Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.428.267ON1121125627e-76
TPHA0A017708.267ON1041142728e-32
KLLA0F19250g8.267ON116902563e-29
YDR115W8.267ON105842345e-26
Kwal_56.237768.267ON130882341e-25
AGR081C8.267ON130812313e-25
TDEL0F039408.267ON110812293e-25
CAGL0B01793g8.267ON98772283e-25
Skud_4.3758.267ON105842293e-25
Smik_4.3598.267ON105502275e-25
Suva_2.2748.267ON105552275e-25
KNAG0H032208.267ON86562265e-25
Ecym_43038.267ON109702251e-24
KAFR0B054908.267ON85852231e-24
SAKL0H16918g8.267ON111552182e-23
ZYRO0C01540g8.267ON97502162e-23
NCAS0B038208.267ON115512173e-23
KLTH0G13574g8.267ON112582163e-23
NDAI0J013408.267ON141502174e-23
TBLA0E044708.267ON94842101e-22
Kpol_413.48.727ON74552730.12
TPHA0N002207.15ON71758710.21
Ecym_50137.15ON72154710.28
CAGL0L00649g7.15ON70458680.68
KLLA0F19338g8.271ON89141661.0
KAFR0A015701.290ON122278661.3
KNAG0E041707.15ON71558651.6
ZYRO0D04796g7.39ON86641632.5
Skud_1.87.15ON71358632.9
Suva_1.127.15ON71258633.0
YAL054C (ACS1)7.15ON71358624.4
NCAS0A076307.15ON71458614.8
Smik_1.117.15ON71358615.4
KLLA0A03333g7.15ON70758606.9
TBLA0E007207.15ON72558606.9
SAKL0D14608g7.15ON70858598.4
ADR408W7.15ON69454598.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.42
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...   221   7e-76
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...   109   8e-32
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   103   3e-29
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    95   5e-26
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    95   1e-25
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    94   3e-25
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    93   3e-25
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    92   3e-25
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    93   3e-25
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    92   5e-25
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    92   5e-25
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    92   5e-25
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    91   1e-24
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    91   1e-24
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    89   2e-23
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    88   2e-23
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    88   3e-23
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    88   3e-23
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    88   4e-23
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    86   1e-22
Kpol_413.4 s413 complement(10875..13112) [2238 bp, 745 aa] {ON} ...    33   0.12 
TPHA0N00220 Chr14 complement(35883..38036) [2154 bp, 717 aa] {ON...    32   0.21 
Ecym_5013 Chr5 complement(22206..24371) [2166 bp, 721 aa] {ON} s...    32   0.28 
CAGL0L00649g Chr12 complement(80936..83050) [2115 bp, 704 aa] {O...    31   0.68 
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...    30   1.0  
KAFR0A01570 Chr1 complement(313408..317076) [3669 bp, 1222 aa] {...    30   1.3  
KNAG0E04170 Chr5 (831222..833369) [2148 bp, 715 aa] {ON} Anc_7.1...    30   1.6  
ZYRO0D04796g Chr4 complement(400656..403256) [2601 bp, 866 aa] {...    29   2.5  
Skud_1.8 Chr1 complement(18892..21033) [2142 bp, 713 aa] {ON} YA...    29   2.9  
Suva_1.12 Chr1 complement(20074..22212) [2139 bp, 712 aa] {ON} Y...    29   3.0  
YAL054C Chr1 complement(42881..45022) [2142 bp, 713 aa] {ON}  AC...    28   4.4  
NCAS0A07630 Chr1 (1519397..1521541) [2145 bp, 714 aa] {ON} Anc_7...    28   4.8  
Smik_1.11 Chr1 complement(25820..27961) [2142 bp, 713 aa] {ON} Y...    28   5.4  
KLLA0A03333g Chr1 complement(297542..299665) [2124 bp, 707 aa] {...    28   6.9  
TBLA0E00720 Chr5 (144667..146844) [2178 bp, 725 aa] {ON} Anc_7.1...    28   6.9  
SAKL0D14608g Chr4 (1204606..1206732) [2127 bp, 708 aa] {ON} high...    27   8.4  
ADR408W Chr4 (1442382..1444466) [2085 bp, 694 aa] {ON} Syntenic ...    27   8.7  

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score =  221 bits (562), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 1   MFLVKRLNAVPTGTIMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLL 60
           MFLVKRLNAVPTGTIMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLL
Sbjct: 1   MFLVKRLNAVPTGTIMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLL 60

Query: 61  GLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           GLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH
Sbjct: 61  GLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score =  109 bits (272), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (66%), Gaps = 15/114 (13%)

Query: 2   FLVKRLNAVPTGTIMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGL-- 59
           FL +  N + TG ++       N ++  SI     G N++G   G A      +I GL  
Sbjct: 3   FLTRSFNQLMTGRVIP------NNTLVDSIKNSILGGNAIGSRTGLA------SILGLNL 50

Query: 60  -LGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
            LGLQRRWKSRGNTYQPSTLKRKR+ GFLARARS+ G+KILERRKAKGRWYL+H
Sbjct: 51  DLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  103 bits (256), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 68/90 (75%), Gaps = 2/90 (2%)

Query: 25  RSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLG--LQRRWKSRGNTYQPSTLKRKR 82
           R++ S + RP A +N + +   + T   GS+I G+L    QRRWKSRGNT+QPSTLKRKR
Sbjct: 27  RTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDLTQRRWKSRGNTFQPSTLKRKR 86

Query: 83  KFGFLARARSRSGSKILERRKAKGRWYLSH 112
           + GFLARARSRSG +IL+RRK KGRWYL++
Sbjct: 87  RVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 94.7 bits (234), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (73%), Gaps = 7/84 (8%)

Query: 31  IFRPFAG--LNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLA 88
           + RP  G  LNS  L     T +F     GL+G QRRWKSRGNTYQPSTLKRKR FGFLA
Sbjct: 27  VLRPQTGMLLNSSPL----KTPSFTPLGFGLIG-QRRWKSRGNTYQPSTLKRKRTFGFLA 81

Query: 89  RARSRSGSKILERRKAKGRWYLSH 112
           RA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 82  RAKSKQGSKILKRRKLKGRWFLSH 105

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 94.7 bits (234), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/88 (54%), Positives = 68/88 (77%), Gaps = 3/88 (3%)

Query: 27  ISSSIFR-PFAGLNSVGLFPGTATNTFGSAITGLLGL-QRRWKSRGNTYQPSTLKRKRKF 84
           ++  +FR P + +N+  +  G++++   S ++ L GL Q+RWKSRGNTYQPSTLKRKR+ 
Sbjct: 44  LNVCMFRSPVSQVNN-SIATGSSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRKRRV 102

Query: 85  GFLARARSRSGSKILERRKAKGRWYLSH 112
           GFLAR +S+ GSKIL+RR+ KGRWYL+H
Sbjct: 103 GFLARVKSKQGSKILKRRREKGRWYLTH 130

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 93.6 bits (231), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 60/81 (74%), Gaps = 4/81 (4%)

Query: 34  PFAGLNSVGLF-PGTATNTFGSAITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARAR 91
           P     ++G F P  A     S ++ LLGL Q+RWKSRGNTYQPSTLKRKR+ GFLARAR
Sbjct: 52  PQIQYGAIGAFTPAAAPKP--SMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARAR 109

Query: 92  SRSGSKILERRKAKGRWYLSH 112
           SR+G  IL+RR+ KGRWYL+H
Sbjct: 110 SRTGRNILKRRREKGRWYLTH 130

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 92.8 bits (229), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (77%), Gaps = 3/81 (3%)

Query: 35  FAGLNSVGLFPGTATNTFGSAITGLLG---LQRRWKSRGNTYQPSTLKRKRKFGFLARAR 91
           FA   S GL     T++  S+I+ L     +QRRWKSRGNT+QPSTLKRKR+ GFLARAR
Sbjct: 30  FAQNKSQGLLGVPETHSPLSSISLLFPFGIMQRRWKSRGNTFQPSTLKRKRRIGFLARAR 89

Query: 92  SRSGSKILERRKAKGRWYLSH 112
           S++GS++L+RRKAKGRWYL++
Sbjct: 90  SKTGSRVLQRRKAKGRWYLTY 110

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 92.4 bits (228), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 58/77 (75%), Gaps = 1/77 (1%)

Query: 37  GLNSVGLFPGT-ATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSG 95
           G NSV L     ++ T  S+I  L  LQRRWKSRGNTYQPSTLKRKRKFGFLAR  ++  
Sbjct: 22  GKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRT 81

Query: 96  SKILERRKAKGRWYLSH 112
           +KI++RRK KGRWYL+H
Sbjct: 82  AKIIKRRKEKGRWYLTH 98

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.8 bits (229), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 52/84 (61%), Positives = 61/84 (72%), Gaps = 7/84 (8%)

Query: 31  IFRPFAG--LNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLA 88
           + RP +   LNS    P   T +  +   G +G QRRWKSRGNTYQPSTLKRKR FGFLA
Sbjct: 27  VLRPQSSMLLNS----PPMKTMSLTALGFGFIG-QRRWKSRGNTYQPSTLKRKRTFGFLA 81

Query: 89  RARSRSGSKILERRKAKGRWYLSH 112
           RA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 82  RAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%)

Query: 63  QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           QRRWKSRGNTYQPSTLKRKR FGFLARA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 50/55 (90%), Gaps = 1/55 (1%)

Query: 58  GLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           G +G QRRWKSRGNTYQPSTLKRKR FGFLARA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 52  GFIG-QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 91.7 bits (226), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 49/56 (87%)

Query: 57  TGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           TG++ L RRWKSRGNTYQPSTLKRKRKFGFLAR R+   SK+L+RRK KGRWYLSH
Sbjct: 31  TGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 91.3 bits (225), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (82%), Gaps = 3/70 (4%)

Query: 46  GTATNTFG--SAITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERR 102
            T+ +TF   S I+ + GL QRRWKSRGNT+QPSTLKRKR+ GFLARARS++G KIL+RR
Sbjct: 40  NTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRR 99

Query: 103 KAKGRWYLSH 112
           K KGRWYL++
Sbjct: 100 KEKGRWYLTY 109

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 90.5 bits (223), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 61/85 (71%), Gaps = 9/85 (10%)

Query: 28  SSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFL 87
           ++SIF+      SV L    +TN F   I    G Q+RWKSRGNTYQPSTLKRKRKFGFL
Sbjct: 10  NTSIFK------SVILNTVQSTNVF--FILPFFG-QKRWKSRGNTYQPSTLKRKRKFGFL 60

Query: 88  ARARSRSGSKILERRKAKGRWYLSH 112
           +RA+S+  SKIL+ RK KGRWYLSH
Sbjct: 61  SRAKSKQKSKILKDRKEKGRWYLSH 85

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 88.6 bits (218), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 59  LLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           LLGL QRRWKSRGNTYQPSTLKRKR+ GFLARA+++  SKIL+ RK KGRWYL+H
Sbjct: 57  LLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 87.8 bits (216), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%)

Query: 63  QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           QRRWKSRGNT+QPSTLKRKR+ GFLARARS+ GSKIL+RRK KGRW+L+H
Sbjct: 48  QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 88.2 bits (217), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%)

Query: 62  LQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           LQRRWKSRGNTYQPSTLKRKRKFGFLA+AR     KIL+RR+ KGRWYL+H
Sbjct: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 87.8 bits (216), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 41/58 (70%), Positives = 49/58 (84%), Gaps = 1/58 (1%)

Query: 56  ITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
            + L G  QRRWKSRGNTYQPSTLKRKR+ GFLARA+S+ G K+L+RR+ KGRWYL+H
Sbjct: 55  FSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 88.2 bits (217), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%)

Query: 63  QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112
           Q+RWKSRGNTYQPSTLKRKRK+GFL+R R R  SKIL+RRK KGRW+LSH
Sbjct: 92  QKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 85.5 bits (210), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 56/84 (66%), Gaps = 1/84 (1%)

Query: 30  SIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQ-RRWKSRGNTYQPSTLKRKRKFGFLA 88
           + F     LNS+ L   +            L +  RRWKSRGNTYQPSTLKRKRK GFL+
Sbjct: 11  ACFSKSTALNSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKRKRKHGFLS 70

Query: 89  RARSRSGSKILERRKAKGRWYLSH 112
           RA+S + +KIL+RRKAKGRW+LSH
Sbjct: 71  RAKSYTMNKILKRRKAKGRWFLSH 94

>Kpol_413.4 s413 complement(10875..13112) [2238 bp, 745 aa] {ON}
           complement(10875..13112) [2238 nt, 746 aa]
          Length = 745

 Score = 32.7 bits (73), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 21  SGMNRSISSSIFRPFAGLNSVGLFPGTA-TNTFGSAITGLLGLQRRWKSRGN 71
           S M RS+S S+ R F+G   +G  P TA T T  SA+ G++GL    KS  N
Sbjct: 570 SNMTRSLSESVQRSFSG-GVIGQ-PSTAPTPTTSSAMLGMMGLSSDSKSLNN 619

>TPHA0N00220 Chr14 complement(35883..38036) [2154 bp, 717 aa] {ON}
           Anc_7.15 YAL054C
          Length = 717

 Score = 32.0 bits (71), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+  V L P T     G    G+L ++R W S   T
Sbjct: 482 LVTPLAGGITPMKPGSASFPFFGIEPVILDPTTGKEVVGEHAEGVLAIKRPWPSFART 539

>Ecym_5013 Chr5 complement(22206..24371) [2166 bp, 721 aa] {ON}
           similar to Ashbya gossypii ADR408W
          Length = 721

 Score = 32.0 bits (71), Expect = 0.28,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 26/54 (48%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKS 68
           ++T L  G       +   PF G+++V L P T     G  + G+L ++R W S
Sbjct: 486 LITPLAGGSTPMKPGAAGFPFFGIDAVILDPNTGEELIGPNVEGILAVKRPWPS 539

>CAGL0L00649g Chr12 complement(80936..83050) [2115 bp, 704 aa] {ON}
           highly similar to uniprot|Q01574 Saccharomyces
           cerevisiae YAL054c ACS1 acetyl-CoA synthetase
          Length = 704

 Score = 30.8 bits (68), Expect = 0.68,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+ +V L P T      S   G+L ++R W S   T
Sbjct: 469 LVTPLAGGVTPMKPGSASLPFFGIETVILDPTTGEEINDSHAEGVLAIKRPWPSFART 526

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 30.0 bits (66), Expect = 1.0,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 35  FAGLNSV-GLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQ 74
           F  LN+V G   G+A N     + GL+G  +   +R +TY+
Sbjct: 271 FISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYK 311

>KAFR0A01570 Chr1 complement(313408..317076) [3669 bp, 1222 aa] {ON}
           Anc_1.290 YJL080C
          Length = 1222

 Score = 30.0 bits (66), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 13/78 (16%)

Query: 26  SISSSIFRPFAGLNSVGLFPGTATNTFGS-----AITGL--------LGLQRRWKSRGNT 72
           S++ S+  PF  +NS+   PGT    F        I+GL        + +Q+   +  NT
Sbjct: 267 SVTDSLLLPFVQINSIDSIPGTIKCQFFKDTGDIVISGLRDDAKQAKITIQKYLDALANT 326

Query: 73  YQPSTLKRKRKFGFLARA 90
                +K   KF FL  A
Sbjct: 327 LTEQKVKIPTKFQFLIDA 344

>KNAG0E04170 Chr5 (831222..833369) [2148 bp, 715 aa] {ON} Anc_7.15
           YAL054C
          Length = 715

 Score = 29.6 bits (65), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 25/58 (43%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+ +V L P T          G+L ++R W S   T
Sbjct: 480 LVTPLAGGVTPMKPGSASFPFFGIETVILDPTTGQEVTTDHAEGVLAIKRAWPSFART 537

>ZYRO0D04796g Chr4 complement(400656..403256) [2601 bp, 866 aa] {ON}
           some similarites with uniprot|Q08817 Saccharomyces
           cerevisiae YOR353C SOG2 Protein required for cell
           viability
          Length = 866

 Score = 28.9 bits (63), Expect = 2.5,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%)

Query: 23  MNRSISSSIFRPFAGLNSVG----LFPGTATNTFGSAITGL 59
           + RS+SSS+  P +G N  G      P T +NT  S +  L
Sbjct: 471 VGRSLSSSVAHPISGANGTGSNNMFLPRTRSNTLQSKVAPL 511

>Skud_1.8 Chr1 complement(18892..21033) [2142 bp, 713 aa] {ON}
           YAL054C (REAL)
          Length = 713

 Score = 28.9 bits (63), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+++V L P T      S   G+L ++  W S   T
Sbjct: 478 LVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEEVNTSHAEGVLAVKAAWPSFART 535

>Suva_1.12 Chr1 complement(20074..22212) [2139 bp, 712 aa] {ON}
           YAL054C (REAL)
          Length = 712

 Score = 28.9 bits (63), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+++V L P T      S   G+L ++  W S   T
Sbjct: 477 LVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEEIKTSHAEGVLAVKSAWPSFART 534

>YAL054C Chr1 complement(42881..45022) [2142 bp, 713 aa] {ON}
           ACS1Acetyl-coA synthetase isoform which, along with
           Acs2p, is the nuclear source of acetyl-coA for histone
           acetylation; expressed during growth on nonfermentable
           carbon sources and under aerobic conditions
          Length = 713

 Score = 28.5 bits (62), Expect = 4.4,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+++V L P T      S   G+L ++  W S   T
Sbjct: 478 LVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFART 535

>NCAS0A07630 Chr1 (1519397..1521541) [2145 bp, 714 aa] {ON} Anc_7.15
          Length = 714

 Score = 28.1 bits (61), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 24/58 (41%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G       S   PF G+ +V L P T          G+L ++R W S   T
Sbjct: 479 LVTPLAGGCTPMKPGSASFPFFGIETVILDPNTGEEIKDDHAEGVLAVKRAWPSFART 536

>Smik_1.11 Chr1 complement(25820..27961) [2142 bp, 713 aa] {ON}
           YAL054C (REAL)
          Length = 713

 Score = 28.1 bits (61), Expect = 5.4,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 26/58 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+++V L P T      +   G+L ++  W S   T
Sbjct: 478 LVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEEINSTHAEGVLAVKAAWPSFART 535

>KLLA0A03333g Chr1 complement(297542..299665) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|Q01574 Saccharomyces
           cerevisiae YAL054C ACS1 Acetyl-coA synthetase isoform
           expressed during growth on nonfermentable carbon sources
           and under aerobic conditions
          Length = 707

 Score = 27.7 bits (60), Expect = 6.9,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 24/58 (41%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G       +   PF G++   L P T     G    G+L ++R W S   T
Sbjct: 472 LVTPLAGGATPMKPGAAAFPFFGIDLAVLDPTTGIEQTGEHAEGVLAIKRPWPSFART 529

>TBLA0E00720 Chr5 (144667..146844) [2178 bp, 725 aa] {ON} Anc_7.15
           YAL054C
          Length = 725

 Score = 27.7 bits (60), Expect = 6.9,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T L  G+      S   PF G+++V L P T      +   G+L +++ W S   T
Sbjct: 490 LVTPLAGGVTPMKPGSASYPFFGIDAVILDPTTGQEINENHAEGVLAVKQAWPSFART 547

>SAKL0D14608g Chr4 (1204606..1206732) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|Q01574 Saccharomyces cerevisiae
           YAL054C ACS1 Acetyl-coA synthetase isoform expressed
           during growth on nonfermentable carbon sources and under
           aerobic conditions
          Length = 708

 Score = 27.3 bits (59), Expect = 8.4,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 25/58 (43%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNT 72
           ++T +  G+      S   PF G+    L P +     G  + G+L +++ W S   T
Sbjct: 473 LVTPMAGGVTPMKPGSASFPFFGIELAVLDPASGEELKGEPVEGVLAIKKPWPSFART 530

>ADR408W Chr4 (1442382..1444466) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL054C (ACS1)
          Length = 694

 Score = 27.3 bits (59), Expect = 8.7,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 24/54 (44%)

Query: 15  IMTSLTSGMNRSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKS 68
           ++T L  G       S   PF G++   L P T     G  + G+L +++ W S
Sbjct: 459 LVTPLAGGSTPMKPGSASFPFFGIDLAILDPQTGEELLGPNVEGVLAVKQPWPS 512

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,682,549
Number of extensions: 392356
Number of successful extensions: 1122
Number of sequences better than 10.0: 51
Number of HSP's gapped: 1121
Number of HSP's successfully gapped: 51
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)