGGYSEL--FVFAVTFGVTILCSIEAGICIGCVYS 523

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 114/461 (24%), Positives = 191/461 (41%), Gaps = 51/461 (11%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   W+P Y+ K  + D IAG+++    +P +MSYA  +A +PP  GLYS       Y+
Sbjct: 74  LPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYT 133

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIIS---- 227
           +  +   + +GP + +SL   + I+   + L+E+ K               C +I+    
Sbjct: 134 VLGSVPQMIVGPESAISLILGQAIE---ARLSEDPKLKAINI---------CLVITFISG 181

Query: 228 ---AGVGLLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATY---- 280
                 GLLRLGFL  ++S   + GF++G  + ++   +   +       TR+  Y    
Sbjct: 182 LVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPF 241

Query: 281 KVIINTLKHLPDT--KIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSXXXXXXXXX 338
           + ++  +K+ P+   K  AI  L+  VIL   + +    G K                  
Sbjct: 242 EKVLFIMKYGPENYHKPTAILSLVAFVILMSLRIFKKRYGKKF----------------- 284

Query: 339 XXXGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKV 398
                 +   I+++V  SI  S  +   KS   I I+  +P    +       N  +A  
Sbjct: 285 --KWLVLLPDILVVVALSIFVSY-KMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATF 341

Query: 399 APELPSSIIVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGS 455
                +  +V +L   E    +KS G   +  +  ++ELIA+G  N++G+ F   P  G 
Sbjct: 342 KDLFSTGFMVAMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGG 401

Query: 456 FSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYK 515
           + RS + A    +T +SG F G   L  +  L     YIP   LS +       L+    
Sbjct: 402 YGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAP 461

Query: 516 TTWSF-WKMNPL-DFICFITTVFITVFASIEDGIYFTMCWS 554
               F W+     +   F  T+  T+F S+E GIY     S
Sbjct: 462 HDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACS 502

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 92/405 (22%), Positives = 165/405 (40%), Gaps = 45/405 (11%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P + W+P Y+++    DL+AGI++    +P ++SYA  IA + P  GLYS  +    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   +  +  ++  +E                   G++   +G
Sbjct: 134 IFGSVPQMIVGPESAISLVVGQATEKFSAHDSE-----ISTVTITMMITFISGVVLFFLG 188

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLP 291
            +RLGFL  ++S   + GF++   L +I   +   +    ++      Y   +  +  L 
Sbjct: 189 SVRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLF 248

Query: 292 D------TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRY-----YPNSXXXXXXXXXXX 340
                   K  AI  LI  ++L   +        KL++RY      P             
Sbjct: 249 RYASEYYHKPTAILSLICFLVLISTRIA----KKKLMNRYRFLIFVPE------------ 292

Query: 341 XGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTV-PSGLQEVG--VFTPPNGLLAK 397
                   I+++V  +I  S+ +   K    IS +G     G   +G  +      L + 
Sbjct: 293 --------ILLVVSVTILLSL-KYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSS 343

Query: 398 VAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFS 457
           +  E  +  ++   E    +KS G   +     ++ELIA+G  N++G+ F + P  G + 
Sbjct: 344 LWNEGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYG 403

Query: 458 RSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAV 502
           RS +      KT +SG   G   LL    L     Y P   LS +
Sbjct: 404 RSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVI 448

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 95/437 (21%), Positives = 175/437 (40%), Gaps = 56/437 (12%)

Query: 144 QSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLT 203
            S+S + +A LPP  GLYS  +    Y +  T     +GP  V+SL   +  +  +    
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 204 EEQKXXXXXXXXXXXXXXXCGIISAGV----GLLRLGFLVELISLNAVTGFMTGSALNII 259
           E                   G +S G+    G+ R+GF+   +S   + GF++  AL ++
Sbjct: 61  EPLSTVAVI-----------GCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVML 109

Query: 260 ----SGQVPALMGYASEV------NTREATYKVIINTLKHLPDTKI--DAIFGLIPLVIL 307
                 ++     YA  V       T    ++ I+       DT     ++F  I L+ +
Sbjct: 110 ITELLPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDTFTWNLSLFTFILLMTI 169

Query: 308 YFWKWWFSSMGPKLVDRYYPNSXXXXXXXXXXXXGNAMRSGIIIIVMTSISWSVTRGKSK 367
            + K   +         ++P                     I+I+V+ SI+ S T+ K  
Sbjct: 170 RYLKRHLAEKCGWKKCIFFPE--------------------ILIVVVGSITLSNTQ-KWS 208

Query: 368 SERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLL---EHIAIAKSFGRVN 424
             + I I+G +P     + V   P    ++      +S ++ +L   E   + KS    +
Sbjct: 209 ELKGIKIIGDIPPNSDHIKV---PVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNS 265

Query: 425 DYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLAL 484
           +     ++EL+++G+ NL+ + F++ P  G + RS +   C  +T  SG+F     ++ +
Sbjct: 266 NVDASSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICM 325

Query: 485 YCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSF-WKMNPL-DFICFITTVFITVFAS 542
             L  AF ++P   L+ +I      L+        F W +    +   FI  V  T+  S
Sbjct: 326 NFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWS 385

Query: 543 IEDGIYFTMCWSAAILL 559
            + G+   MC +   LL
Sbjct: 386 PQFGVTMGMCLTMIRLL 402

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 405 SIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAK 464
           S ++  LE I  +KS G   +     ++EL+A+G+ N IG+ F   P  G + RS + A 
Sbjct: 349 SALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAF 408

Query: 465 CNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLV--ASYKTTWSFWK 522
              +T ++G+F GS  L  +  L     YIP   LS +       L+  A +   +    
Sbjct: 409 SGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRC 468

Query: 523 MNPLDFICFITTVFITVFASIEDGIYFTMCWS 554
               + I F+ T   T F SIE GI     +S
Sbjct: 469 KGYDELIMFVLTFLCTCFYSIEFGILAGCTYS 500

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P + W+P YN+K    D IAG+++    +P  +S+A  +A + P  GLYS  V  + Y+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           LF +   + +GP + +SL   + ++ + S                       G+     G
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTS-----HDLSLETVDIATMISFMSGLTLLFGG 186

Query: 232 LLRLGFLVELISLNAVTGFMT 252
           + RLGFL  ++S   + GF++
Sbjct: 187 IFRLGFLGNILSKALLRGFIS 207

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 6/148 (4%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y +  L  D+IAGI++    +P ++SY   IA +PP  GLYS  +  + Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   + ++ +        K                G I    G
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESIT-----LHKDNVSLIDISIVITFVSGAILLFSG 209

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNII 259
           + R GFL  ++S   + GF++   L +I
Sbjct: 210 ISRFGFLGNVLSKALLRGFISSVGLVMI 237

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 6/164 (3%)

Query: 397 KVAPEL-PSSIIVLLL---EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPV 452
           K+ P+L  +S+IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F + P 
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 453 TGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVA 512
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       L+ 
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 513 SYKTTWSFWKM--NPLDFICFITTVFITVFASIEDGIYFTMCWS 554
              +   F        +   F  T  +T+F SIE GI     +S
Sbjct: 480 EVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYS 523

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 6/157 (3%)

Query: 104 SFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYS 162
           SF + L    P   W+P Y +   + DL+AGIT+    +P ++SYA  +A + P  GLYS
Sbjct: 73  SFRDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYS 132

Query: 163 SFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXX 222
                + Y++F +   + +GP + +SL   + ++ + +   E                  
Sbjct: 133 LAFTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAHNHE-----ISTMSISVLVTFI 187

Query: 223 CGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNII 259
            G+     G+ R GFL  ++S   + GF++   + +I
Sbjct: 188 SGMFLFVFGICRFGFLGNVLSRALLRGFISSVGVVMI 224

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 90/197 (45%), Gaps = 9/197 (4%)

Query: 365 KSKSERPISILGTVPS-GLQEVGVFTPPNGLLAKVAPELPSS--IIVLL--LEHIAIAKS 419
           K K    ISI+G   + GL  V  + P +    ++AP L ++  I+ +L   E    AKS
Sbjct: 316 KFKKHYEISIVGDFDTDGL--VNFYNPISKSNRELAPNLMNAGFIVAILGFFESTTAAKS 373

Query: 420 FGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSC 479
            G   ++ +  ++EL+A+G  NL  +   + P  G + RS + +    +T +SG+  G  
Sbjct: 374 LGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVI 433

Query: 480 VLLALYCLTGAFFYIPKATLSAV-IIHAVSDL-VASYKTTWSFWKMNPLDFICFITTVFI 537
           VLL +        YIP   LS +  I  +S L  A     + F      + + F  TV  
Sbjct: 434 VLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLT 493

Query: 538 TVFASIEDGIYFTMCWS 554
           T F S+E G+     +S
Sbjct: 494 TFFYSLEMGVCIGCGYS 510

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 66/147 (44%), Gaps = 6/147 (4%)

Query: 412 EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPL 471
           E    +KS G   D  +  ++EL+A+G  NL+G+ F + P  G + RS + A     T +
Sbjct: 369 ESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVM 428

Query: 472 SGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IHAVSDLVASYKTTWSFWKMNPLD 527
           SG+F G   L+    L  A  +IP   LS +     I    +  A  K  +     N L 
Sbjct: 429 SGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNEL- 487

Query: 528 FICFITTVFITVFASIEDGIYFTMCWS 554
            + F  TV  T F S+E GI     +S
Sbjct: 488 -LTFAITVLTTFFYSVEAGITLGCGYS 513

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y+    I DLIAG ++    +P +MSY+  +A +PP  GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   + I+ +      +                  G I    G
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLT-----KHDASLNVTNLCVVLTFISGSILFSFG 199

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNII 259
           L+R GFL  ++S   + GF++   L ++
Sbjct: 200 LMRFGFLDSVLSRALLRGFISAVGLIMV 227

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 64/140 (45%), Gaps = 6/140 (4%)

Query: 412 EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPL 471
           E    +KS G   D  V  ++EL+A+G  NLIG+ F + P  G + RS + A    +T +
Sbjct: 381 ESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVV 440

Query: 472 SGIFTGSCVLLALYCLTGAFFYIPKATLSAVI----IHAVSDLVASYKTTWSFWKMNPLD 527
           SG   G+  +  +  L     YIP   LS +     +  + +  A  +        N L 
Sbjct: 441 SGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNEL- 499

Query: 528 FICFITTVFITVFASIEDGI 547
            I FI TV  T F S+E GI
Sbjct: 500 -ISFIITVLTTFFYSVEAGI 518

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 8/148 (5%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y+ +    D IAG+++    +P +MSYA  IA + P  GLY+     + Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   + I+ +                         G++    G
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMI-----RHDPSLSSLDLCVIITFISGVVLFTFG 211

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNII 259
           + R GFL  ++S   + GF+  SA+ +I
Sbjct: 212 VFRFGFLDNVLSRAFLRGFI--SAVGVI 237

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 412 EHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPL 471
           E    +KS G   +  V  ++EL+A+G  NL+G+ F + P  G + RS + A     T +
Sbjct: 354 ESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVM 413

Query: 472 SGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLV--ASYKTTWSFWKMNPLDFI 529
           SG+F G    +    L  A  +IP   LS +       L   A     + F      + +
Sbjct: 414 SGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELL 473

Query: 530 CFITTVFITVFASIEDGIYFTMCWS 554
            F  TV  T F S+E GI     +S
Sbjct: 474 IFALTVLTTFFYSVEAGITLGCGYS 498

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYA-QIATLPPQYGLYSSFVGAYTYS 171
            P   WLP Y+   L+ D IAG ++    +P +MSY+  +A +PP  GL +     + Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 172 LFATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKXXXXXXXXXXXXXXXCGIISAGVG 231
           +F +   + +GP + +SL   + I+        +                  G I    G
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEK-----QMKHDKSLDVVNLCLILTFISGAILFCFG 184

Query: 232 LLRLGFLVELISLNAVTGFMTGSALNII 259
           ++R G+L  ++S   + GF++   L ++
Sbjct: 185 IMRFGYLDSVLSRALLRGFISAVGLVMV 212

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 71/172 (41%), Gaps = 9/172 (5%)

Query: 422 RVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVL 481
           +++ Y V  D+ELIA G+SNL+   F S      ++ S L  +    +P +G       +
Sbjct: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557

Query: 482 LALYCLTGAFFYIPKATLSAVI-IHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVF 540
           + +        +IP   + ++I +     LV +   TW   K+   +++  +  V     
Sbjct: 558 VVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGI 615

Query: 541 ASIEDGI---YFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYL 589
                GI       C+   I   K+    G+F G V     VN +++ S +L
Sbjct: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVA-KSTVNRDLIQSKFL 666

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 6/116 (5%)

Query: 415 AIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGI 474
           A+A S   V+ Y V  D+ELIA G SNLI  F  S      ++ S L  +    +P++GI
Sbjct: 548 ALAMSLN-VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGI 604

Query: 475 FTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVA-SYKTTWSFWKMNPLDFI 529
                  + +        +IP   + ++I     +L+  +   TW   K+ P +++
Sbjct: 605 MLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYL 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,530,253
Number of extensions: 3567438
Number of successful extensions: 9394
Number of sequences better than 10.0: 49
Number of HSP's gapped: 9437
Number of HSP's successfully gapped: 80
Length of query: 866
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 748
Effective length of database: 39,950,811
Effective search space: 29883206628
Effective search space used: 29883206628
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)