Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.418.265ON3062949301e-125
Suva_2.2738.265ON3761701564e-11
Smik_4.3588.265ON3711701325e-08
YDR113C (PDS1)8.265ON3731671309e-08
Skud_4.3748.265ON3731701301e-07
ZYRO0C01584g8.265ON2822321235e-07
SAKL0H16962g8.265ON3361431237e-07
TDEL0F039208.265ON3221511131e-05
TPHA0A017808.265ON35233970.001
NCAS0B038308.265ON32534920.005
Ecym_43058.265ON31141840.043
AGR083W8.265ON29525780.25
NDAI0J013508.265ON42248750.58
KNAG0H032308.265ON28134750.59
KLLA0F19206g8.265ON26322730.79
CAGL0L12298g8.265ON28636730.87
KLTH0G13618g8.265ON30247721.3
NOTE: 3 genes in the same pillar as Kpol_543.41 were not hit in these BLAST results
LIST: TBLA0E04460 KAFR0B05510 Kwal_56.23781

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.41
         (306 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...   362   e-125
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    65   4e-11
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    55   5e-08
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    55   9e-08
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    55   1e-07
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    52   5e-07
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    52   7e-07
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    48   1e-05
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    42   0.001
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    40   0.005
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    37   0.043
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    35   0.25 
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    33   0.58 
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    33   0.59 
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    33   0.79 
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    33   0.87 
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    32   1.3  

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 197/294 (67%)

Query: 1   MDQNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASK 60
           MDQNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASK
Sbjct: 1   MDQNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASK 60

Query: 61  DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQHIFQQNKSGILADDRKLKKYG 120
           D                                   KKQHIFQQNKSGILADDRKLKKYG
Sbjct: 61  DNNRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILADDRKLKKYG 120

Query: 121 SVLGYNALPKVKSLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           SVLGYNALPKVKSLV                                             
Sbjct: 121 SVLGYNALPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSINTNKSNSGIGLLSGGNL 180

Query: 181 XXXXRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNXXXXX 240
               RDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSN     
Sbjct: 181 QQLIRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEE 240

Query: 241 XXXXXXXXANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSYGEG 294
                   ANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSYGEG
Sbjct: 241 DSSELLLLANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSYGEG 294

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 73/170 (42%), Gaps = 36/170 (21%)

Query: 2   DQNKENNIF---RHAMLKDMPQTPNNLLKRTHS----------KLKTGI-------AKDI 41
           +++KENNI      +     PQTP +LLKR+HS          +LK  +        K I
Sbjct: 4   NEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNLKYI 63

Query: 42  QGGNVIN--------TSPQKRLPLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 93
           QGG  ++        T PQ RLPLA+KD                                
Sbjct: 64  QGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLST 123

Query: 94  XXXKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
               +     Q        N +G+L + RKL+KYGSVLGYNALPK+KSLV
Sbjct: 124 RKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLV 173

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 206 YIPDDHLPFDENDIAKLKTFNSPFKLE 232
           Y+PD + PF + DI KLKTFNSP+ L+
Sbjct: 269 YVPDGYPPFQQEDILKLKTFNSPYGLD 295

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 70/170 (41%), Gaps = 36/170 (21%)

Query: 2   DQNKENNIFRHAMLK---DMPQTPNNLLKRTHS----------KLKTGI-------AKDI 41
           +++KENNI          + PQTP +LLKR+HS          +LK  +        K I
Sbjct: 4   NEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKYI 63

Query: 42  QGGNVIN--------TSPQKRLPLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 93
           QGG  ++           Q RLPLA+KD                                
Sbjct: 64  QGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSI 123

Query: 94  XXXKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
               +     Q        N S +L + RKL+KYGSVLGYNALPK+KSLV
Sbjct: 124 RKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLV 173

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 188 NEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLE 232
           N D  EIE          Y+PD + PF + DI KLK+FNSP++L+
Sbjct: 251 NADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 71/167 (42%), Gaps = 34/167 (20%)

Query: 3   QNKENNIF---RHAMLKDMPQTPNNLLKRTHSK-LKTGIAKD----------------IQ 42
           ++KENNI      +   + PQTP +LLKR+HS  LK  +  D                IQ
Sbjct: 6   EDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTLKYIQ 65

Query: 43  GGNVIN--------TSPQKRLPLASKDXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXX 92
           GG  ++           Q RLPLA+KD                                 
Sbjct: 66  GGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKN 125

Query: 93  XXXXKKQHIFQQ----NKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
               K   I +     N + +L++ RKL+KYGSVLGYNALPK+KSLV
Sbjct: 126 DQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLV 172

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 23/27 (85%)

Query: 206 YIPDDHLPFDENDIAKLKTFNSPFKLE 232
           Y+P+ + PF ++DI KLKTFNSP+KL+
Sbjct: 271 YVPEGYSPFQQDDIEKLKTFNSPYKLD 297

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 71/170 (41%), Gaps = 36/170 (21%)

Query: 2   DQNKENNIF---RHAMLKDMPQTPNNLLKRTHS----------KLKTGI-------AKDI 41
           +++KENNI      +   + PQTP +LLKR+HS          +LK  +        K I
Sbjct: 4   NEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKYI 63

Query: 42  QGGNVIN--------TSPQKRLPLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 93
           QGG  ++           Q RLPLA+KD                                
Sbjct: 64  QGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSI 123

Query: 94  XXXKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
               +     Q        N + +L + RKL+KYGSVLGYNALPK+KSLV
Sbjct: 124 RKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLV 173

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 206 YIPDDHLPFDENDIAKLKTFNSPFKLE 232
           Y+PD +  F   DI KL+TFNSP++L+
Sbjct: 271 YVPDGYPSFQREDIEKLRTFNSPYELD 297

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 85/232 (36%), Gaps = 49/232 (21%)

Query: 4   NKENNIF----RHAMLKDMPQTPNNLLKRTHSKL-----KTGIAKDIQGGNVINTSPQKR 54
           NKENN+      +  L  +PQTP +LLKR+   +      T + K     +V     Q+R
Sbjct: 8   NKENNVVLDPGENGSLA-LPQTPIHLLKRSQPNVLKPEENTPVKK---SRSVSPVRGQRR 63

Query: 55  LPLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQHIFQQNKSGILADDR 114
           LPLASKD                                   K+Q   Q     +L++ R
Sbjct: 64  LPLASKDHNKSSAAGPVK------------------------KRQPTLQ---GELLSNPR 96

Query: 115 KLKKYGSVLGYNALPKVKSLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 174
           KL+KYGSVLGY  LP+ KSLV                                       
Sbjct: 97  KLQKYGSVLGYTDLPRTKSLV------LKDGDDEDDDEEEENSELQKKLQDAMNRREDSN 150

Query: 175 XXXXXXXXXXRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFN 226
                     RD  +D   IE+  +  P  EY PD H  +++ DI KLK  +
Sbjct: 151 EGLGGLAKLVRDTKDD---IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD 199

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 60/143 (41%), Gaps = 22/143 (15%)

Query: 3   QNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDX 62
           +NKEN IF     +++P TP++LLKR+ S +K          N       KRLPLASKD 
Sbjct: 5   ENKENVIFSS---ENLPTTPSHLLKRSQSFMKP------LASNSPTKKSGKRLPLASKDN 55

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQHIFQQNKSGI----------LAD 112
                                             + + +     S I          L  
Sbjct: 56  NKSNTLINNGQKSALVNLAPNNSLLHGGKLK---RNRPVVSNTGSFINTNTSKSSFPLLP 112

Query: 113 DRKLKKYGSVLGYNALPKVKSLV 135
           D +LKKYGSVLGYN LP+VKSLV
Sbjct: 113 DSRLKKYGSVLGYNGLPRVKSLV 135

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 206 YIPDDHLPFDENDIAKLKTFNSPFKLEQ 233
           ++P+ + PF E+D+ KL TF SPF + +
Sbjct: 228 HVPNGYSPFKESDVIKLNTFTSPFSMHK 255

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 62/151 (41%), Gaps = 25/151 (16%)

Query: 1   MDQNKENNI---FRHAMLKDMPQTPNNLLKRTHSKLK--------TGIAKDIQGGNVINT 49
           +++NKEN++      +     PQTP +LLKR+ S +         + +        V   
Sbjct: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62

Query: 50  SPQKRL-----PLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQHIFQQ 104
           SP +R+     PLASKD                                     Q     
Sbjct: 63  SPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQ----- 117

Query: 105 NKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
               +L + R+LKKYGSVLGYNALPK+KSLV
Sbjct: 118 ----LLTNPRRLKKYGSVLGYNALPKMKSLV 144

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 16/109 (14%)

Query: 192 REIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNXXXXXXXX----XXXX 247
           REIE+         YIP+ HL   + D  KLKTF SP+ +E                   
Sbjct: 212 REIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEDDYSDSDDDKQDGFLQLEE 271

Query: 248 XANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPA-DILDIEPSY-GEG 294
             +  DDE    + +T  +          ++++P  D  +I+PSY GEG
Sbjct: 272 IGSAGDDENIERENLTVKQ----------REMLPQYDTFEIQPSYCGEG 310

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 197 KSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPF 229
           KS A+PD  Y P+ ++PF+  DI KL TF SP+
Sbjct: 237 KSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPY 269

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 102 FQQNKSGILADDRKLKKYGSVLGYNALPKVKSLV 135
           F   K+G L + +KLKKYGSVLG +ALP+ KSL+
Sbjct: 85  FSSRKNG-LNNIKKLKKYGSVLGMDALPRTKSLI 117

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 192 REIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLE 232
           REIE+         ++P  + PF   DI KLKTF+S +KL+
Sbjct: 213 REIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLD 253

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 189 EDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPF 229
           E+V +IE      P+ E+IP+ +  F++ +I KL T+ SPF
Sbjct: 189 EEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 2/25 (8%)

Query: 113 DRKLKKYGSVLG--YNALPKVKSLV 135
           D KLKKYGSVLG  Y  L K KSLV
Sbjct: 94  DSKLKKYGSVLGVNYPHLTKTKSLV 118

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 2/25 (8%)

Query: 113 DRKLKKYGSVL--GYNALPKVKSLV 135
           D KLKKYGSVL  GY +L K KSLV
Sbjct: 88  DSKLKKYGSVLGVGYGSLAKAKSLV 112

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 186 DANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPF 229
           +  EDV  +E+     P+  ++P+ +      D+AKL  ++SPF
Sbjct: 172 ETQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 186 DANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQ 233
           D  +D+     + ++ P   YIP  + PF   DI KLK ++SPF +  
Sbjct: 271 DEEDDIEYAPIREDSLP---YIPQGYTPFTNEDINKLKVYHSPFAIHH 315

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 54/153 (35%), Gaps = 63/153 (41%)

Query: 10  FRHAMLKDMPQTPNNLLKRTHS------------KLKTGIAKDIQGGNVI-NTSP----- 51
           FR       PQTP +LLKR+ S             L+  +  D   G V  N SP     
Sbjct: 29  FRSGKPILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLL 88

Query: 52  --QKRLPLASKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQHIFQQNKSGI 109
             Q R PL+ KD                                       I +Q +   
Sbjct: 89  QLQNRFPLSKKDN----------------------------------NNSFILKQQQQQF 114

Query: 110 LADDRKLKKYGSVLG-------YNALPKVKSLV 135
             D ++LKKYGSVLG       +N L ++KSLV
Sbjct: 115 --DHKRLKKYGSVLGLGTDGNNHNNLTRIKSLV 145

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 192 REIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTF 225
           RE+E +  A  +  YIPD H+   E DIAKL+ +
Sbjct: 169 RELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%), Gaps = 1/22 (4%)

Query: 115 KLKKYGSVLGYNA-LPKVKSLV 135
           KLKKYGSVLG N  +P+ KSLV
Sbjct: 84  KLKKYGSVLGMNTFMPRTKSLV 105

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 189 EDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLE 232
           ED   IE+      +  YIP+ + PFD+  I KL+   SPF++E
Sbjct: 152 EDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 192 REIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNS 227
           REIE  S   P+K Y P+ + P D++D+ KLK  N+
Sbjct: 159 REIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNA 194

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 4/47 (8%)

Query: 186 DANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFN-SPFKL 231
           D++++V  I  +    P   ++P+ + PF E +IAKL+  + SPF+L
Sbjct: 175 DSDQEVEVIPPRPEPLP---HVPEGYTPFGEQEIAKLQGVDVSPFQL 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,632,122
Number of extensions: 951703
Number of successful extensions: 3154
Number of sequences better than 10.0: 19
Number of HSP's gapped: 3198
Number of HSP's successfully gapped: 38
Length of query: 306
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 197
Effective length of database: 40,982,805
Effective search space: 8073612585
Effective search space used: 8073612585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)