Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.408.264ON41441421930.0
TPHA0A017908.264ON4394029821e-130
NCAS0B050308.264ON4334319721e-128
NDAI0B020008.264ON4334309701e-128
ZYRO0C01606g8.264ON4324329281e-122
TDEL0F039108.264ON4294068911e-116
SAKL0H16984g8.264ON4354368171e-105
AGR084C8.264ON4274317971e-102
KLTH0G13640g8.264ON4144307951e-102
Suva_10.1748.264ON4564397971e-102
KNAG0G020508.264ON4324207861e-100
Kwal_56.237828.264ON4144057801e-100
Smik_12.1498.264ON4604387831e-99
Ecym_43068.264ON4344387783e-99
YLR090W (XDJ1)8.264ON4594377778e-99
Skud_12.1588.264ON4554377751e-98
CAGL0L12276g8.264ON4524237621e-96
KLLA0F19184g8.264ON5124237453e-93
NDAI0D010302.243ON4113854585e-52
Kwal_23.48302.243ON4113804509e-51
KNAG0I019002.243ON4093784482e-50
KAFR0J009402.243ON4113854421e-49
TDEL0C046002.243ON4113794385e-49
TBLA0E038102.243ON4103944351e-48
KLLA0F03333g2.243ON4093734332e-48
KLTH0G09394g2.243ON4113754298e-48
TPHA0C031102.243ON4073774281e-47
Skud_14.2682.243ON4103744281e-47
NCAS0G030002.243ON4103954281e-47
YNL064C (YDJ1)2.243ON4093744236e-47
Smik_14.2632.243ON4093744236e-47
CAGL0J09966g2.243ON4073744228e-47
Ecym_32812.243ON4093764221e-46
Suva_14.2772.243ON4093784167e-46
SAKL0E08734g2.243ON4113804141e-45
ZYRO0A01496g2.243ON4123954132e-45
ADL257C2.243ON4103834071e-44
Kpol_1003.122.243ON4083723904e-42
KLTH0G08756g2.218ON4623873602e-37
Ecym_62368.730ON3743653323e-34
KNAG0G028808.730ON3783713272e-33
KAFR0A041608.730ON3783653253e-33
ZYRO0A06226g8.730ON3773803244e-33
SAKL0E09306g2.218ON4613863284e-33
Kwal_23.30612.218ON4583903232e-32
TDEL0B037908.730ON3733623183e-32
Suva_13.3978.730ON3753653131e-31
TDEL0C043502.218ON4623903135e-31
CAGL0F03729g8.730ON3613553042e-30
YMR214W (SCJ1)8.730ON3773653025e-30
Smik_13.4228.730ON3783663018e-30
Kpol_1002.1222.218ON5034483042e-29
Kwal_26.90248.730ON3753652903e-28
KLTH0D12496g8.730ON3753592876e-28
AER427W2.218ON4703802872e-27
NCAS0B005308.730ON3753632832e-27
Skud_13.3838.730ON3753632823e-27
SAKL0H05258g8.730ON3683652823e-27
KLLA0C07260g8.730ON3683662781e-26
Ecym_53842.218ON5034372821e-26
KLLA0E07899g2.218ON4954602775e-26
TPHA0G006308.730ON3933812737e-26
AER346W8.730ON3673582683e-25
NDAI0E008708.730ON3763632673e-25
KNAG0M020202.218ON4603972704e-25
Kpol_1064.408.730ON3873752658e-25
ZYRO0C15048g2.218ON4912812616e-24
TBLA0B034908.730ON3843722517e-23
YNL077W (APJ1)2.218ON5282862547e-23
Skud_14.2532.218ON5322902475e-22
Smik_14.2492.218ON5332792388e-21
NCAS0G028502.218ON4944172371e-20
CAGL0J10296g2.218ON4794452281e-19
TPHA0C029802.218ON5543212282e-19
TBLA0E036602.218ON4484062182e-18
Suva_14.2622.218ON5362782174e-18
TBLA0D026008.61ON5104062084e-17
NDAI0F024502.218ON5303341971e-15
TPHA0D005508.61ON4862801811e-13
Ecym_14508.61ON4924021802e-13
AFR507W8.61ON474701773e-13
Kwal_14.24521.297ON607731695e-12
KLLA0E04423g7.217ON428691651e-11
KAFR0C031608.61ON4983111641e-11
KNAG0I007407.157ON425681622e-11
KLLA0D06402g1.297ON631731623e-11
KAFR0A016201.297ON665701614e-11
TDEL0H022907.217ON387691594e-11
Ecym_43727.217ON579691605e-11
Suva_12.1851.113ON168841515e-11
KLTH0H10032g1.297ON607721589e-11
NDAI0C026101.398ON340651551e-10
SAKL0D06226g1.297ON615701552e-10
Smik_10.1681.297ON649881543e-10
Smik_14.1062.15ON593871534e-10
NDAI0E045607.217ON394681514e-10
Suva_14.1162.15ON600681524e-10
ABL194C2.15ON552831525e-10
TBLA0C014801.398ON353641505e-10
KAFR0L007407.217ON364681505e-10
Skud_14.1102.15ON596681525e-10
KNAG0G011308.61ON500681515e-10
Suva_6.1481.297ON642771526e-10
ZYRO0G21230g1.297ON584701516e-10
NDAI0G042501.398ON363651496e-10
YNL227C (JJJ1)2.15ON590681517e-10
Smik_6.638.61ON5102841507e-10
Kpol_1011.98.61ON4953821508e-10
KAFR0H031501.398ON359651489e-10
KLTH0H12100g1.398ON350701489e-10
KLLA0C02981g1.113ON162891401e-09
NCAS0E029307.217ON387681471e-09
TPHA0C012607.217ON380691471e-09
TPHA0B037601.398ON355651471e-09
TBLA0E024907.217ON366681462e-09
KLLA0D04818g1.398ON354701462e-09
NCAS0A093201.297ON635731482e-09
CAGL0H03707g1.398ON349651462e-09
KLTH0A03740g7.217ON395681462e-09
YJL073W (JEM1)1.297ON645701482e-09
Smik_10.3851.113ON172841392e-09
TBLA0D042407.217ON389691462e-09
CAGL0L00957g7.217ON373691452e-09
Kwal_47.181337.217ON393681452e-09
Skud_10.3191.113ON168841382e-09
ZYRO0E04598g1.398ON357651452e-09
TDEL0D016401.297ON604741463e-09
Kpol_1070.227.217ON380681443e-09
AAL008W1.398ON349651443e-09
TBLA0C027201.297ON715701453e-09
KNAG0F008602.15ON626681454e-09
Kpol_529.212.15ON622691454e-09
CAGL0C04565g1.113ON175731374e-09
TBLA0J018707.157ON470691444e-09
ZYRO0D16390g7.217ON398681435e-09
Kwal_0.2071.398ON353701425e-09
Skud_5.1587.217ON391661435e-09
CAGL0J02750g7.217ON382681426e-09
ADR124C1.297ON611721436e-09
Kpol_457.151.398ON357641417e-09
Suva_5.1507.217ON391661417e-09
NCAS0G013602.15ON616711427e-09
TBLA0G001702.15ON659681428e-09
YNL007C (SIS1)1.398ON352651409e-09
Smik_14.3211.398ON366651409e-09
NDAI0F038002.15ON638711421e-08
TPHA0I011101.297ON666771421e-08
TDEL0B059601.398ON369651401e-08
Skud_13.3232.350ON224711361e-08
Skud_14.3201.398ON368651391e-08
KNAG0H016801.398ON363651391e-08
YMR161W (HLJ1)2.350ON224711351e-08
KNAG0B052401.297ON668711402e-08
Suva_14.3411.398ON359651382e-08
SAKL0D08778g1.398ON348701382e-08
KAFR0A079502.15ON551711392e-08
Smik_5.1737.217ON391661382e-08
NDAI0A028207.157ON482681382e-08
Skud_10.1691.297ON644841392e-08
Smik_15.4378.698ON663751392e-08
KNAG0L013307.217ON396661372e-08
ZYRO0F15400g2.15ON525691382e-08
ZYRO0F03652g8.61ON4622811382e-08
KLTH0B08338g2.15ON590871382e-08
Smik_9.2037.157ON432681373e-08
Kpol_1027.131.297ON641731383e-08
NCAS0G036101.398ON327651363e-08
YER048C (CAJ1)7.217ON391671363e-08
TDEL0H032107.157ON411691363e-08
YOR254C (SEC63)8.698ON663751373e-08
NDAI0G032808.61ON5522941373e-08
TDEL0G028002.350ON225711323e-08
CAGL0J07370g2.15ON623681374e-08
Skud_9.1817.157ON421681364e-08
TPHA0O019402.15ON5982171374e-08
YIR004W (DJP1)7.157ON432681364e-08
KNAG0I008602.350ON219721314e-08
SAKL0E14234g2.15ON678691364e-08
Smik_13.3612.350ON224711315e-08
Suva_13.3402.350ON225751315e-08
KLLA0D19602g2.15ON620721365e-08
NCAS0A132107.157ON414681355e-08
NDAI0G056401.297ON623671355e-08
SAKL0F08052g7.217ON393681346e-08
KLLA0D13464g7.157ON433681346e-08
Kwal_23.44202.15ON592681356e-08
CAGL0H02827g1.297ON656881357e-08
Ecym_12921.398ON347641337e-08
Ecym_63181.297ON624691357e-08
KAFR0H023108.698ON655751357e-08
ZYRO0F15972g1.113ON162671269e-08
CAGL0J01936g7.157ON425681321e-07
YJR097W (JJJ3)1.113ON172841261e-07
Suva_8.3038.698ON664751331e-07
Kwal_23.3578singletonOFF85671201e-07
KLTH0F09944g2.350ON233661281e-07
TPHA0C045902.350ON233711281e-07
NCAS0C048901.398ON367651311e-07
SAKL0F04444g7.157ON429681311e-07
TDEL0E005002.15ON581711312e-07
ZYRO0G03850g7.157ON418681302e-07
KNAG0B018901.92ON370931302e-07
ADR015W7.157ON436681302e-07
Skud_15.4208.698ON665681312e-07
TPHA0G014808.698ON660681312e-07
KNAG0J018408.698ON650681302e-07
KLTH0F13398g7.157ON419681302e-07
SAKL0C05456g1.185ON583751302e-07
KLLA0F03124g5.4ON433921292e-07
TBLA0B037308.698ON693751302e-07
CAGL0I06226g1.185ON455871293e-07
KLLA0E01629g2.350ON231721253e-07
Suva_9.2137.157ON431681283e-07
SAKL0E06050g2.350ON232661253e-07
Ecym_56262.350ON243661254e-07
TPHA0L007907.157ON446681284e-07
Ecym_23748.698ON661681284e-07
KAFR0B047807.157ON423701274e-07
NDAI0H031802.350ON229711244e-07
NDAI0D005001.113ON190961225e-07
AFL190C2.350ON235661245e-07
ZYRO0A07502g2.350ON238751245e-07
NCAS0D009602.350ON224751236e-07
Ecym_44697.157ON433681266e-07
ZYRO0D10934g8.698ON663711276e-07
KNAG0A056502.350ON1751121207e-07
Kpol_526.62.350ON228711227e-07
Kwal_33.135331.113ON161861197e-07
TBLA0A011007.157ON434681257e-07
Kwal_47.179578.61ON4783911258e-07
KNAG0C024501.185ON544661259e-07
Kwal_55.209657.157ON421681259e-07
KLLA0C09823g8.698ON669681251e-06
AFR639W1.113ON156701181e-06
NCAS0I028301.185ON491671251e-06
ZYRO0G18436g1.185ON503651241e-06
TDEL0C036801.185ON556651241e-06
YJL162C (JJJ2)1.185ON583661232e-06
KLTH0G18546gna 1ON283991202e-06
SAKL0H05984g8.698ON658681222e-06
TPHA0A056505.4ON433701212e-06
KAFR0C024507.217ON373921212e-06
Kpol_1072.48.698ON661681223e-06
Smik_10.681.185ON560661213e-06
TBLA0B093802.350ON227711173e-06
Kwal_26.88798.698ON656751213e-06
NCAS0C012208.698ON669621204e-06
NDAI0B006705.4ON431701194e-06
AAL103W8.698ON669681204e-06
KAFR0I026805.4ON433701194e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.40
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   849   0.0  
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   382   e-130
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    379   e-128
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    378   e-128
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   362   e-122
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   347   e-116
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   319   e-105
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   311   e-102
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   310   e-102
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   311   e-102
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   307   e-100
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   305   e-100
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   306   e-99 
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   304   3e-99
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   303   8e-99
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   303   1e-98
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   298   1e-96
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   291   3e-93
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   181   5e-52
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   177   9e-51
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   177   2e-50
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   174   1e-49
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   173   5e-49
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   172   1e-48
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   171   2e-48
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   169   8e-48
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   169   1e-47
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   169   1e-47
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   169   1e-47
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   167   6e-47
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   167   6e-47
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   167   8e-47
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   167   1e-46
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   164   7e-46
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   164   1e-45
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   163   2e-45
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   161   1e-44
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   154   4e-42
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   143   2e-37
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   132   3e-34
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   130   2e-33
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   129   3e-33
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   129   4e-33
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   130   4e-33
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   129   2e-32
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   127   3e-32
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   125   1e-31
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   125   5e-31
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   121   2e-30
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   120   5e-30
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   120   8e-30
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   121   2e-29
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   116   3e-28
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   115   6e-28
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   115   2e-27
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      113   2e-27
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   113   3e-27
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   113   3e-27
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   111   1e-26
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   113   1e-26
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   111   5e-26
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   109   7e-26
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   107   3e-25
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   107   3e-25
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   108   4e-25
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   106   8e-25
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   105   6e-24
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   101   7e-23
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   102   7e-23
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   100   5e-22
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    96   8e-21
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     96   1e-20
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    92   1e-19
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    92   2e-19
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    89   2e-18
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    88   4e-18
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    85   4e-17
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    80   1e-15
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    74   1e-13
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    74   2e-13
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    73   3e-13
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    70   5e-12
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    68   1e-11
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    68   1e-11
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    67   2e-11
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    67   3e-11
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    67   4e-11
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    66   4e-11
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    66   5e-11
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    63   5e-11
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    65   9e-11
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               64   1e-10
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    64   2e-10
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    64   3e-10
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    64   4e-10
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             63   4e-10
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    63   4e-10
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    63   5e-10
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    62   5e-10
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    62   5e-10
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    63   5e-10
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    63   5e-10
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    63   6e-10
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    63   6e-10
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    62   6e-10
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    63   7e-10
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    62   7e-10
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    62   8e-10
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    62   9e-10
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    62   9e-10
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    59   1e-09
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     61   1e-09
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    61   1e-09
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    61   1e-09
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    61   2e-09
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    61   2e-09
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    62   2e-09
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    61   2e-09
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    61   2e-09
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    62   2e-09
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    58   2e-09
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    61   2e-09
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    60   2e-09
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    60   2e-09
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    58   2e-09
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    60   2e-09
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    61   3e-09
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    60   3e-09
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    60   3e-09
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    60   3e-09
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    60   4e-09
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    60   4e-09
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    57   4e-09
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    60   4e-09
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    60   5e-09
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    59   5e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    60   5e-09
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    59   6e-09
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    60   6e-09
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    59   7e-09
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    59   7e-09
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    59   7e-09
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    59   8e-09
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    59   9e-09
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    59   9e-09
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      59   1e-08
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    59   1e-08
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    59   1e-08
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    57   1e-08
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    58   1e-08
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    58   1e-08
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    57   1e-08
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    59   2e-08
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    58   2e-08
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    58   2e-08
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    58   2e-08
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    58   2e-08
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    58   2e-08
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    58   2e-08
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    58   2e-08
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    57   2e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    58   2e-08
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    58   2e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    58   2e-08
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    57   3e-08
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    58   3e-08
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      57   3e-08
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    57   3e-08
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    57   3e-08
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    57   3e-08
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    57   3e-08
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    55   3e-08
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    57   4e-08
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    57   4e-08
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    57   4e-08
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    57   4e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    55   4e-08
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    57   4e-08
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    55   5e-08
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    55   5e-08
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    57   5e-08
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    57   5e-08
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    57   5e-08
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    56   6e-08
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    56   6e-08
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    57   6e-08
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    57   7e-08
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    56   7e-08
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    57   7e-08
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    57   7e-08
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    53   9e-08
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    55   1e-07
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    53   1e-07
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    56   1e-07
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    51   1e-07
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    54   1e-07
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    54   1e-07
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     55   1e-07
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    55   1e-07
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    55   2e-07
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    55   2e-07
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    55   2e-07
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    55   2e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    55   2e-07
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    55   2e-07
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    55   2e-07
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    55   2e-07
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    55   2e-07
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    54   2e-07
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    55   2e-07
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    54   3e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    53   3e-07
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    54   3e-07
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    53   3e-07
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    53   4e-07
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    54   4e-07
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    54   4e-07
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               54   4e-07
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      52   4e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    52   5e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    52   5e-07
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    52   5e-07
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    52   6e-07
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    53   6e-07
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    54   6e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    51   7e-07
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    52   7e-07
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    50   7e-07
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    53   7e-07
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    53   8e-07
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    53   9e-07
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    53   9e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    53   1e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    50   1e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    53   1e-06
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    52   1e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    52   1e-06
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    52   2e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    51   2e-06
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    52   2e-06
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    51   2e-06
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    51   2e-06
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    52   3e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    51   3e-06
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    50   3e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    51   3e-06
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     51   4e-06
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    50   4e-06
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    51   4e-06
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    50   4e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    50   6e-06
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    50   6e-06
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    50   6e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    50   7e-06
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    50   7e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    50   7e-06
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    50   7e-06
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    50   7e-06
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    50   8e-06
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    49   9e-06
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    50   9e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    50   9e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    47   1e-05
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    49   1e-05
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    47   2e-05
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    49   2e-05
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    47   2e-05
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    49   2e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    49   2e-05
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    48   2e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    48   2e-05
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       49   2e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    49   2e-05
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    48   3e-05
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    48   3e-05
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    48   3e-05
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    47   3e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    45   4e-05
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    47   5e-05
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    47   6e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    47   6e-05
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    45   6e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         46   6e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    45   7e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    47   8e-05
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    46   8e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    46   9e-05
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    47   9e-05
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    46   1e-04
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    46   1e-04
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    45   1e-04
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    44   2e-04
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    45   2e-04
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    46   2e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    45   2e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    44   3e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    45   3e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    44   4e-04
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    44   4e-04
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    44   4e-04
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    44   4e-04
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    44   4e-04
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    44   5e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    42   7e-04
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    43   7e-04
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    43   9e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    43   0.001
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    43   0.002
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    42   0.002
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    42   0.002
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    42   0.002
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    42   0.002
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    42   0.002
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    42   0.003
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    41   0.004
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    39   0.013
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    39   0.015
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    39   0.015
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    39   0.017
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    39   0.018
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    38   0.019
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    39   0.020
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    38   0.024
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    38   0.031
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    38   0.032
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    38   0.033
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    38   0.041
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    37   0.044
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    37   0.044
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    37   0.045
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    37   0.046
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    37   0.072
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    37   0.074
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.092
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    37   0.094
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    36   0.11 
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    36   0.12 
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    36   0.12 
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    36   0.16 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    35   0.18 
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    35   0.29 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    35   0.35 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    35   0.37 
NCAS0I00580 Chr9 (95119..95856) [738 bp, 245 aa] {ON} Anc_7.105 ...    34   0.38 
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    34   0.39 
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    35   0.42 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    34   0.56 
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    33   0.90 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    33   1.3  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    33   1.6  
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...    31   1.9  
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    32   1.9  
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    32   2.4  
KLLA0F13068g Chr6 complement(1205686..1208568) [2883 bp, 960 aa]...    32   2.5  
Ecym_2329 Chr2 (642658..643476) [819 bp, 272 aa] {ON} similar to...    32   3.0  
KAFR0G03090 Chr7 complement(643266..646073) [2808 bp, 935 aa] {O...    32   3.0  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    32   3.7  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    32   3.8  
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...    32   4.0  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    31   4.6  
NCAS0H00720 Chr8 (127587..128858) [1272 bp, 423 aa] {ON} Anc_7.332     31   5.2  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    31   5.3  
YJL185C Chr10 complement(82095..82976) [882 bp, 293 aa] {ON}  AT...    31   6.4  
Kwal_14.1634 s14 complement(399243..400358) [1116 bp, 371 aa] {O...    30   8.6  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    30   9.2  

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/414 (100%), Positives = 414/414 (100%)

Query: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60
           MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI
Sbjct: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60

Query: 61  TAAYQTLSDEDKRNEYDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSEL 120
           TAAYQTLSDEDKRNEYDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSEL
Sbjct: 61  TAAYQTLSDEDKRNEYDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSEL 120

Query: 121 YNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFY 180
           YNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFY
Sbjct: 121 YNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFY 180

Query: 181 TTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKG 240
           TTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKG
Sbjct: 181 TTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKG 240

Query: 241 EADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFD 300
           EADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFD
Sbjct: 241 EADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFD 300

Query: 301 DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII 360
           DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII
Sbjct: 301 DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII 360

Query: 361 KIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGEEQTEHDTNPSCAQM 414
           KIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGEEQTEHDTNPSCAQM
Sbjct: 361 KIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGEEQTEHDTNPSCAQM 414

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  382 bits (982), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 205/402 (50%), Positives = 267/402 (66%), Gaps = 20/402 (4%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK-----SIDEGQKLINEIKFKDITAAYQ 65
           +D Y IL V E  T +E+KK YRKLAL+YHPDK       ++  KL  E+KFK+I +AY+
Sbjct: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69

Query: 66  TLSDEDKRNEYDNKKNFEPYFE-SDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGK 124
            LSDE+KR +YD +KNF    + SD+    DG   +     SKDI + L +   +LYNGK
Sbjct: 70  ILSDEEKRKQYDLQKNFRDANQGSDYG---DGINTAFGNQTSKDISIPLKVTIKDLYNGK 126

Query: 125 TIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQN 184
            I+++  RN IC+ C GLGWR++K+GK YVPP  EC+ C+G GYK ++ Q+APGF+T QN
Sbjct: 127 IIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQN 186

Query: 185 VLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE 244
           ++C  C G G+YYKKP S KNFC  CNGK +I+I + I V+IPRGSS+ D II+  +AD+
Sbjct: 187 LVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ 246

Query: 245 ELGKKNAGDLIFEINEIIDSNNDLERYGNH-LINHTHISLAEAITGFENKFIVKTFDDRD 303
           ELGK   GDLIF + EI D    L+RYG+  LI    ISLA+AITGF+ K IVKT D R 
Sbjct: 247 ELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRL 306

Query: 304 LYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIR 363
           L LS P GKVIR GDIL+V+ EGWP++K     G+LY+   IEFP DNW +E NDIIKIR
Sbjct: 307 LRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIR 366

Query: 364 NILPNEKTKRNNIVD----------PINSEYISTFEIVKSLP 395
           N+LP     + +I+            +NSE IS ++ VK LP
Sbjct: 367 NLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLP 408

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  379 bits (972), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 272/431 (63%), Gaps = 30/431 (6%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQ--KLINEIKFKDITAAYQTLSD 69
           D Y +LGVA +AT  +IKK YRKLALQ+HPDK ++     +  +EIKFK+I+AAY+ LSD
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62

Query: 70  EDKRNEYD----------NKKNFEPYFESDFANNHDGNYNSRYR--SRSKDIKVELSLKT 117
           EDKR  YD           ++ ++P FES F    D   +  Y    RS D+K+ L +  
Sbjct: 63  EDKRAHYDLYGSEEEQQRQQRQYDP-FESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMTI 121

Query: 118 SELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAP 177
            ELYNGKT KF   RN IC  C GLGWR +K+G+  VPPE+EC+ C GQG+      LAP
Sbjct: 122 QELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAP 181

Query: 178 GFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNII 237
           GF T +   C  C G GK+Y K NS KN CK C+G+ L      + VS+PRG  +GD I 
Sbjct: 182 GFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIK 241

Query: 238 LKGEADEELGKKNAGDLIFEINEIIDSNND--LERYGNHLINHTHISLAEAITGFENKFI 295
           +  EAD+ELGK   GDLIF I E      D  LER G++ +   +ISLAEA+TGF++KF+
Sbjct: 242 VVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFV 301

Query: 296 VKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINE 355
            KTFD R L LS P GKVIRPG+I++++ EGWP++     FG+LY+ + IEFPPDNW  E
Sbjct: 302 TKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFTE 361

Query: 356 KNDIIKIRNILPNEKTKRNNIV-DPINSEYISTFEIVKSLPQ--EEGEEQTEHDT----- 407
           K+D+ +I+NILP   + +  +  DP+N+E +  FE++++LP   +EG++Q E++      
Sbjct: 362 KSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAESHGE 421

Query: 408 -----NPSCAQ 413
                +P CAQ
Sbjct: 422 YRGEGSPQCAQ 432

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  378 bits (970), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 270/430 (62%), Gaps = 28/430 (6%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
           D Y ILGV   AT  EIKK YRKLALQYHPDK +D   +  NEIKFK+IT+AY+ LSDE+
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62

Query: 72  KRNEYD-----NKKNFEPYFESDFAN--NHDGNYNSRY--RSRSKDIKVELSLKTSELYN 122
           KR  YD     N+  +     +DF N      +Y+S      +SKD+K+ L L   ELYN
Sbjct: 63  KRAHYDLYGDANENEYNNQNANDFFNFETDQPDYDSYAFDNDKSKDVKIPLKLSIQELYN 122

Query: 123 GKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTT 182
           GKT KF + RN IC  C GLGWR +K+G   +P EIEC+KCNG GYK     L PGF TT
Sbjct: 123 GKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTT 182

Query: 183 QNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEA 242
             + C  C G G+ Y KPNS KN CK+C+GK L+  +  ++VS+PRG  N D I ++ EA
Sbjct: 183 DKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEA 242

Query: 243 DEELGKKNAGDLIFEINEIIDSNNDLE--RYGNHLINHTHISLAEAITGFENKFIVKTFD 300
           D+E+GK   GD+I  I E     +D+   R G   + +  +SLAEA+TGF++KF+ K+ D
Sbjct: 243 DQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLD 302

Query: 301 DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII 360
            R L LS P GKVIRPG+I+++K EGWP++   + FG+LYVI++IEFPPDNW +EK+DI 
Sbjct: 303 GRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSDIQ 362

Query: 361 KIRNILP---NEKTKRNNIVDPINSEYISTFEIVKSLPQE--EGEEQTEHDTN------- 408
            +RN+LP   N       I DP+N+E ++TF+I++ LP    E   ++ +DT        
Sbjct: 363 LLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTGDQSDANY 422

Query: 409 -----PSCAQ 413
                P C+Q
Sbjct: 423 DREGPPQCSQ 432

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  362 bits (928), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 192/432 (44%), Positives = 261/432 (60%), Gaps = 36/432 (8%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           Y+ LGV++DAT  EIKK YRKLALQ+HPDK  D+  +  +E++FK+ITAAY+ LSDE+KR
Sbjct: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63

Query: 74  NEYDNKKNFE--PYFESDFANNHDGNYNSRYRS----------------RSKDIKVELSL 115
           ++YD   +    P FE +   N    +NS +                  RS D++V L +
Sbjct: 64  SKYDTYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDDVQVPLKV 123

Query: 116 KTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQL 175
             ++ YNGK  KF + R  +C+ C G GWR ++ G P  PP+  C+ C G+GYK    ++
Sbjct: 124 SMADCYNGKVFKFQSKRKIVCEKCEGSGWR-RRSGGP--PPQTNCKSCQGRGYKEQLRRV 180

Query: 176 APGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDN 235
           APG    Q V C  C G GKY  KP S KN CK C G+ +I+   P+ VSIPRGS +GD 
Sbjct: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240

Query: 236 IILKGEADEELGKKNAGDLIFEINEIIDSNND--LERYGNHLINHTHISLAEAITGFENK 293
           I+ +GEAD+E+GK   GDLIF ++E  +      LER G  LI +  ISLAEAITG  ++
Sbjct: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGL-DR 299

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
            + KT D R L LSTP GKVI PG I++V+ EGWP++ +   FG+LYV+++I FP DNW 
Sbjct: 300 TLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWF 359

Query: 354 NEKNDIIKIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGE--EQTEH------ 405
            EK+D++KIRNILP+E    +   DP N+E +S  ++V  LP   G   +Q  H      
Sbjct: 360 AEKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQYAHEGHASG 419

Query: 406 ----DTNPSCAQ 413
               D  P CAQ
Sbjct: 420 AFPDDGTPQCAQ 431

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  347 bits (891), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 251/406 (61%), Gaps = 30/406 (7%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           YEILGV  DAT  EIKK YRK ALQ+HPDK  DE  +  +E++FK+I AAY+ L DE+KR
Sbjct: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64

Query: 74  NEYDNK--------------------KNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113
             YD                       NF   F S+  N +D +Y  +   RS D++V L
Sbjct: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYD-HYGEQKVDRSADVQVPL 123

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           ++  ++ YNGK+ KF + R  +C  C G GWR + D     PP++EC+KC GQG+K    
Sbjct: 124 NVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRND-HVVPPPQVECKKCGGQGFKQRIR 182

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           +LAPGF TT+N+ C  C G GK   KPN+ KN CK C G  +      + VS+PRGS   
Sbjct: 183 RLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSRQD 242

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNN--DLERYGNHLINHTHISLAEAITGFE 291
           D I+LKGEAD+E+GK   G+L+F I E  +     DL+R+G  LI H  +SLAEAITGF 
Sbjct: 243 DQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGF- 301

Query: 292 NKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDN 351
           +K + KT D R L L  P GKVIRPG+I+++ +EGWP+D    + G+LYV++ IEFPPDN
Sbjct: 302 SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDT--TTSGDLYVVVHIEFPPDN 359

Query: 352 WINEKNDIIKIRNILPNEKTKRNNIV--DPINSEYISTFEIVKSLP 395
           W +E++D+ +++N+LP E T  N  V  DP N+E ++   IV+ +P
Sbjct: 360 WFSERSDLTQVKNVLPGE-TNNNAAVEDDPGNTETVTNINIVEEIP 404

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  319 bits (817), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/436 (42%), Positives = 245/436 (56%), Gaps = 42/436 (9%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           YE+LGVA DA+  EIKK YRKLALQ+HPDK  DE  +  +E+KFK+ITAAY+ LSDED R
Sbjct: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64

Query: 74  NEYDNKKNFEPYFESD-------------FANNHDGNYNSRYRS----------RSKDIK 110
            +YD   +  P                  F     G +    R           R+ D +
Sbjct: 65  KKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
           + L L   ELYNGKT KF + RN +C  C G G R K    P  P  + CQ C G G+K 
Sbjct: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCEGHGHKE 182

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
              ++A GF   + V C  C G G+    P  P++ CK C+GKC+I  +  + V IPRGS
Sbjct: 183 RIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
            NGD + L+GEAD+E   K  GDL+F I E  +++ +LER G+ L     ISL+EAITGF
Sbjct: 241 RNGDIVKLEGEADQE-PDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPD 350
           E K +  T DDR L L  P+GKVIRPG+ + ++NEGWP+D  G  FG++YV + IEFPPD
Sbjct: 300 E-KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358

Query: 351 NWINEKNDIIKIRNILPNEKTKR-NNIVDPINSEYISTFEIVKS-------LPQEEGEEQ 402
           NW +EK+D+  +R +LP     R  +  D  N+E +  + +VKS       L  E+GE Q
Sbjct: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSYEKGEYQ 418

Query: 403 TEHD-----TNPSCAQ 413
            +         P CAQ
Sbjct: 419 GQEQEYGAFEEPQCAQ 434

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  311 bits (797), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/431 (39%), Positives = 246/431 (57%), Gaps = 39/431 (9%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           RD YE+LG+A  A+ +E+K+ YR+LAL+YHPDK  DE ++  +E KFK+I+AAY  LSDE
Sbjct: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62

Query: 71  DKRNEYDNKKNFEPYFESDFANNHDGNYNSRYR------------------SRSKDIKVE 112
            KR EYD     +  +  D   + D ++ + +R                   R+ D  V 
Sbjct: 63  QKRAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGRTADSTVP 122

Query: 113 LSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMK 172
           L L T +LY GKT +F   R  +C  C G G R +   +P     I C+ C GQGYK   
Sbjct: 123 LKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM----IRCEGCEGQGYKERI 178

Query: 173 VQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSN 232
            ++ PG  + + V C+ C G GK  + P +  + CK C GKC+++ +  I V +PRGS +
Sbjct: 179 SRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236

Query: 233 GDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFEN 292
           GD +   G++D E GK+  GDL+F I+E  D ++ LER G  L     ISLAEA+TGF  
Sbjct: 237 GDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGF-T 294

Query: 293 KFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNW 352
           + + +TFD+R L ++ P+GKV+RPG+ L+  NEGWP++  GA FG++YV + IEFP DNW
Sbjct: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDNW 353

Query: 353 INEKNDIIKIRNILPN-EKTKRNNIVDPINSEYISTFEIVK---SLP-----QEEGEEQT 403
            NEK ++  IRNILP           DP N+E +  + I+     LP     + +G  + 
Sbjct: 354 FNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQ 413

Query: 404 EHDT---NPSC 411
           +H++    P C
Sbjct: 414 QHESTAGTPEC 424

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  310 bits (795), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/430 (42%), Positives = 246/430 (57%), Gaps = 44/430 (10%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
           D YE LGVA DAT +EIKK YR+LALQ+HPDK  DE  +  +EIKFK++ AAY+ LS+E+
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61

Query: 72  KRNEYDNKKNFEPYFESDFANNHDGNYNS--------RYR----------SRSKDIKVEL 113
           KR  YD   +    F  D++   DG++ S        RY+           R+ D  V +
Sbjct: 62  KRQNYDTYGDTNG-FSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
            L   ELYNGKTI+F   RN +C  C G G R +            C +C G G K    
Sbjct: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHAS------ACSQCEGHGVKQRLR 174

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           +L PGF T + V C  CKG GK  +     ++ CK C+GK +      + V IPRGS +G
Sbjct: 175 RLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
           D ++LKGEADEE GK   GDL+F+I E   S++ LER G+ L     ISL++A+TGFE K
Sbjct: 231 DRVVLKGEADEEPGKI-PGDLVFDIAENSASSS-LERRGSDLYAKITISLSDALTGFE-K 287

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
            +  T D R L L  P G+V+RPG+ + + NEGWP+D  G+ FG++YV ++IEFPPD+W 
Sbjct: 288 EVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWF 347

Query: 354 NEKNDIIKIRNILPNEKTKR------NNIVDPINSEYISTFEIVKS---LPQEEGEEQTE 404
           +E++D+  ++N+LP   +         +  DP N+E    F IVKS   LPQ   EE   
Sbjct: 348 SERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEES-- 405

Query: 405 HDTNPSCAQM 414
            +  P CAQ 
Sbjct: 406 -EPGPQCAQQ 414

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  311 bits (797), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/439 (41%), Positives = 253/439 (57%), Gaps = 47/439 (10%)

Query: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60
           MS +D  S+DR  Y++LGV  +A+ +EIK  YRKLAL++HPDKS+D+  K +NE KFK+I
Sbjct: 1   MSGSD--SKDR-LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEI 57

Query: 61  TAAYQTLSDEDKRNEYD------------------------NKKNFEPYFESDFANNHDG 96
           TAAY+ LSD +K++ YD                        N  N   +  +DF N H+ 
Sbjct: 58  TAAYEILSDPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHE- 116

Query: 97  NYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPP 156
            Y     + SKDI ++LS    +LY GK +KF   R  IC  C G GW+ KK  K +V  
Sbjct: 117 MYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTH 174

Query: 157 EIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLI 216
           E+EC+ C G+G K    +  PG   +Q V+C  C G GKY K+P + KNFC DC    L 
Sbjct: 175 EMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQ 234

Query: 217 KIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE----IIDSNNDLERYG 272
              + I V++P G    D + +KG ADEE+ K   GDLIF + E    +      ++++G
Sbjct: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFG 294

Query: 273 ----NHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP 328
                 L     +SL+EA+TGFE KF+ +TFDDR L LS   GKVIRPGDI+++ NEGWP
Sbjct: 295 GGNLQDLYVSITVSLSEALTGFE-KFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWP 353

Query: 329 -MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNIV-------DPI 380
            +D      G+LYV ++IEFPPDNW NEK++++ I+  LP+  ++ +N          PI
Sbjct: 354 ILDHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPI 413

Query: 381 NSEYISTFEIVKSLPQEEG 399
           NSE +S F+I+ S    EG
Sbjct: 414 NSETVSNFQIIHSDDLPEG 432

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/420 (39%), Positives = 245/420 (58%), Gaps = 19/420 (4%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           Y+ILGV  D+T +EI+K YRKLAL++HPDK ID  +K  NE+KFK+IT AY+ LS+ +  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 74  NEYDNKKNFEPY---FESDFANNHDGNYNSRY---------RSRSKDIKVELSLKTSELY 121
            E + +   + Y   F  DF N  +   N+            S ++  ++E+ +   +LY
Sbjct: 67  EEMEEEYEGQGYGFNFGDDFMNFFNEGRNAHPMGGHPQREDESTNEATQIEIEVTLKDLY 126

Query: 122 NGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYT 181
           NGK +KF  +RN IC  C+G  WR +K+G  Y PP + C KC G GY    V  +P F  
Sbjct: 127 NGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSPFFQY 186

Query: 182 TQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGE 241
            Q + C  C G G+Y  KP S KN CK C+G+ LIK    ++V+IPRGS N + II K +
Sbjct: 187 VQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEK 246

Query: 242 ADEELGKKNAGDLIFEINEIIDSNND-----LERYGNHLINHTHISLAEAITGFENKFIV 296
            DE+L  + AGD++F +    + N       + + G  L  +  I L EAI+G + +F+ 
Sbjct: 247 GDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLT 306

Query: 297 KTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEK 356
           KTFDDR L L+ P+GKV+RPGD + +K EGWP    G  FG+++V + +EFPPDNWI+E+
Sbjct: 307 KTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISER 366

Query: 357 NDIIKIRNILPNEKTKRNNIV--DPINSEYISTFEIVKSLPQEEGEEQTEHDTNPSCAQM 414
           NDI  + N+LP  K+   +    D  N+E++  +EI+K+  +      T+  + P    +
Sbjct: 367 NDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASRPPAQGL 426

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  305 bits (780), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/405 (42%), Positives = 237/405 (58%), Gaps = 37/405 (9%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
           D Y+ LGVA DAT +EIKK YR+LALQ+HPDK  DE  +  +EIKFK++ AAY+ LS+E+
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61

Query: 72  KRNEYDNKKNFEPY-----------FESDFANNHDGNY------NSRYRSRSKDIKVELS 114
           KR  YD   +   Y           F S F N   G Y       +  R R+ D  V L 
Sbjct: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSLR 121

Query: 115 LKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQ 174
           L   +LYNGKT++F ++RN +C  C G G R +            C  C G G K    +
Sbjct: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHAS------ACTHCEGHGVKQRLRR 175

Query: 175 LAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGD 234
           L PGF T + V C+ C+G GK  +     ++ CK C+GK +      + V IPRGS + D
Sbjct: 176 LGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231

Query: 235 NIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKF 294
            I+L+GEADEE GK   GDL+F+I+E   ++N LER G+ L     ISL++A+TGFE K 
Sbjct: 232 RIVLEGEADEEPGKL-TGDLVFDISEDSTTSN-LERRGSDLHTKIIISLSDALTGFE-KE 288

Query: 295 IVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWIN 354
           +  T D RDL L  P G+VIRPG+ + +KNEGWP+D  G  FGN+YV + IEFPPD+W +
Sbjct: 289 VCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYS 348

Query: 355 EKNDIIKIRNILPNEKTKRNNIV------DPINSEYISTFEIVKS 393
           E+ +I  +RNI+P   +            DP+N+E + TF+I+KS
Sbjct: 349 ERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKS 392

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  306 bits (783), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 182/438 (41%), Positives = 246/438 (56%), Gaps = 52/438 (11%)

Query: 7   SSEDRDY--YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAY 64
           S  DR Y  Y++LGV  DA+ +EIK  YRKLAL++HPDK +D+  K +NEIKFK+ITAAY
Sbjct: 2   SGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAY 61

Query: 65  QTLSDEDKRNEYD------------------NKKNFEPYFESDFANNHDGN--------Y 98
           + LSD +K++ YD                  +      +     + +H+GN        Y
Sbjct: 62  EILSDPEKKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTY 121

Query: 99  NSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEI 158
                  SKDI +++ L   +LY GK +KF   R  +C  C+G GW+ KK  K +V  E+
Sbjct: 122 EEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIHVTHEV 179

Query: 159 ECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKI 218
           EC+ C G+G K    +  PG   +Q V C  C G GKY K+P +PKNFC DC G  L   
Sbjct: 180 ECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSK 239

Query: 219 DDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE---------IIDSNNDLE 269
            + I V++  G    D I +KG ADEEL K   GDL F + E         I   N D E
Sbjct: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFD-E 298

Query: 270 RYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP- 328
                L     ISL+EA+TGFE KF+ +TFDDR L LS   G+VIRPGD++++ NEGWP 
Sbjct: 299 GSAEDLYTSATISLSEALTGFE-KFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPI 357

Query: 329 MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNE-----KTKRNNIVD---PI 380
           MD      G+LYV + IEFPPDNW NEK++++ I+ +LP+      +T  N   D   PI
Sbjct: 358 MDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPI 417

Query: 381 NSEYISTFEIV--KSLPQ 396
           N+E IS F+I+  + LP+
Sbjct: 418 NNETISNFQIINMEELPE 435

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  304 bits (778), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 260/438 (59%), Gaps = 46/438 (10%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +D Y +LG+  +AT +E+K+ YR LAL YHPDK  DE Q+  +E KFK+I+AAY  LSDE
Sbjct: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62

Query: 71  DKRNEYDNKKNFE----PY--FESDFANNHD----------GNYN------SRYRSRSKD 108
            KR+EYD+   F+    P+  F+ D+   ++          G Y        +   ++KD
Sbjct: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122

Query: 109 IKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGY 168
             V L L T +LY GKT +F   RN +C  C GLG R +     +  P ++C  C+G+G+
Sbjct: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR---AAHCMP-MKCGICDGRGF 178

Query: 169 KNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPR 228
           K    +++PGF + + V C  C G G    +   P + CK C+GKC+I  +  + + +PR
Sbjct: 179 KERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSILTLYVPR 236

Query: 229 GSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAIT 288
           G  + D I + G+AD E GK+  GDL+FEI+EI D + +LER G  L     ISLAEA+T
Sbjct: 237 GHRHADTIRIDGQADMEAGKE-TGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALT 295

Query: 289 GFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
           GF  + + +TFDDR L ++ P GKV+RPG+ L+  NEGWP++  G+ FG+LYV + IEFP
Sbjct: 296 GF-TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFP 353

Query: 349 PDNWINEKNDIIKIRNILPNEKTKRNNIV----DPINSEYISTFEIVK---SLP---QEE 398
            DNW+NEK+++  I++ILP  K   N+      DP N+E I+++ +++    LP    +E
Sbjct: 354 KDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQE 413

Query: 399 GEEQT-----EHDTNPSC 411
           G++++     E +T   C
Sbjct: 414 GQQRSNQQYGERNTASEC 431

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  303 bits (777), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 178/437 (40%), Positives = 245/437 (56%), Gaps = 47/437 (10%)

Query: 6   GSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQ 65
           GS      Y++LGV  DAT +EIK  YRKLAL++HPDK +D+  K +NEIKFK+ITAAY+
Sbjct: 3   GSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYE 62

Query: 66  TLSDEDKRNEYDNKKNFEPYFESDFAN------------------NHDGN--------YN 99
            LSD +K++ YD   +      S  AN                  +HDGN        Y 
Sbjct: 63  ILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYE 122

Query: 100 SRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIE 159
               + SKDI +++SL   +LY GK +KF+  R  IC  C+G GW+ K+  K +V  ++E
Sbjct: 123 EGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVE 180

Query: 160 CQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKID 219
           C+ C G+G K    +  PG   +Q V+C  C G GKY K+P +PKNFC DC G  L+   
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240

Query: 220 DPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE---------IIDSNNDLER 270
           + I V++  G    D I +KG ADEE+ K   GDL F + E         I   N D + 
Sbjct: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD-DG 299

Query: 271 YGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP-M 329
            G  L     ISL+EA+TGFE KF+ KTFDDR L LS   G+V+RPGD +++ NEGWP +
Sbjct: 300 AGEDLYTSITISLSEALTGFE-KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPIL 358

Query: 330 DKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNIV-------DPINS 382
           D      G+LYV + IEFPPDNW NEK++++ I+  LP+  +  ++         +  N+
Sbjct: 359 DNPHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNN 418

Query: 383 EYISTFEIVKSLPQEEG 399
           E IS F I+ +    EG
Sbjct: 419 ETISNFRIIHTDDLPEG 435

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  303 bits (775), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 177/437 (40%), Positives = 252/437 (57%), Gaps = 44/437 (10%)

Query: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60
           MSD+D    +   Y +LGV  DA  +EIK  YRKLAL++HPDK +D+  K +NEIKFK+I
Sbjct: 1   MSDSD---RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEI 57

Query: 61  TAAYQTLSDEDKRNEYD---------NKKNFEPY---------FESDFANNHDGN-YNSR 101
           TAAY+ LSD +K++ YD         N    + +                 H+GN +++ 
Sbjct: 58  TAAYEILSDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNE 117

Query: 102 YR-------SRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYV 154
           Y+       + SKDI +++SL   +LY GK ++F+  R  +C  C+G GW+TKK  + +V
Sbjct: 118 YKMYEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHV 175

Query: 155 PPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKC 214
             E+EC+ C G+G K    +  PG   +Q V+C  C G GKY K P +PKNFC DC G  
Sbjct: 176 THEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVG 235

Query: 215 LIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE----IIDSNNDLER 270
           L    + I V +  G    D I ++G ADEE+GK   GDL F +NE           L+ 
Sbjct: 236 LQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKN 295

Query: 271 YGNHLINHTH----ISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEG 326
           +G+  +  ++    ISL+EA+TGFE KF+ KTFDDR L LS   G+VIRPGD+L++ NEG
Sbjct: 296 FGDGNMEDSYVSVTISLSEALTGFE-KFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEG 354

Query: 327 WP-MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILP---NEKTKRNNIVDPINS 382
           WP +D      G+LYV + IEFPPDNW NEK++++ I+  LP   +      +  D IN+
Sbjct: 355 WPILDDARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINN 414

Query: 383 EYISTFEIVKSLPQEEG 399
           E +S F+I+ +    EG
Sbjct: 415 ETVSNFQIIHTDDLPEG 431

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  298 bits (762), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 173/423 (40%), Positives = 247/423 (58%), Gaps = 42/423 (9%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-----DEGQKLINEIKFKDITAAYQT 66
           DYY +LGV +DA+ +EIK+ YRKLAL++HPDK+      ++    + ++ FK++TAAYQ 
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61

Query: 67  LSDEDKRNEYDNKKNFE--PYFESDFAN-----------NHDGNYNS---RYRSRSKDIK 110
           LSD   R EYD K  FE  PY + DF N            H   ++S     R +S DI+
Sbjct: 62  LSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGARRYKSDDIE 121

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRT------KKDGKPYVPPEIECQKCN 164
           ++L +KTSELY GK + FN  R + C+ C+G GW++      KK  K +      C+ C 
Sbjct: 122 IDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNV---CEGCE 178

Query: 165 GQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDC--NGKC-LIKIDDP 221
           GQG +    QLAPGF TT+ + C  C G GK    P S KN C DC  +G   +++ +  
Sbjct: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           + ++I +G+ +GD I+LKGEADE+L     GDL+ +I E+ +   D+ R G  LI    I
Sbjct: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYG------AS 335
            LA+AI GF+ K +++T+D R L  S+ +GKVIRP DI+ ++NEGWP  +          
Sbjct: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358

Query: 336 FGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNIVDP---INSEYISTFEIVK 392
            G+LYVI++I FPPDNW  E ND   +RNI+P+   KR +       +N E I+  EIVK
Sbjct: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVK 418

Query: 393 SLP 395
            +P
Sbjct: 419 EIP 421

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  291 bits (745), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 168/423 (39%), Positives = 244/423 (57%), Gaps = 40/423 (9%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           Y++LGV +DAT  EI+K YRKLAL+YHPDK IDE ++  +E  FK++TAAY+ LSD + +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 74  NEYD-------------------NKKNFEPYFESDFANNH--DGNYNSRYR------SRS 106
           + YD                      +F  +F+      H    +Y++R++       R+
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193

Query: 107 KDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQ 166
            D ++   + T +LY GKT+ F   R  +C  C+G G R K     +  PEI C  CNGQ
Sbjct: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH----FQKPEISCTSCNGQ 249

Query: 167 GYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSI 226
           G+K    +LA G+    + +C  CKG G+Y KK  S  + CK C+GK LI  +    V I
Sbjct: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKK--SASDTCKHCSGKGLINEEKSQTVYI 307

Query: 227 PRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEA 286
           PRGS +GD   L   AD E GK+  GD+I  I+E   S + LER  N L    +ISL +A
Sbjct: 308 PRGSRHGDEFRLPQMADMEYGKE-TGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVDA 365

Query: 287 ITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIE 346
           +TGF +  + +T+D+R L ++ P GKVIRPG+  + K EGWP+   G SFG++YV + IE
Sbjct: 366 LTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIE 423

Query: 347 FPPDNWINEKNDIIKIRNILPNEKTKRNNIVDPINSEYISTFEIVKS---LPQEEGEEQT 403
           FP DNW NEK++I  +RNILP  K+K     DP+N+E + ++ ++ S   LP    EE+ 
Sbjct: 424 FPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483

Query: 404 EHD 406
           +++
Sbjct: 484 KYN 486

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  181 bits (458), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 186/385 (48%), Gaps = 44/385 (11%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D  +Y+ILGV+  A+  EIKK YRK AL+YHPDK+  E        KFK+ +AAY+ LS
Sbjct: 3   KDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAE----KFKEASAAYEVLS 58

Query: 69  DEDKRNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDI 109
           D++KR  YD                        +  F   F     G    R   R +DI
Sbjct: 59  DDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRDI 118

Query: 110 KVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYK 169
           K ELS    ELY G+T K   ++  +CKTC G G +     K        C  CNGQG K
Sbjct: 119 KHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGVK 170

Query: 170 NMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRG 229
            +  Q+ P     Q   C  C G G        PK+ CK CN K +      + V I  G
Sbjct: 171 FVTRQMGPMLQRFQ-AECEVCHGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPG 225

Query: 230 SSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITG 289
             +G  ++ KGEAD +      GD+IF +++    +   +R G+ L+    I L  AI G
Sbjct: 226 MKDGQKVVFKGEAD-QAPDIIPGDVIFVVSQ--KPHEHFQRAGDDLVYEAEIDLLTAIAG 282

Query: 290 FENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPP 349
            E  F +K      L ++   G+VI PG    + ++G P+ KYG  +GNL V   I+FPP
Sbjct: 283 GE--FAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGG-YGNLIVKFNIKFPP 339

Query: 350 DNWINEKNDIIKIRNILPNEKTKRN 374
           +++ +E++ + K+  ILP  +TK N
Sbjct: 340 NHFTDEES-LKKLEEILP-PRTKTN 362

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  177 bits (450), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 128/380 (33%), Positives = 186/380 (48%), Gaps = 48/380 (12%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D  +Y++LGV+ DA   +IKK YRK AL++HPDK+  E        KFK++T AY+ LS
Sbjct: 3   KDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAA----DKFKELTVAYEILS 58

Query: 69  DEDKRNEYDNKKNFEPYFESD----------------FANNHDGNYNSRYRS--RSKDIK 110
           D  KR+ YD                            F+    G  + R R   + +DIK
Sbjct: 59  DSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIK 118

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
            E+S    ELY G+T K   ++  +CKTC G G +     K        C  CNGQG K 
Sbjct: 119 HEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK--------CSSCNGQGIKF 170

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDP---IVVSIP 227
           +  Q+ P     Q   C  C G G        PK+ CK CNGK   KID+    + V I 
Sbjct: 171 ITRQMGPMIQRFQ-AECDVCSGTGDII----DPKDRCKSCNGK---KIDNERKILEVHIE 222

Query: 228 RGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAI 287
            G  +G  I+ +GEAD+  G    GD++F I++    +   ER G+ L+    + L  AI
Sbjct: 223 PGMKDGQKIVFQGEADQAPG-IIPGDVVFVISQ--RPHKHFERKGDDLLYQAEVDLLSAI 279

Query: 288 TGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEF 347
            G E  F ++      L +S   G+VI PG    ++ +G P+ KYG  +GNL V  +I F
Sbjct: 280 AGGE--FAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIVTFKINF 336

Query: 348 PPDNWINEKNDIIKIRNILP 367
           P +++ +E++ + K+  ILP
Sbjct: 337 PTNHFADEES-LKKLEEILP 355

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 181/378 (47%), Gaps = 44/378 (11%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++LGV+  AT  EIKK YRK+AL++HPDK+  E        KFK+ ++AY+ LS
Sbjct: 3   KDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 69  DEDKRNEYDN------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIK 110
           D DKR+ YD                       +  F   F     G    R   R +DIK
Sbjct: 59  DADKRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGA--GAQRPRGPQRGRDIK 116

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
            E+++   ELY GKT K   ++  +CKTC G G +     K        C  CNGQG K 
Sbjct: 117 HEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGIKF 168

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
           +  Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  G 
Sbjct: 169 VTRQMGPMIQRFQTE-CDVCHGAGDIV----DPKDRCKSCNGKKVASERKILEVHVDPGM 223

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
            NG  ++ KGEAD+       GD++F INE    +   +R G++L+    + L  AI G 
Sbjct: 224 KNGQKVVFKGEADQAP-DVIPGDVVFVINE--KPHKHFQRSGDNLVYEAEVDLLTAIAGG 280

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPD 350
           E  F ++      L ++   G+VI PG    +  +G P+ KYG  +GNL +   ++FP  
Sbjct: 281 E--FAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPEP 337

Query: 351 NWINEKNDIIKIRNILPN 368
           ++  E+N + K+  ILP 
Sbjct: 338 HFTTEEN-LKKLEEILPQ 354

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  174 bits (442), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 133/385 (34%), Positives = 188/385 (48%), Gaps = 44/385 (11%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           Y+ILGV+  A+  EIKK YRK AL+YHPDK+  E        KFK+ ++AY+ LSD +KR
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE----KFKEASSAYEVLSDSEKR 63

Query: 74  NEYDN--------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVELSLKT 117
           + YD                     + E  F+    G   SR R   R +DIK E+S+  
Sbjct: 64  DIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRDIKHEISVSL 123

Query: 118 SELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAP 177
            ELY GKT K   ++  +CKTC G G +     K        C  CNGQG K +  Q+ P
Sbjct: 124 EELYKGKTSKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGIKFVTRQMGP 175

Query: 178 GFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNII 237
                Q   C  C G G         K+ CKDC+GK +      + V++  G  NG  ++
Sbjct: 176 MIQRFQTE-CDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKVV 230

Query: 238 LKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVK 297
            KGEAD+       GD+IF I+E    +   +R G+ LI    I L  A+ G E  F ++
Sbjct: 231 FKGEADQAP-DIIPGDVIFVISE--KPHKHFQRVGDDLIYEAEIDLLTAVAGGE--FALE 285

Query: 298 TFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKN 357
                 L +S   G+VI P     V+ +G P+ KYG  +GNL +   I+FP +++ +E +
Sbjct: 286 HVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLIIKFSIKFPENHFADE-D 343

Query: 358 DIIKIRNILPNEKT----KRNNIVD 378
            + K+  ILP  K      +N IVD
Sbjct: 344 TLKKLEEILPARKPLPTFPKNAIVD 368

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  173 bits (438), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 186/379 (49%), Gaps = 46/379 (12%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQT 66
           +D  YY++LGV+  AT  EIKK YRK AL+YHPDK  S +  +      KFK++++AY+ 
Sbjct: 3   KDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE------KFKEVSSAYEV 56

Query: 67  LSDEDKRNEYDNKKNFEPYFE------------------SDFANNHDGNYNSRYRSRSKD 108
           LSD +KR  YD                            S F     G    R   R +D
Sbjct: 57  LSDSEKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRGRD 116

Query: 109 IKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGY 168
           IK E+++   ELY G+T K   ++  +CK CNG G +     K        C  CNGQGY
Sbjct: 117 IKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK--------CSSCNGQGY 168

Query: 169 KNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPR 228
           K +  Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  
Sbjct: 169 KFVTRQMGPMIQRFQTE-CEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDP 223

Query: 229 GSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAIT 288
           G  +G  I+ KGEAD+       GD+IF ++E    + + +R G+ L+    I L  A+ 
Sbjct: 224 GMKDGQKIVFKGEADQAP-DVIPGDVIFVVSE--KPHKNFQRVGDDLVYEAEIDLLTAVA 280

Query: 289 GFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
           G E  F ++      L ++   G+VI PG    V+ +G P+ K+G  +GNL V  +I FP
Sbjct: 281 GGE--FSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLVTFKINFP 337

Query: 349 PDNWINEKNDIIKIRNILP 367
           P+++ +++N + K+  ILP
Sbjct: 338 PNHFTSDEN-LKKLEEILP 355

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  172 bits (435), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 128/394 (32%), Positives = 190/394 (48%), Gaps = 48/394 (12%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTL 67
           +D  +Y+ILGV+  A+  EIKK YRK AL+YHPDK+   E  +     KFK+ +AAY+ L
Sbjct: 3   KDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE-----KFKECSAAYEVL 57

Query: 68  SDEDKRNEYDN----------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDI 109
           SD +KR+ YD                    F  + +  F+    G  + R R   + +DI
Sbjct: 58  SDPEKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDI 117

Query: 110 KVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYK 169
           K E++    ELY G+T K   ++  +CK+C G G +     K        C  C GQG K
Sbjct: 118 KHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADAVKK--------CSSCGGQGIK 169

Query: 170 NMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRG 229
            +  Q+ P     Q   C  C G G        PK  CK C+GK +      + V I  G
Sbjct: 170 FVTKQMGPMIQRFQTE-CDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPG 224

Query: 230 SSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITG 289
             +G  I+ KGE+D+       GD++F +NE    +   +R GN L+    I L  AI G
Sbjct: 225 MKDGQRIVFKGESDQAP-DIIPGDVVFVVNE--KPHKHFQRSGNDLVYLAEIDLLTAIAG 281

Query: 290 FENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPP 349
            E  F ++      L ++   G+VI PG    ++ +G P+ KYG  +GNL +   I+FP 
Sbjct: 282 GE--FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLIIQFNIKFPE 338

Query: 350 DNWINEKNDIIKIRNILPNEKTKRNNIVDPINSE 383
           +++ +E N + K+  ILP     RN +  P  +E
Sbjct: 339 NHFTDESN-LKKLEEILP----PRNKVTIPAKAE 367

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  171 bits (433), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 184/373 (49%), Gaps = 38/373 (10%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++LGV+  A   +IKK YRK AL++HPDK+  E        KFK+IT+AY+ LS
Sbjct: 3   KDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE----KFKEITSAYEILS 58

Query: 69  DEDKRNEYDN------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVELS 114
           D  KR  YD                    F  D  +   G  +SR R   + +DI+ E+ 
Sbjct: 59  DSQKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHEIP 118

Query: 115 LKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQ 174
               +L+ G+T K   ++  ICK+C G G +     K        C  C+GQG+K +  Q
Sbjct: 119 ATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVKK--------CTACSGQGFKFVTRQ 170

Query: 175 LAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGD 234
           + P     Q V C  C G G+       PK  CK C+GK ++     + V+I  G  +G 
Sbjct: 171 MGPMIQRFQ-VECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQ 225

Query: 235 NIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKF 294
            I+ +GEAD+  G    GD++F ++E    +   +R GN L     I L  AI G   +F
Sbjct: 226 RIVFQGEADQSPG-IIPGDVVFVVSE--QPHPVFKRDGNDLHYDAEIDLLSAIAG--GQF 280

Query: 295 IVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWIN 354
            VK      L +    G+VI PG +  ++ +G P+ KYG  +GNL +   I+FPP ++ +
Sbjct: 281 AVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGG-YGNLLIKFNIKFPPAHFTD 339

Query: 355 EKNDIIKIRNILP 367
           ++  + K+  ILP
Sbjct: 340 DET-LKKLEEILP 351

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  169 bits (429), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 182/375 (48%), Gaps = 47/375 (12%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y++LGV  DA   +IKK YRK AL++HPDK+           KFK++T AY+ LSD  K
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDKN----PSAEAADKFKELTVAYEVLSDSQK 62

Query: 73  RNEYDN---------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVELSL 115
           R+ YD                       F  D  +   G   SR R   + +DIK E+S 
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIKHEMSA 122

Query: 116 KTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQL 175
              ELY G+T K   ++  +CKTC G G +     K        C  CNGQG K +  Q+
Sbjct: 123 SLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK--------CASCNGQGVKFITRQM 174

Query: 176 APGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDP---IVVSIPRGSSN 232
            P     Q   C  C G G        PK+ CK CNGK   KID+    + V I  G  +
Sbjct: 175 GPMIQRFQ-AECDACNGTGDIV----DPKDRCKTCNGK---KIDNERKILEVHIEPGMKD 226

Query: 233 GDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFEN 292
           G  I+ +GEAD+  G    GD+IF I++    +   ER G++L     + L  AI G E 
Sbjct: 227 GQKIVFQGEADQAPG-VIPGDVIFVISQ--RPHKHFERKGDNLYYQAEVDLLSAIAGGE- 282

Query: 293 KFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNW 352
            F ++      L +    G+VI PG    ++ +G P+ KYG  FG+L V  ++ FP +++
Sbjct: 283 -FAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPTNHF 340

Query: 353 INEKNDIIKIRNILP 367
            +E++ + K+  ILP
Sbjct: 341 ADEES-LKKLEEILP 354

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 177/377 (46%), Gaps = 52/377 (13%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y++LGV+ +A+  EIKK YRK AL+YHPDK+  E        KFK+ +AAY+ LSD  K
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE----KFKECSAAYEVLSDSQK 62

Query: 73  RNEYDNKKN----------------------FEPYFESDFANNHDGNYNSRYRSRSKDIK 110
           R  YD                          F  +F    A    G        R +DIK
Sbjct: 63  REVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGP------QRGRDIK 116

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
            E+     ELY G+T K   ++  +CKTC G G +     K        C  CNGQG K 
Sbjct: 117 HEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK--------CTSCNGQGIKF 168

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
           +  Q+ P     Q   C  C G+G        PK+ CKDC GK +      + V +  G 
Sbjct: 169 VTRQMGPMIQRFQTE-CDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGM 223

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
             G  I+ KGEAD+       GD+IF + E    +   +R G+ L+    I L  AI G 
Sbjct: 224 REGQKIVFKGEADQAP-DVIPGDVIFVVVE--KPHKHFKRAGDDLLYEAEIDLLTAIAGG 280

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPD 350
           E  F ++      L +ST  G+VI  G    ++ +G P+ KYG  +GNL V  +I+FP +
Sbjct: 281 E--FAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG-YGNLIVTFKIKFPEN 337

Query: 351 NWINEKNDIIKIRNILP 367
           N+  E + + ++ NILP
Sbjct: 338 NFATE-DKLKELENILP 353

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 178/374 (47%), Gaps = 44/374 (11%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y+ILGV+  AT  EIKK YRK AL+YHPDK+  E        KFK+ ++AY+ LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSEK 62

Query: 73  RNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113
           R+ YD                        +  F S F     G    R   R KDIK E+
Sbjct: 63  RDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIF-SQFFGGAGGAQRPRGPQRGKDIKHEI 121

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           S    ELY G+T K   ++  +CK C G G +     K        C  CNGQG K +  
Sbjct: 122 SASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK--------CSSCNGQGIKFVTR 173

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  G  +G
Sbjct: 174 QMGPMIQRFQTE-CDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVEPGMKDG 228

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD++F ++E    +   +R G+ L+    I L  AI G E  
Sbjct: 229 QRIVFKGEADQAP-DVIPGDVVFLVSE--RPHKSFKRDGDDLVYEAEIDLLTAIAGGE-- 283

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    ++ +G P+ KYG  +GNL +   ++FP +++ 
Sbjct: 284 FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIIKFTVKFPENHFT 342

Query: 354 NEKNDIIKIRNILP 367
            E+N + K+  ILP
Sbjct: 343 AEEN-LKKLEEILP 355

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 130/395 (32%), Positives = 184/395 (46%), Gaps = 50/395 (12%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTL 67
           +D   Y++LGV+  A   EIKK YRK AL+YHPDK+  +EG +     KFK+++AAY+ L
Sbjct: 3   KDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE-----KFKEVSAAYEIL 57

Query: 68  SDEDKRNEYDNKKNF--------------------EPYFESDFANNHDGNYNSRYRSRSK 107
           SD +KR  YD                         +  F   F     G    R   R +
Sbjct: 58  SDSEKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR 117

Query: 108 DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQG 167
           DIK E++    ELY G+T K   ++  +CKTC G G +     K        C  CNGQG
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQG 169

Query: 168 YKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIP 227
            K +  Q+ P     Q   C  C G G        PK+ CK CN K +      + V I 
Sbjct: 170 VKFVTRQMGPMIQRFQ-AECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIE 224

Query: 228 RGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAI 287
            G  +G NI+ KGEAD+       GD+IF + +    +   +R G+ L+    I L  AI
Sbjct: 225 PGMKDGQNIVFKGEADQAP-DVIPGDVIFVVAQ--KPHKHFQRSGDDLVYEAEIDLLTAI 281

Query: 288 TGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEF 347
            G E  F ++      L +S   G+VI PG    ++ +G P+ KYG   GNL V   ++F
Sbjct: 282 AGGE--FALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-HGNLIVHFTVKF 338

Query: 348 PPDNWINEKNDIIKIRNILPNEKTKRNNIVDPINS 382
           P  ++ +E + + K+  ILP     R  I  P N+
Sbjct: 339 PQKHFADE-DSLKKLEEILP----PRKKISIPANA 368

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  167 bits (423), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 177/374 (47%), Gaps = 45/374 (12%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y+ILGV   AT  EIKK YRK AL+YHPDK+  E        KFK+ +AAY+ LSD +K
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASAAYEILSDPEK 62

Query: 73  RNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113
           R+ YD                        +  F   F     G    R   R KDIK E+
Sbjct: 63  RDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAG--GAQRPRGPQRGKDIKHEI 120

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           S    ELY G+T K   ++  +CK C G G +     K        C  CNGQG K +  
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK--------CTSCNGQGIKFVTR 172

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  G  +G
Sbjct: 173 QMGPMIQRFQTE-CDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDG 227

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD++F ++E    +   +R G+ L+    I L  AI G E  
Sbjct: 228 QRIVFKGEADQAP-DVIPGDVVFIVSE--RPHKSFKRDGDDLVYEAEIDLLTAIAGGE-- 282

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    ++ +G P+ KYG  +GNL +   I+FP +++ 
Sbjct: 283 FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFPENHFT 341

Query: 354 NEKNDIIKIRNILP 367
           +E+N + K+  ILP
Sbjct: 342 SEEN-LKKLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  167 bits (423), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 177/374 (47%), Gaps = 45/374 (12%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y+ILGV+  AT  EIKK YRK AL+YHPDK+  E        KFK+ ++AY+ LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSEK 62

Query: 73  RNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113
           R  YD                        +  F   F     G    R   R KDIK E+
Sbjct: 63  REVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAG--GAQRPRGPQRGKDIKHEI 120

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           S    ELY G+T K   ++  +CK C G G +     K        C  CNGQG K +  
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK--------CSSCNGQGIKFVTR 172

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  G  +G
Sbjct: 173 QMGPMIQRFQTE-CDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDG 227

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD++F ++E    + + +R G+ L+    I L  AI G E  
Sbjct: 228 QRIVFKGEADQAP-DVIPGDVVFIVSE--RPHKNFKRDGDDLVYEAEIDLLTAIAGGE-- 282

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    ++ +G P+ KYG  +GNL +   I+FP +++ 
Sbjct: 283 FALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVIKFTIKFPENHFT 341

Query: 354 NEKNDIIKIRNILP 367
            E+N + K+  ILP
Sbjct: 342 TEEN-LKKLEEILP 354

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  167 bits (422), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/374 (33%), Positives = 179/374 (47%), Gaps = 39/374 (10%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y+ LGV+  A+  EIKK YRK AL+YHPDK+  E        KFK++++AY+ LS
Sbjct: 3   KDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE----KFKEVSSAYEILS 58

Query: 69  DEDKRNEYDN-------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVEL 113
           D  KR  YD                    + E  F+    G    R R   R +DIK E+
Sbjct: 59  DSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHEM 118

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           +    ELY G+T K   ++  +CK+C G G +     K        C  CNGQG K +  
Sbjct: 119 AASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK--------CSSCNGQGIKFVTR 170

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G         K+ CK CNGK +      + V I  G  +G
Sbjct: 171 QMGPMIQRFQTE-CDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPGMKDG 225

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD++F I+E    +   +R G+ LI    I L  A+ G   +
Sbjct: 226 QKIVFKGEADQAP-DVIPGDVVFVISE--KPHKHFQRAGDDLIYEAEIDLLTALAG--GQ 280

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    V+ +G P+ KYG  +GNL +   I+FP +++ 
Sbjct: 281 FALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKFNIKFPENHFT 339

Query: 354 NEKNDIIKIRNILP 367
           +E+N + K+  ILP
Sbjct: 340 SEEN-LKKLEEILP 352

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  167 bits (422), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 180/376 (47%), Gaps = 41/376 (10%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++LGV+ DA   +IKK YRK AL+YHPDK+           KFK +TAAY+ LS
Sbjct: 3   KDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAA----DKFKQMTAAYEILS 58

Query: 69  DEDKRNEYDNKKNFEPYFESD---------------FANNHDGNYNSRYRS--RSKDIKV 111
           D  KR  YD                           F+    G   SR R   + +DIK 
Sbjct: 59  DSQKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIKH 118

Query: 112 ELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNM 171
           ++S     LY G+T K   ++  +CK+C G G ++    K        C  C G G K +
Sbjct: 119 DISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVKK--------CSSCGGHGVKFV 170

Query: 172 KVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSS 231
             Q+ P     Q   C  C G G        PK+ C++C+GK +      + V+I  G  
Sbjct: 171 TRQMGPMIQRFQTT-CEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGMK 225

Query: 232 NGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFE 291
           NG  ++ +GEAD++ G +  GD++F +NE    +    R G++L     I L  A+ G  
Sbjct: 226 NGQKVVFQGEADQQPG-QIPGDVVFVVNE--QEHPKFVRNGDNLHYEAQIDLLTAVAG-- 280

Query: 292 NKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDN 351
            +F ++      L +    G+VI PG +  ++ +G P+ KYG S+GNL +   ++FP  +
Sbjct: 281 GQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYG-SYGNLLIKFNVKFPKSH 339

Query: 352 WINEKNDIIKIRNILP 367
           + ++  D+ K+  ILP
Sbjct: 340 FASDA-DLKKLEEILP 354

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  164 bits (416), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 177/378 (46%), Gaps = 45/378 (11%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y+ILGV+  AT  EIKK YRK AL++HPDK+  E        KFK+ ++AY+ LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE----KFKEASSAYEVLSDSEK 62

Query: 73  RNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113
           R  YD                        +  F   F     G    +   R +DIK E+
Sbjct: 63  REVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAG--GAQRPKGPQRGRDIKHEI 120

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           S    ELY G+T K   ++  +CK C G G +     K        C  CNGQG K +  
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK--------CTGCNGQGIKFVTR 172

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G        PK+ CK CNGK +      + V +  G  +G
Sbjct: 173 QMGPMIQRFQTE-CDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVEPGMKDG 227

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD++F ++E    +   +R G+ L+    I L  AI G E  
Sbjct: 228 QKIVFKGEADQAP-DVIPGDVVFLVSE--RPHKHFKRDGDDLVYEAEIDLLTAIAGGE-- 282

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    ++ +G P+ KYG  +GNL V   I+FP +++ 
Sbjct: 283 FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIVKFTIKFPENHFT 341

Query: 354 NEKNDIIKIRNILPNEKT 371
            E+N + K+  ILP   T
Sbjct: 342 TEEN-LKKLEEILPPRAT 358

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  164 bits (414), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 121/380 (31%), Positives = 177/380 (46%), Gaps = 48/380 (12%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y+++GV+  A   +IKK YRK AL+YHPDK+  E        KFK+I++AY+ LS
Sbjct: 3   KDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAE----KFKEISSAYEILS 58

Query: 69  DEDKRNEYDNKKNFEPYFE------------------SDFANNHDGNYNSRYRSRSKDIK 110
           D  KR  YD                            S F     G+   R   + +DI+
Sbjct: 59  DSQKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRDIR 118

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
            E+S    ELY G+T K   ++  +CK+C G G +     K        C  CNGQG+K 
Sbjct: 119 HEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGAVKK--------CSSCNGQGFKF 170

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
           +  Q+ P     Q   C  C G G         K+ CK CNGK +      + V I  G 
Sbjct: 171 ITRQMGPMIQRFQ-AECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIEPGM 225

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERY---GNHLINHTHISLAEAI 287
            +G  I+ +GEAD+      A D++      + S    ER+   G+ L     + L  AI
Sbjct: 226 KDGQKIVFQGEADQ------APDVVPGDVVFVVSERPHERFNRKGDDLYYEAEVDLLTAI 279

Query: 288 TGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEF 347
            G E  F V+      L +    G+VI PG    ++ +G P+ KYG  FGNL V  +I+F
Sbjct: 280 AGGE--FAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIVKFKIKF 336

Query: 348 PPDNWINEKNDIIKIRNILP 367
           PP+++ +E + + ++ NILP
Sbjct: 337 PPNHFADEAS-LKQLENILP 355

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  163 bits (413), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 186/395 (47%), Gaps = 47/395 (11%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           +Y++LGV+  A+  EIKK YRK AL+YHPDK+  E        KFK+ ++AY+ L D +K
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE----KFKEASSAYEVLMDAEK 62

Query: 73  RNEYDN-----------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVEL 113
           R  YD                         F  D  +   G   SR R   R +DIK E+
Sbjct: 63  REAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRDIKHEI 122

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           ++   ELY G+T K   ++  +CKTC G G +     K        C  CNGQG K +  
Sbjct: 123 TVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK--------CTSCNGQGVKFITR 174

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           Q+ P     Q   C  C G G       +PK+ CK C+GK +      + V +  G  +G
Sbjct: 175 QMGPMIQRFQTE-CDACDGTGDII----NPKDRCKACSGKKVANERKILEVHVDPGMKDG 229

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
             I+ KGEAD+       GD+IF ++E    +    R  + L+    I L  AI G E  
Sbjct: 230 QKIVFKGEADQAP-DIIPGDVIFVVSE--RPHKHFRRDSDDLVYEADIDLLTAIAGGE-- 284

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353
           F ++      L +    G+VI PG    ++ +G P+ KYG  FGNL V   I FP D++ 
Sbjct: 285 FAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLVKFNIVFPKDHFT 343

Query: 354 NEKNDIIKIRNILPNEKT----KRNNIVDPINSEY 384
           + +N + K+  ILP  K      + ++ D + SE+
Sbjct: 344 SLEN-MKKLEEILPPRKKTSIPSKAHVDDCVLSEF 377

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  161 bits (407), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 178/383 (46%), Gaps = 42/383 (10%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++LGV+ DA   +IKK YRK AL+YHPDK+  E        KFK IT AY+ LS
Sbjct: 3   KDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAA----DKFKQITGAYEILS 58

Query: 69  DEDKRNEYDNKKNFEPYFESD----------------FANNHDGNYNSRYRS--RSKDIK 110
           D  KR  YD                            F+    G   SR R   + +DI+
Sbjct: 59  DSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIR 118

Query: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170
            ++S     LY G+  K   ++  +CK C G G +     K        C  CNGQG K 
Sbjct: 119 HDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVKK--------CTSCNGQGVKF 170

Query: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
           +   + P     Q   C  C G G      +     CKDC+GK +      + V+I  G 
Sbjct: 171 VTRHMGPMIQRFQTT-CEVCNGEGDVIPAADR----CKDCDGKKIASERKILEVNIQPGM 225

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
            +G  I+ +GEAD++ G +  GD++F +NE    +    R G++L     I L  AI G 
Sbjct: 226 KHGQKIVFQGEADQQPG-QIPGDVVFVVNE--QEHPRFVRNGDNLHYEAEIDLLTAIAG- 281

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPD 350
             +F ++      L +    G+VI PG +  ++ +G P+ KYG S+G+L +   ++FP  
Sbjct: 282 -GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYG-SYGDLLIKFNVKFPKS 339

Query: 351 NWINEKNDIIKIRNILPNEKTKR 373
           ++ +E+  + K+  ILP +   R
Sbjct: 340 HFADEEA-LKKLEAILPPKTLPR 361

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  154 bits (390), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 175/372 (47%), Gaps = 42/372 (11%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTLSDED 71
           +Y++LGV+ +A+  EIKK YRK AL+YHPDK+  DE  +     KFK+ + AY+ LSD  
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE-----KFKECSGAYEVLSDSQ 61

Query: 72  KRNEYDN--------------KKNFEPYFESDFANNHDGNYNSRYRS--RSKDIKVELSL 115
           KR  YD                  F  + +  F+    G   SR R   R KDI+ E+  
Sbjct: 62  KREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGKDIRHEIQN 121

Query: 116 KTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQL 175
              ELY G+T K   ++  +CK C G G +     K        C  C GQG K +  Q+
Sbjct: 122 TLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKK--------CSSCGGQGVKFVTRQM 173

Query: 176 APGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDN 235
            P     Q   C  C G+G        PK+ CK+C G  +      + V +  G   G  
Sbjct: 174 GPMIQRFQTE-CDVCHGSGDII----DPKDRCKECKGNKVANERKVLEVHVEPGMREGQK 228

Query: 236 IILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFI 295
           +  KGEAD+       GD+IF + E    +   +R G+ L+    + L  AI G    F 
Sbjct: 229 VTFKGEADQAP-DIIPGDVIFVVTE--KPHKHFKRSGDDLLYEAEVDLLTAIAG--GDFA 283

Query: 296 VKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINE 355
           ++      L ++   G+VI PG    +  +G P+ KYG  +GNL +  +I+FP +++ +E
Sbjct: 284 IEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKFPENHFADE 342

Query: 356 KNDIIKIRNILP 367
              +  + +ILP
Sbjct: 343 AK-LKALEDILP 353

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  143 bits (360), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 109/387 (28%), Positives = 171/387 (44%), Gaps = 66/387 (17%)

Query: 7   SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
           S  + + Y+ILGV+  A+ ++IKK YR  AL++HPDK+   G    +++KF+ I  AY+ 
Sbjct: 3   SVSNSELYDILGVSASASRQDIKKAYRVNALKHHPDKN---GHSEESKLKFQQICKAYEI 59

Query: 67  LSDEDKRNEYDNKKN------------------------FEPYF------------ESDF 90
           L DE KR  YD                            F  +F            +  F
Sbjct: 60  LKDERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSF 119

Query: 91  ANNHDGNYNSRYRS---RSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTK 147
                G + +  R    R  DIK  L     E+Y+GK  K    R R+CK C G G    
Sbjct: 120 FGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKA 179

Query: 148 KDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFC 207
                      +C  C G+G +    +  P    T +  CS C G G + K+    K+ C
Sbjct: 180 S----------QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQ----KDIC 224

Query: 208 KDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE----ELGKKNA--GDLIFEINEI 261
           +DCNG+  I+      + + +G  NG  ++L GEADE    ELG ++   GD+I  + ++
Sbjct: 225 RDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQL 284

Query: 262 IDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILE 321
                   R  + +++H  + L  ++ G    ++      + L +    G++++PG I  
Sbjct: 285 PHKAFWRHRDASLVLDHCKVDLKTSLCGGP-VWVDSHPSGKLLKIDVLPGEILKPGAIKC 343

Query: 322 VKNEGWPMDKYGASFGNLYVILEIEFP 348
           V  EG  M K G  FGNLY+  ++ FP
Sbjct: 344 V--EGMGMPKSGGRFGNLYIRFDVAFP 368

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  132 bits (332), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 170/365 (46%), Gaps = 49/365 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGV   A+ ++IK  YR+L+ +YHPDK  + G +  +  +F ++  AY+ LSD 
Sbjct: 20  QDYYAILGVGRGASDKDIKSAYRQLSKKYHPDK--NPGDEDAHN-RFIEVGEAYEALSDP 76

Query: 71  DKRNEYDN-----KKN--------------------FEPYFESDFANNHDGNYNSRYRSR 105
           +KR  YD       KN                    F+  F     +   G    R + R
Sbjct: 77  EKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQR 136

Query: 106 SKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNG 165
            + ++V+  L   + Y+G +I+F  S N  C  C+G G    +DGK       +C +C G
Sbjct: 137 GQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG---SQDGKVE-----KCGQCGG 188

Query: 166 QGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIV 223
           +G   M VQ+    + TQ +  +C  C+G G+        KN CK C+G  ++K +    
Sbjct: 189 RG---MVVQVIRQGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFH 239

Query: 224 VSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISL 283
           V +P G+      +++GEA E+      GD+  ++ E    N    R G  L     +SL
Sbjct: 240 VDVPAGAPRDFVAVIRGEA-EKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSL 298

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
            EA+ G   + +      + + LS  KG  ++ G++  +K  G P++  G  +G+LYV  
Sbjct: 299 TEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLES-GTKYGDLYVDY 357

Query: 344 EIEFP 348
            I  P
Sbjct: 358 VIVMP 362

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 164/371 (44%), Gaps = 56/371 (15%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGVA+DA+ ++IK  YR+++ ++HPDK+  + +      KF +I  AY+ LSD 
Sbjct: 18  QDYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEA---HHKFIEIGEAYEVLSDS 74

Query: 71  DKRNEYDN----------------------KKNFEPY--FESDFANNHDGNYNSRYRSRS 106
           +KR  YD                           +P+  F   F ++H G  N R   + 
Sbjct: 75  EKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVR---KG 131

Query: 107 KDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQ 166
            ++ V+ S+  +  Y+G         N  C+ C+G G    +           C+ C G+
Sbjct: 132 SNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQFAT--------CETCQGR 183

Query: 167 GYKNMKVQLAPGFYTTQ-NVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVS 225
           G     +Q+  GF T Q   +C  C+G GK      + K+ CK C G  ++K      +S
Sbjct: 184 GVIIQVIQM--GFMTQQIQQVCGACQGKGK------TIKHVCKICRGARVVKTPKTFEIS 235

Query: 226 IPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAE 285
           +P G+    N++  G+A E++    +GDL+F   E    N    R G+HL     +   E
Sbjct: 236 VPAGAQRNYNVVKSGQA-EKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHWKE 294

Query: 286 AITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP--------MDKYGASFG 337
           A+ G   + I    D + + +   K  V  PG+I  V N G P         + YG  F 
Sbjct: 295 ALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFI 354

Query: 338 NLYVILEIEFP 348
              ++   EFP
Sbjct: 355 EYVIVSPKEFP 365

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  129 bits (325), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 167/365 (45%), Gaps = 46/365 (12%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY+ILGV +DA  +EIK  YR+L+ +YHPDK+  + +      KF ++  AY  LSD 
Sbjct: 21  QDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEA---HNKFIEVGEAYDVLSDS 77

Query: 71  DKRNEYDNK-------------------------KNFEPYFESD-FANNHDGNYNSRYRS 104
           +KRN YD                           + FE  F  + F     G    R R 
Sbjct: 78  EKRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRP 137

Query: 105 RSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCN 164
           R +++ +   +   + YNG+  K+N   N  C+ C+G G    KDGK        C  C 
Sbjct: 138 RGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG---SKDGKV-----TRCPDCQ 189

Query: 165 GQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVV 224
           G+G     +Q+       Q+V C  C G+G+  K P      C  C+G  + K+D    V
Sbjct: 190 GRGVIVQVIQMGIMTQQIQHV-CDRCSGSGEIIKNP------CPHCHGHKVAKMDKEFTV 242

Query: 225 SIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLA 284
            +P G+      I  GEA E+    +AGDL+FE  E   +N    R G+HL     +S+ 
Sbjct: 243 KLPNGAQRNYVDIKHGEA-EKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQ 301

Query: 285 EAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP-MDKYGASFGNLYVIL 343
           EA+ G   + +     D+++ L     +V+  G+I  V   G P ++  G  FG+L++  
Sbjct: 302 EALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDY 361

Query: 344 EIEFP 348
            I  P
Sbjct: 362 VILMP 366

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  129 bits (324), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/380 (27%), Positives = 172/380 (45%), Gaps = 55/380 (14%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILG+ +DA+ +++K  YR+L+ +YHPDK  + G +  ++ +F ++  AY+ LSD 
Sbjct: 18  QDYYSILGLNKDASDKDVKSAYRQLSKKYHPDK--NPGDESAHQ-RFIEVGEAYEVLSDP 74

Query: 71  DKRNEYDN-----KKN---------------FEPY--FESDF-----ANNHDGNYNSRYR 103
           +KR  +D       KN                +P+  FE  F          G +   +R
Sbjct: 75  EKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHR 134

Query: 104 SRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKC 163
            +   ++V   L   + Y+G  ++F    N IC  C G G    +DGK        C  C
Sbjct: 135 GKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG---SEDGKVET-----CPDC 186

Query: 164 NGQGYKNMKVQLAPGFYTTQNVL--CSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDP 221
            GQG   + +Q+      TQ +   C  C G G   K      N CK C G  ++K    
Sbjct: 187 GGQG---ILIQIIRMGIMTQRIQQPCGRCSGRGHIIK------NQCKACGGHKVVKKPKS 237

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
             V +P G+   D++ ++ +  ++     AGD+  E  E   +N    R G+HL     +
Sbjct: 238 FQVEVPAGAPR-DHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRTEVL 296

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  EA+ G  ++ I    D + + L  PKG ++  G+I ++   G P    G SFG+L+V
Sbjct: 297 SAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFV 356

Query: 342 ILEIEFPP-----DNWINEK 356
              +  P      + WI ++
Sbjct: 357 EYAVVMPAQFKQTNQWIRDE 376

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  130 bits (328), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 109/386 (28%), Positives = 171/386 (44%), Gaps = 64/386 (16%)

Query: 7   SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
           S ++ + Y+ L ++ DAT +EIKK YR  AL+ HPDK+        ++ KF++I  AY+ 
Sbjct: 3   SVKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDKN---NHSEDSKRKFQEICKAYEI 59

Query: 67  LSDEDKRNEYDNKKN--------------------------FEPYF-------ESDFANN 93
           L D  K+  YD                              F  +F        S F N+
Sbjct: 60  LGDAKKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFND 119

Query: 94  ----HDGNYNSRYR-SRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKK 148
                 G  NS+ R SR  DIK  L     ELY+GK  K    R R+CKTC G G  +  
Sbjct: 120 DTMFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSSS 179

Query: 149 DGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCK 208
                      C+ CNGQG+     +  P    T +  C  C G+G + ++    K+ C 
Sbjct: 180 ----------ACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRR----KDVCS 224

Query: 209 DCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEEL----GKK--NAGDLIFEINEII 262
           +C G+  IK      + +  G  +G  I+L  EADE +    GK+  N GD+I  + ++ 
Sbjct: 225 ECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVK 284

Query: 263 DSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEV 322
                +    + ++N  H+ L  ++ G E   I        L +    G++++PG +  V
Sbjct: 285 HPLFQIHNDTDLVMNDCHVDLKTSLCGGE-VLIENHPCGSALKIEVLPGEILKPGCVKCV 343

Query: 323 KNEGWPMDKYGASFGNLYVILEIEFP 348
           ++ G P  +    FGNLY+  +++FP
Sbjct: 344 ESMGMPHPQ-SQGFGNLYIRFQVDFP 368

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  129 bits (323), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 169/390 (43%), Gaps = 69/390 (17%)

Query: 6   GSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQ 65
           GS+ + D Y+ LGVA +A+ +EIKK YR  AL++HPDK+   G    +++KF+ I  AY+
Sbjct: 2   GSAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDKN---GHSEQSKLKFQQICKAYE 58

Query: 66  TLSDEDKRNEYDN------------KKNFEP----------------------------- 84
            L D+ KR  YD               N+E                              
Sbjct: 59  ILGDDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMD 118

Query: 85  YFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGW 144
           +F S       G+  S  + R  DIK  L     E+YNGK  K    R R+C+TC G G 
Sbjct: 119 FFGSSRGFRAQGSRRSAPQ-RGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEG- 176

Query: 145 RTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPK 204
            +KK           C  C G+G +    +  P    T +  C  C G+G   K    P 
Sbjct: 177 -SKK--------ATSCYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIVK----PS 222

Query: 205 NFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNA------GDLIFEI 258
           + C  C+G+  ++      + + +G  NG  +++  EADE +  K        GD+I  +
Sbjct: 223 DICNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIIL 282

Query: 259 NEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGD 318
            ++   +       + L++   + L  ++ G    ++      + L +    G++++PG 
Sbjct: 283 EQLPHRSLKRGHDSSLLLSECQVDLKTSLCG-GTVWVDSHPSGKVLKIDVIPGELLKPGA 341

Query: 319 ILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
           I  V++ G P  K G  +G+L++  ++ FP
Sbjct: 342 IKCVQSMGMPKSKGG--YGDLFIKFKVIFP 369

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  127 bits (318), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 165/362 (45%), Gaps = 44/362 (12%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILG+ +DA+ +EIK +YR+L+ ++HPDK+  + +      KF +I  AY+ LSD 
Sbjct: 20  QDYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEA---HHKFIEIGEAYEVLSDP 76

Query: 71  DKRNEYDN-----KKNF-------------EPY--FESDF---ANNHDGNYNSRYRSRSK 107
           +KR  +D       KN              +P+  FE  F        G +    R R  
Sbjct: 77  EKRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRGH 136

Query: 108 DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQG 167
           ++KV   L   E Y G T++F  + N IC  C+G G     DGK       +C  C G+G
Sbjct: 137 NLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG---SADGKV-----AKCSDCQGRG 188

Query: 168 YKNMKVQLAPGFYTTQ-NVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSI 226
                +++  G  T Q   +C  C G G         KN CK C+G  ++K   P  V +
Sbjct: 189 VVIQVIRM--GMMTQQIQQMCGRCGGKGSVI------KNHCKTCHGSKVVKKQKPFHVEV 240

Query: 227 PRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEA 286
           P G++        GE+D+     +AGD+  E NE   +N    R G HL     +S  EA
Sbjct: 241 PPGAARHYTETRSGESDKG-ADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEVLSAREA 299

Query: 287 ITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIE 346
           + G   + +    + + + ++  K  V+  G++  +   G P      +FG+L++   + 
Sbjct: 300 LKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVV 359

Query: 347 FP 348
            P
Sbjct: 360 MP 361

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  125 bits (313), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 169/365 (46%), Gaps = 52/365 (14%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI--DEGQKLINEIKFKDITAAYQTLS 68
           +DYY IL + +DA+ +EIK  YR+L+ +YHPDK+   DE        KF +I  AY+ LS
Sbjct: 22  QDYYAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHH-----KFIEIGEAYEVLS 76

Query: 69  DEDKRNEYDN-----KKN-------------FEPY--FESDF---ANNHDGNYNSRYRSR 105
           D +K+  YD       KN              +P+  FE  F        G +  R R R
Sbjct: 77  DPEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQR 136

Query: 106 SKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNG 165
              IKV  +L   + Y+G +I+F  S N  C  C+G G     DGK       +C  C G
Sbjct: 137 GPTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG---SADGKL-----AQCPDCQG 188

Query: 166 QGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIV 223
           +G   + VQ+      TQ +  +C  C G G+        KN CK C+GK + K +    
Sbjct: 189 RG---IIVQVVRMGIMTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKKNKFFH 239

Query: 224 VSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISL 283
           V +P G+         GEA E+    +AGDL+ E  E+   N    R G++L     +S 
Sbjct: 240 VDVPPGAPRNYMDTRAGEA-EKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSA 298

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
           AEA+ G   + I    +++ + LS P   V+  G+I  VK  G+ M K     G+LY+  
Sbjct: 299 AEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVK--GFGMPKGSRDHGDLYIDY 356

Query: 344 EIEFP 348
            +  P
Sbjct: 357 VVVMP 361

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  125 bits (313), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 103/390 (26%), Positives = 165/390 (42%), Gaps = 70/390 (17%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++L V+ +A+  EI+K YR LAL++HPDK+    +   ++ KF ++  AY+ L 
Sbjct: 3   KDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEE---SKSKFLEVNEAYEILI 59

Query: 69  DEDKRNEYDNKKN--------------------------------------FEPYFESDF 90
           DE KR+ YD                                          F  +F+   
Sbjct: 60  DEKKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMS 119

Query: 91  ANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDG 150
           + +  G    +      DIK +L    S LY GK  K   +R R+CK C G G    +  
Sbjct: 120 SPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVR-- 177

Query: 151 KPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDC 210
                    C+ C G+G ++   Q+ P    T    CS C G G + K      + C+DC
Sbjct: 178 --------TCKACRGRGQQSRSRQMGP-MMQTWTQTCSDCNGMGTFTKD----SDVCRDC 224

Query: 211 NGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNA------GDLIFEINEIIDS 264
            G+  I+      V +  G   G  IIL GEADE +  +        GD+I  I +I D 
Sbjct: 225 EGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDP 284

Query: 265 N-NDLERYG-NHLINHTHISLAEAITGFENKFIVKTFDDRDLY-LSTPKGKVIRPGDILE 321
               + R G + ++ +  I L  ++ G   K  +    +  L  ++   G++I+P     
Sbjct: 285 KFQRVNRNGCDLMVRNCKIPLVTSLCG--GKLSIDGHPNGKLINVTILPGELIKPNHFKS 342

Query: 322 VKNEGWPM---DKYGASFGNLYVILEIEFP 348
           ++N G P     +    +GNLY+  ++EFP
Sbjct: 343 IENLGMPRYEEKRAPEGYGNLYIQFQVEFP 372

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  121 bits (304), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 104/355 (29%), Positives = 164/355 (46%), Gaps = 40/355 (11%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILG+++DA+ +EIK  YR+L+ +YHPDK+  + +      KF ++  AY  L D 
Sbjct: 19  QDYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEA---HHKFIEVGEAYDILGDP 75

Query: 71  DKRNEYD---------------NKKNFEPY--FESDFANNHDGNYNSRYRSRSKDIKVEL 113
           +KR  YD                    +P+  FE  F     G +    RS++  ++ ++
Sbjct: 76  EKRKTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFG-RQGGGFRQTQRSQNYQVRNQV 134

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
           SLK  E Y+G  ++F    N IC +C+G G     DGK  V     C  C G+G     +
Sbjct: 135 SLK--EFYSGGEVEFEIPLNDICDSCHGSG---SADGKVKV-----CPACQGRGVVVQVI 184

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           ++ P       +     +  G+   K  + +N CK C G  +++ + P     P G    
Sbjct: 185 RMGP-------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRN 237

Query: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293
                 GE+D+      +GD+I E NE    N    R GN+L     I+  EAI G   +
Sbjct: 238 HIDKKSGESDKSP-DMESGDIIIEYNESEKENLGYRRRGNNLYRTEIITANEAINGGWTR 296

Query: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
            I    + + + LS PKG ++  GDI  +K  G P+     +FG+LY+   +  P
Sbjct: 297 EIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPI-MGSKNFGDLYIDYVVLVP 350

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  120 bits (302), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 112/365 (30%), Positives = 169/365 (46%), Gaps = 50/365 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY IL + +DAT +EIK  YR+L+ +YHPDK  + G +  ++ KF ++  AY  LSD 
Sbjct: 22  QDYYAILEIDKDATEKEIKSAYRQLSKKYHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDP 78

Query: 71  DKRNEYDN-----KKN---------------FEPY--FESDF---ANNHDGNYNSRYRSR 105
           +K+  YD       KN                +P+  FE  F        G +  R R R
Sbjct: 79  EKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQR 138

Query: 106 SKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNG 165
              IKV+  L   + Y+G +I+F  + N  C  C+G G     DGK       +C  C G
Sbjct: 139 GPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG---SADGKL-----AQCPDCQG 190

Query: 166 QGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIV 223
           +G   + +Q+      TQ +  +C  C G G+        KN CK C+GK + K +    
Sbjct: 191 RG---VIIQVLRMGIMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFH 241

Query: 224 VSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISL 283
           V +P G+         GEA E+    +AGDL+ E  E    N    R G++L     +S 
Sbjct: 242 VDVPPGAPRNYMDTRVGEA-EKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSA 300

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
           AEA+ G   + I    +++ + LS P   V+  G++  VK  G P    G  +G+LY+  
Sbjct: 301 AEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYIDY 358

Query: 344 EIEFP 348
            +  P
Sbjct: 359 VVVMP 363

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  120 bits (301), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 169/366 (46%), Gaps = 51/366 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY IL V +DA+ +EIK  YR+L+ +YHPDK  + G +  +  KF ++  AY  LSD 
Sbjct: 22  QDYYAILEVDKDASEKEIKSAYRQLSKKYHPDK--NSGSEEAHH-KFIEVGEAYDVLSDP 78

Query: 71  DKRNEYDN-----KKN----------------FEPY--FESDF---ANNHDGNYNSRYRS 104
           +K+  YD       KN                 +P+  FE  F        G +  R R 
Sbjct: 79  EKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQRQ 138

Query: 105 RSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCN 164
           R   IKV+  L   + Y+G +I+F  S N  C  C+G G     DGK       +C  C 
Sbjct: 139 RGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG---SADGKL-----AQCPDCQ 190

Query: 165 GQGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPI 222
           G+G   + +Q+      TQ +  +C  C G G+        KN CK C+GK +IK +   
Sbjct: 191 GRG---VIIQVLRMGIMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKNKFF 241

Query: 223 VVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHIS 282
            V +P G+         GEA E+    +AGDL+ E  E    N    R G++L     +S
Sbjct: 242 HVDVPPGAPRNYLDTRAGEA-EKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLS 300

Query: 283 LAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVI 342
             EA+ G   + I    +++ + LS P   V+  G+I  +K  G+ M K G   G+LY+ 
Sbjct: 301 AEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLK--GFGMPKSGKGHGDLYID 358

Query: 343 LEIEFP 348
             +  P
Sbjct: 359 YVVIMP 364

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  121 bits (304), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 117/448 (26%), Positives = 188/448 (41%), Gaps = 103/448 (22%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
           + Y+IL ++ +A  ++IKK YR LAL+YHPDK+    +   +++ F+ I+ AY+ L D +
Sbjct: 6   ELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEE---SKVMFQKISEAYEVLIDVE 62

Query: 72  K-----------------------RNEYDNKK----------NFEPYFESDFA------- 91
           K                       ++E+  ++          N  P F SD A       
Sbjct: 63  KRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGDLF 122

Query: 92  ---------------------------NNHDGNYNSRYRSRSKDIKVELSLKTSELYNGK 124
                                      NN   N  S    R  DIK  L     +LY GK
Sbjct: 123 AQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYYGK 182

Query: 125 TIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQN 184
             K    R R+C  C G G   K           +C  CNG G      ++ P   T   
Sbjct: 183 KTKLRLDRTRLCVLCMGQGSMKKS----------KCFTCNGLGSLTQTRRMGPMIQTFSQ 232

Query: 185 VLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE 244
             C  C+G+G + K+ ++    C+ C+G   ++      V I  G  NG  IIL GEADE
Sbjct: 233 S-CPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADE 287

Query: 245 ----ELGKKN--AGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKT 298
                 GK+   AGD++  IN++ D+N ++    + L+++  ++L++A+ G    FI   
Sbjct: 288 VVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCG-GTIFISNH 346

Query: 299 FDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDK--------YGASFGNLYVILEIEFPPD 350
                + +    G+++ PG I  V N G P ++           S GNLYV  +I+FP  
Sbjct: 347 PSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFPTR 406

Query: 351 NWINEKNDIIKIRNILPNEKTKRNNIVD 378
               E++ I K++ +L  ++     + D
Sbjct: 407 ---LEEDTIAKLKAVLSEDRYAHAEMAD 431

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  116 bits (290), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 108/365 (29%), Positives = 168/365 (46%), Gaps = 52/365 (14%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGV++DA+ +EIK  YR+L+ ++HPDK+  +        KF ++  AY+ LSD+
Sbjct: 24  QDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDA---HHKFIEVGEAYEVLSDD 80

Query: 71  DKRNEYDNK----------------------KNFEPY--FESDFANNHDGNYNSRYRSRS 106
            KR  YD                           +P   FE  F  +  G    R R  +
Sbjct: 81  QKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRPRGHN 140

Query: 107 KDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQ 166
            + + EL+LK  + Y G ++ F  + N  C+ C+G G    +DGK        C +C GQ
Sbjct: 141 LEAREELTLK--QYYQGTSLDFTLNLNDFCENCHGSG---SQDGK-----TTHCSECRGQ 190

Query: 167 GYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVV 224
           G     V++ P    TQ +  +C  C+G G+        KN CK C+G  + +      V
Sbjct: 191 GVVIQVVRMGP---LTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHV 241

Query: 225 SIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLA 284
            +P G+      +  GEAD+     ++GD+  + +E    N    R G HL     +SL 
Sbjct: 242 DVPAGAPRDFVDVKAGEADKG-PDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLK 300

Query: 285 EAITGFENKFIVKTFD-DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
           EA+ G   + I + FD ++ L L   +G  +R G+I  V   G P   +G   G+L+V  
Sbjct: 301 EALLGGWKREI-EFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKH-GDLFVDY 358

Query: 344 EIEFP 348
            +  P
Sbjct: 359 VVVIP 363

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  115 bits (287), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 159/359 (44%), Gaps = 53/359 (14%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGV++DA+ +EIK  YR+L+ +YHPDK  + G +  +  KF ++  AY+ LSD+
Sbjct: 23  QDYYAILGVSKDASEKEIKSAYRQLSKKYHPDK--NPGDETAHH-KFIEVGEAYEVLSDD 79

Query: 71  DKRNEYDN------------------------KKNFEPY--FESDFANNHDGNYNSRYRS 104
            KR  Y+                             +P   FE  F     G    R R 
Sbjct: 80  QKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRPRG 139

Query: 105 RSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCN 164
            + + + E++LK  E Y G ++ F  + N  C  C G G    +DGK        C  C 
Sbjct: 140 HNLEAREEITLK--EYYQGTSLDFTLNLNDFCDNCKGTG---SQDGKT-----TRCSDCQ 189

Query: 165 GQGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPI 222
           GQG     +++ P    TQ +  +C  C+G G+        KN CK C+G  + +     
Sbjct: 190 GQGVVIQIIRMGP---ITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKTKHF 240

Query: 223 VVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHIS 282
            V +P G+      +  GEAD+     +AGD+  + +E    N    R G HL     ++
Sbjct: 241 HVDVPAGAPRDFVDVKNGEADKGP-DFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLT 299

Query: 283 LAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           L EA+ G   + I      + + L    G  +R G+   V   G P D  G  FG+L+V
Sbjct: 300 LKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFV 356

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 153/380 (40%), Gaps = 59/380 (15%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y++LGV    +  E+KK+Y+  AL+YHPDK+   G    ++ +F+ I  AY+ L 
Sbjct: 3   KDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDKN---GHSEASKQRFQQIADAYRVLG 59

Query: 69  DEDKRNEYDNKKNFE------------------------PYFESD---------FANNHD 95
           DE  R  YD     +                         +F  D         F  +  
Sbjct: 60  DERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGA 119

Query: 96  GNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVP 155
            +      SR  DIK +L     ELY GK ++   +R R+C  C G G            
Sbjct: 120 SSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAS------- 172

Query: 156 PEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCL 215
               C  C+GQG  + + +       T +  C  C G+G   K  ++    C  C G   
Sbjct: 173 ---TCTACSGQGICS-QTKRQGSLVQTWSSTCRVCSGSGTIVKDCDT----CTSCGGAGY 224

Query: 216 IKIDDPIVVSIPRGSSNGDNIILKGEADEEL----GKKNA--GDLIFEINEIIDSNNDLE 269
           ++      V I  G   G  ++  GEADE +    GK+    GDL   I E   +     
Sbjct: 225 LRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQC 284

Query: 270 RY-GNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP 328
           R   N L+   H+ L  ++ G    +I      + + L    G+++ PG I  +++ G P
Sbjct: 285 RGDANLLLTELHVDLRTSLCG-GTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMP 343

Query: 329 MDKYGASFGNLYVILEIEFP 348
                + +G+L++   ++FP
Sbjct: 344 HPDDPSQYGHLFIKFHVDFP 363

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  113 bits (283), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 161/363 (44%), Gaps = 46/363 (12%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY+ILG+A+DAT +EIK  YR+L+ ++HPDK  + G +  ++ KF ++  AY+ LSD 
Sbjct: 20  QDYYQILGIAKDATDKEIKSAYRQLSKKFHPDK--NPGNEDAHQ-KFIEVGEAYEVLSDP 76

Query: 71  DKRNEYDN-----KKNFEPYFESDFANNHD-----------------GNYNSRYRSRSKD 108
            KR  +D       KN         A  HD                      R + R  +
Sbjct: 77  QKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGPN 136

Query: 109 IKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGY 168
           I     +   + Y G  + F  + N +C  C+G G     DGK  + P   C  C G+G 
Sbjct: 137 IMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGK--LTP---CPDCQGRG- 187

Query: 169 KNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSI 226
             + +QL      TQ +  +C  C G G+ +KK       C+ C+G  ++       V +
Sbjct: 188 --VIIQLIRMGMMTQQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKEFQVKL 239

Query: 227 PRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEA 286
           P+G+      +  GEAD+      AGDL+ E NE   SN    R G +L     +++ EA
Sbjct: 240 PKGAKRHYMDVKHGEADKN-PDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEA 298

Query: 287 ITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDK-YGASFGNLYVILEI 345
           + G   + I      + L +      V+  G++  +   G P  K    +FG+L++   +
Sbjct: 299 LYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDYVV 358

Query: 346 EFP 348
             P
Sbjct: 359 IMP 361

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 108/363 (29%), Positives = 168/363 (46%), Gaps = 48/363 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY IL + + A+ +EIK  YR+L+ ++HPDK  + G +  ++ KF ++  AY  LSD 
Sbjct: 22  QDYYAILEIDKGASEKEIKSAYRQLSKKFHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDP 78

Query: 71  DKRNEYDN-----KKN-------------FEPY--FESDF---ANNHDGNYNSRYRSRSK 107
           +K+  YD       KN              +P+  FE  F        G +  R R R  
Sbjct: 79  EKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGP 138

Query: 108 DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQG 167
            IKV+  L   + Y+G +I+F  S N  C  C+G G     DGK       +C  C G+G
Sbjct: 139 MIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG---SADGKL-----AQCPDCQGRG 190

Query: 168 YKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVS 225
              + +Q+      TQ +  +C  C G G+        KN CK C+G  + K +    V 
Sbjct: 191 ---VIIQVLRMGIMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVD 241

Query: 226 IPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAE 285
           +P G+         GEA E+    +AGDL+ E  E    N    R G++L     +S+ E
Sbjct: 242 VPPGAPRNYMDTRAGEA-EKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEE 300

Query: 286 AITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEI 345
           A+ G   + I    +++ + LS P    +  G+I  +K  G+ M K G  +G+LY+   +
Sbjct: 301 ALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMK--GFGMPKGGKGYGDLYIDYVV 358

Query: 346 EFP 348
             P
Sbjct: 359 IMP 361

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 108/365 (29%), Positives = 166/365 (45%), Gaps = 50/365 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGV++ A  ++IK  YR+L+ +YHPDK+ D+        KF ++  AY+ LSD 
Sbjct: 19  QDYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSA---HNKFIEVGEAYEVLSDP 75

Query: 71  DKRNEYDN------KKN--------------FEPY--FESDF-ANNHDGNYNSRYRSRSK 107
           +KR  YD       K N               +P+  FE  F           R R  + 
Sbjct: 76  EKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNL 135

Query: 108 DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQG 167
           + + EL+LK  E Y G +I FN + N  C+ C G G    +DGK       +C  C G G
Sbjct: 136 ETREELTLK--EYYRGTSIDFNLNLNDFCEHCEGSG---SQDGKV-----TKCPDCKGHG 185

Query: 168 YKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVS 225
                V++ P    TQ +  +C  C+G G      ++ KN CK C+G+ +++      V 
Sbjct: 186 VVVQIVRMGP---VTQQIQQMCGKCQGRG------STIKNKCKHCHGEKVVRKPKSFHVD 236

Query: 226 IPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAE 285
           +P G+      + +GE+D+     +AGDL  + +E    N    R G+ L     +SL E
Sbjct: 237 VPPGAPRNFVEVKQGESDKG-PDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLRE 295

Query: 286 AITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEI 345
           A+ G   + I      R + +      V   G+I  +   G+ M K    FG+LY+   +
Sbjct: 296 ALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIP--GFGMPKEHNKFGDLYIDYVV 353

Query: 346 EFPPD 350
             P D
Sbjct: 354 IVPDD 358

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  111 bits (278), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 156/366 (42%), Gaps = 51/366 (13%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI--DEGQKLINEIKFKDITAAYQTLS 68
           +DYY ILGV + A+ +EIK  YR+L+ +YHPDK+   DE         F ++  AY  LS
Sbjct: 19  QDYYAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHH-----HFIEVGEAYDVLS 73

Query: 69  DEDKRNEYDNKKN-----------------FEPY--FESDFANNHDGNYNSRYRSRSKDI 109
           D +KR  YD                      +P+  FE  F +N       + R ++  +
Sbjct: 74  DPEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQNLQV 133

Query: 110 KVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYK 169
             ++SLKT   Y G   +F  + N IC  C+G G    +DGK        C  C G G +
Sbjct: 134 NHDISLKT--FYLGTEFEFTLNLNDICDACDGSG---SEDGKTET-----CPDCGGSG-Q 182

Query: 170 NMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRG 229
            MKV  A          CS C+G G+        K+ CK C G  +++        +  G
Sbjct: 183 IMKVFRAGPIEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPG 236

Query: 230 SSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITG 289
                  +++G++ E+      GDL     E    +    R GN L     +S  EA+ G
Sbjct: 237 MERNHIHVMQGQS-EKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQG 295

Query: 290 FENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNL---YVILEIE 346
              + I     ++ L LS P G  ++ G+   +K+ G P+      FG+L   YVIL   
Sbjct: 296 GWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVIL--- 352

Query: 347 FPPDNW 352
             P  W
Sbjct: 353 -LPGEW 357

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  113 bits (282), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 112/437 (25%), Positives = 180/437 (41%), Gaps = 82/437 (18%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D  +Y++L V+   + +E+KK+Y+  AL+YHPDK+   G     +  F+ IT AY  LS
Sbjct: 3   KDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDKN---GHSESAKQAFQQITEAYGILS 59

Query: 69  DEDKRNEYDN-----------------------------KKNFEPYFESDFANNH----- 94
           DE KR  YD                               +N E      FA+       
Sbjct: 60  DERKRKIYDRYGVSDENEIVAILASQKRAAAAAAPAATAARNMEMTPGDLFAHFFGDGFG 119

Query: 95  --------DGN------YNSRYRSRSK-------DIKVELSLKTSELYNGKTIKFNNSRN 133
                    GN      +NS  + +++       DIK  L  +  ELY+GK  K   +R 
Sbjct: 120 AGGEFSFLQGNLGGHCRFNSAAKDKARDGKSRGPDIKHNLKCELKELYSGKVAKLGLTRT 179

Query: 134 RICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGN 193
           R+C  C+G G  T             C +C GQG  +   +  P    T +  C  C G 
Sbjct: 180 RLCHRCSGHGSMTSS----------VCGECRGQGVYSQTRRHGP-LVQTWSSSCRNCSGA 228

Query: 194 GKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEEL----GKK 249
           G + K      + C+ C G   I+      V I  G SN   IIL GEAD+ +    GK+
Sbjct: 229 GTFVKS----NDVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQ 284

Query: 250 NA--GDLIFEINEIIDSNNDLE-RYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYL 306
               GD+I  + E   +      R  + ++    + L  ++ G  + +I      R + L
Sbjct: 285 QVIPGDVIIIVQEQCSTGRYRRFRESDLVLTRCVVDLRTSLCG-GSIYIDDHPSGRPIKL 343

Query: 307 STPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNIL 366
               G+++ PG I  V+N G P     + +G+LY+   + F P+    E  ++I      
Sbjct: 344 EVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNF-PERLEPETMNVISSALAS 402

Query: 367 PNEKTKRNNIVDPINSE 383
            +   ++ NI +P +++
Sbjct: 403 DSNIIRQENITEPSSAQ 419

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  111 bits (277), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 124/460 (26%), Positives = 199/460 (43%), Gaps = 104/460 (22%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKF----------KDIT 61
           Y+IL V   AT +EIKK YRK AL++HPDK+    E  KL  +I            +++ 
Sbjct: 8   YDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSNSNKRELY 67

Query: 62  AAYQTLSDEDKRNEYDNKKN---------------------FEPYF---------ESDF- 90
             Y T+ DE + +E   K+N                     F  +F          S F 
Sbjct: 68  DQYGTV-DEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGASGFG 126

Query: 91  -----------ANNHDGNYNSRY---------RSRSKDIKVELSLKTSELYNGKTIKFNN 130
                      + +HD N NS            +    I+  L     +L++GK  K   
Sbjct: 127 FMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAKLAL 186

Query: 131 SRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYC 190
           +R R+C+ C G G +             +C+ C G G      ++ P   T Q   C  C
Sbjct: 187 NRTRLCQRCQGYGGK----------KATQCRGCQGTGLFTTTKRMGPMVQTWQTT-CKEC 235

Query: 191 KGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE----EL 246
            G GKY +     K+ C +C+G   IK      V +  G  NG+ IIL GEADE    E 
Sbjct: 236 SGTGKYIRS----KDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEY 291

Query: 247 GKKNA--GDLIFEINEIIDSNNDLE-RYGNH----LINHTHISLAEAITGFENKFIVKTF 299
           GK+    GD+I  I    +  +++  +Y  H    ++++  + L  ++ G     I++  
Sbjct: 292 GKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCG--GTIIIEDH 349

Query: 300 DDRDLY-LSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP---PDNWINE 355
              + + +    G++++PG I  V+N+G P+D  G +FGNLY+   ++FP     + IN+
Sbjct: 350 PSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNG-NFGNLYIRFRVKFPEQLKSDTINK 408

Query: 356 KNDII----KIRNILP---NEKTKRNNIVDPINSEYISTF 388
            ++I+     I +IL    N K+ + N  D    + +STF
Sbjct: 409 LSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTF 448

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  109 bits (273), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 164/381 (43%), Gaps = 72/381 (18%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY+ILG+ ++A+ + IK  YR+L+ +YHPDK+ ++ +       F +I  AY+ LSD 
Sbjct: 28  KDYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEA---HNHFIEIGEAYEVLSDP 84

Query: 71  DKRNEYDNKKNFEPYFESDFANN-----------------HD------------------ 95
           +KR  YD        F SD   N                 HD                  
Sbjct: 85  EKRRTYDQ-------FGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGG 137

Query: 96  ------GNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKD 149
                 G +    R +++ I+V   L   E + G  + F       C  C G G    +D
Sbjct: 138 FGGFGGGGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG---SED 194

Query: 150 GKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFC 207
           GK       +C++C G G+    +++ P    TQ +   C  C G G      ++ KN C
Sbjct: 195 GKV-----DKCKECGGNGFVVQVIRMGP---VTQQMHTQCPKCHGAG------STIKNHC 240

Query: 208 KDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNND 267
           K C+G+ L+     I V +P G+      I++   D+EL  + AGDL+ +  EI  +N  
Sbjct: 241 KKCHGQKLVTKSKEINVKVPAGAPRDFLKIVENGGDKELNAE-AGDLLVQFQEIAQNNLG 299

Query: 268 LERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGW 327
             R GN L     +   +A+ G  N+ I      RD+ +S   G  +   +I ++   G 
Sbjct: 300 YRRRGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGM 359

Query: 328 PMDKYGASFGNLYVILEIEFP 348
           P+ +    FG+LY+   I  P
Sbjct: 360 PI-QGSDRFGDLYIDYVIIVP 379

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 157/358 (43%), Gaps = 41/358 (11%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY ILGV  +AT ++IK  YR+L+ +YHPDK+  +     N   F ++  AY+ LSD 
Sbjct: 20  QDYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDP 76

Query: 71  DKRNEYDN----------------KKNFEPY--FESDFANNHDGNYNSRYRSRSKDIKVE 112
           +KR  YD                     +P+  FE  F          R R RS+ ++V+
Sbjct: 77  EKRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQ 136

Query: 113 LSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMK 172
             L   + Y+G  ++F  S N  C  C   G    +DGK         ++C     + + 
Sbjct: 137 EELTLRQYYHGTAVEFTLSLNDHCDHCGATG---SQDGK--------VERCTQCSVRGVI 185

Query: 173 VQLA-PGFYTTQ-NVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230
           VQ+   GF T Q   +C    G       P +    CK C G   IK +    V +P G+
Sbjct: 186 VQVGRQGFMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGA 240

Query: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
                 + +GEA E++   + GD+  ++ E    N    R G +L     +SL EA+ G 
Sbjct: 241 PRDFVAVQQGEA-EKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKEALHGD 299

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
             + +      + +  S  KG+ ++ G++  V   G P+    A FG+LYV   +  P
Sbjct: 300 WKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPD-SAGFGDLYVDYVVILP 356

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  107 bits (267), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 158/363 (43%), Gaps = 46/363 (12%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY+IL + +DAT ++I+  YR+L+ +YHPDK+ ++        KF ++  AY+ LSD 
Sbjct: 21  QDYYKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDA---HHKFIEVGQAYEILSDP 77

Query: 71  DKRNEYDN----------------KKNFEPY--FESDF-----ANNHDGNYNSRYRSRSK 107
           +KR  YD                     +P+  FE  F        H GN   + R R +
Sbjct: 78  EKRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRGQ 137

Query: 108 DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQG 167
           ++    S      YNG  +KF+ + N IC  C+G G     DGK       +C  C G+G
Sbjct: 138 NVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG---SNDGK-----STKCPDCQGRG 189

Query: 168 YKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVS 225
              + VQ+      TQ +  +C  C G G+  K P      CK C+G  +++      + 
Sbjct: 190 ---VTVQVIRMGMMTQQIQQVCGKCGGKGQIIKNP------CKTCHGSKVVQKPKDFEIE 240

Query: 226 IPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAE 285
           +P G+         G AD+     ++GD+  E  E    N    R G HL     ++  E
Sbjct: 241 LPAGAPRKFVHAEHGAADKH-PDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATE 299

Query: 286 AITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEI 345
           A+ G   + +      + + +     K+I+ G+   +   G P+      FG+L++   +
Sbjct: 300 ALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVV 359

Query: 346 EFP 348
             P
Sbjct: 360 VMP 362

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  108 bits (270), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 115/397 (28%), Positives = 162/397 (40%), Gaps = 81/397 (20%)

Query: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
           Y++LGVA DA+  EIKK YRKLAL+YHPDK  + G +  +E  F+ I+ AY  L D  +R
Sbjct: 5   YDVLGVASDASQSEIKKAYRKLALRYHPDK--NNGDEKCHE-AFQKISHAYGVLGDVAQR 61

Query: 74  NEYDNK-----------KNFEPYFESDFANNHDGNY---------NSRYRSRSKDIKVEL 113
             YD              N    F S F  N  G Y          SR  SR  +I  EL
Sbjct: 62  QRYDQSGDENESLQPTGSNAADLFSSFF--NGGGVYPSGSSGGPGPSRGPSRGPNIIHEL 119

Query: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173
                +LY GK IK    R   C+ C+ LG                C  CNG G      
Sbjct: 120 KCTLQDLYRGKVIKLALRRTAPCERCS-LGAANV------------CSSCNGSGNITRIE 166

Query: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233
           ++ P    T +  C+ C+G G+           C  C G   +       V +  G  +G
Sbjct: 167 RVGP-LTQTWSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVFKVHVKPGMHDG 218

Query: 234 DNIILKGEADE-------ELGKKNAGDLIFEINEIIDS---NNDLERYGNHLINHTHISL 283
             I+L GEAD+        L    +GD++  I E+ D+    + L +  N  ++   + L
Sbjct: 219 QTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDL 278

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIR----PGDILE------VKNEGWPMDKYG 333
             A+TG              L    P G +++    PG+ L       V+  G P+D  G
Sbjct: 279 TTALTG-----------GNVLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPIDDTG 327

Query: 334 ASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEK 370
              G+LY+      P      E   I K+R +L N+K
Sbjct: 328 QR-GDLYIRFCTHSPLQ---LEPETIDKLREVLLNDK 360

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 164/375 (43%), Gaps = 72/375 (19%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +DYY+ILG++++   +EIK  YR+L+ ++HPDK+ ++        KF +I  AY+ LSD 
Sbjct: 22  QDYYKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDA---HNKFIEIGEAYEVLSDP 78

Query: 71  DKRNEYDNKKNFEPYFESDFANN---------------HD-------------------- 95
           +KR  YD        F +D   N               HD                    
Sbjct: 79  EKRRMYDQ-------FGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGF 131

Query: 96  -------GNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKK 148
                  G    + + R + IKV  +L   + YNG +I F+   N  C  C+G G    +
Sbjct: 132 GGFGGFGGGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG---SE 188

Query: 149 DGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNV--LCSYCKGNGKYYKKPNSPKNF 206
           DGK       +C  C G+G   + +Q+      TQ V   C+ C G+G+        +N 
Sbjct: 189 DGKVK-----KCPDCGGRG---VVIQVIRMGIVTQQVQQRCNRCAGSGEII------QNK 234

Query: 207 CKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNN 266
           CK C+G  + K +  I VS   G       + +GEA++  G +  GDLI E  E+ ++N 
Sbjct: 235 CKVCSGAKVQKKEKDISVSFDSGIERNHISVQQGEAEKGPGIE-PGDLIVEFFEVPEANM 293

Query: 267 DLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEG 326
              R G  L     ++L EAI G  ++ I      + L L      ++  G++ ++   G
Sbjct: 294 GYRRRGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFG 353

Query: 327 WPMDKYGASFGNLYV 341
            P+      FG+LY+
Sbjct: 354 MPILGSKGKFGDLYI 368

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  105 bits (261), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 132/281 (46%), Gaps = 27/281 (9%)

Query: 104 SRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKC 163
           SR  DIK  L    +ELY+GK  K   +R R+C++C G G   ++           C+ C
Sbjct: 160 SRGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRR----------TCKTC 209

Query: 164 NGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIV 223
            GQG +    +  P    T    C  C G G Y K+     + C +C G+  IK      
Sbjct: 210 RGQGQQTETRRTGP-MVQTWTQTCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFD 264

Query: 224 VSIPRGSSNGDNIILKGEADEELG------KKNAGDLIFEINEIIDSN-NDLERYGNHLI 276
           V + +G  +G  I+L GEADE +       K   GD++  I+++ DS  + + RYG  L+
Sbjct: 265 VEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLV 324

Query: 277 -NHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGAS 335
                I L+ ++ G  + +I      + L +S   G++I P  +  ++  G P   +   
Sbjct: 325 MGSCSIDLSTSLCG-GDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGG 383

Query: 336 FGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNI 376
            GNLY+  ++E+P      E + I +++++L  +K  +N I
Sbjct: 384 KGNLYIQFQLEYPVG---LEPDTIGRLQSVLLQDKYVQNQI 421

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 8  SEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTL 67
          + D   Y+ L V+ DAT  EIK+ Y+ +AL+YHPDK+    +   N  KF+++  AY+ L
Sbjct: 2  ARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKN-HHSEDAKN--KFQEVCKAYEIL 58

Query: 68 SDEDKRNEYDNKKNFEPY 85
          +DEDKR  YD     + Y
Sbjct: 59 ADEDKRVMYDRYGTVDEY 76

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 158/372 (42%), Gaps = 56/372 (15%)

Query: 12  DYYEILGVAEDATHE-EIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           DYY+ILG+ ++  +E EIK  YRKL+ +YHPDK+ ++     N IK   +  AY  L D 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIK---VGEAYDVLGDP 80

Query: 71  DKRNEYDNKKN---------------------FEPY--FESDFANNHDGNYNSRYRSRSK 107
           DK+ +YD   +                      +P+  FE  F     G  N    +   
Sbjct: 81  DKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNPFG 140

Query: 108 ---------DIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEI 158
                     +KVE  L   + Y G   +F  + +  C  C+G G    +DGK  V    
Sbjct: 141 GGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG---SEDGKTKV---- 193

Query: 159 ECQKCNGQGYKNMKVQLAPGFYTTQNVL--CSYCKGNGKYYKKPNSPKNFCKDCNGKCLI 216
            C  C G G   + +Q+      TQ +   C  C+G G      +  KNFCK CNG  + 
Sbjct: 194 -CPDCKGSG---IIIQIIRMGMMTQQIQQPCGRCRGQG------HLIKNFCKVCNGAKVQ 243

Query: 217 KIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLI 276
           +      V +P GS      +  G+A E+      GD+I E NE+   N    R GN+L 
Sbjct: 244 QKLKDFKVYVPPGSPRNHVEVKAGQA-EKNPNYEPGDVIIEFNELPLDNLGYRRRGNNLF 302

Query: 277 NHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASF 336
              +ISL EA+ G   + +      + + L       I  G+I  +K  G P+      F
Sbjct: 303 RTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKF 362

Query: 337 GNLYVILEIEFP 348
           G+LY+  ++  P
Sbjct: 363 GDLYIDYKVIIP 374

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  102 bits (254), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 126/286 (44%), Gaps = 28/286 (9%)

Query: 94  HDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPY 153
           ++ N    +  R  DIK  L     ELY GKT K   +R RIC  C+G G   K      
Sbjct: 164 YNSNDEDHHLDRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK------ 217

Query: 154 VPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGK 213
                 C+ C GQG +    ++ P    + +  C+ C G G + K     K+ C+ C G 
Sbjct: 218 ----CTCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVKN----KDICQQCQGL 268

Query: 214 CLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNA-------GDLIFEINEIIDSNN 266
             IK    + V++  GS +   I+L GE DE +  K         GD++  I  + D N 
Sbjct: 269 GFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNF 328

Query: 267 DLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEG 326
            +  Y N +     I    ++ G    +I      + + L    G++++PG    V++ G
Sbjct: 329 QVINYSNLICKKCKIDFMTSLCG-GVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMG 387

Query: 327 WP--MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEK 370
            P  ++   + FG+LYV  ++ +P      E  +  KI+NIL N+K
Sbjct: 388 MPKFINGVRSGFGHLYVKFDVTYPER---LEPENAKKIQNILANDK 430

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 7/71 (9%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQT 66
          ++   Y+ L V   A+  EIKK YR  AL+YHPDK+   +E ++     KF++I  AY+ 
Sbjct: 3  QNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKR-----KFQEICQAYEI 57

Query: 67 LSDEDKRNEYD 77
          L D   R  YD
Sbjct: 58 LKDNRLRALYD 68

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 130/290 (44%), Gaps = 32/290 (11%)

Query: 98  YNS----RYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPY 153
           YNS    R+ +R  DIK  L     ELY GKT K   +R RIC+ C+G G   K      
Sbjct: 168 YNSEGEGRHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK------ 221

Query: 154 VPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGK 213
                 C+ C GQG +    ++ P    + +  C+ C G G + +     K+ C+ C G 
Sbjct: 222 ----YACKTCKGQGVQTQTNRMGP-LVQSWSQTCADCGGAGIFVES----KDICQQCQGL 272

Query: 214 CLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNA-------GDLIFEINEIIDSNN 266
             +K    + V++  GS +   I+L GE DE +  K         GD++  I  + D   
Sbjct: 273 GFVKQRKILQVAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRF 332

Query: 267 DLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEG 326
            +    N +     + L  ++ G    +I      + + L    G+V++PG    V+N G
Sbjct: 333 QIVDDYNLIYKKCKVDLMTSLCG-GVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMG 391

Query: 327 WP--MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRN 374
            P  ++   + FG++YV  E+ +P      E  + IK++ +L N+K  +N
Sbjct: 392 MPKFINGVRSGFGHMYVKFEVTYPRR---LEPENAIKLQKVLANDKYVQN 438

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 7/66 (10%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTLSDED 71
          Y+ L V   A+  EIKK YR  AL+YHPDK+   +E ++     KF++I  AY+TL D  
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKR-----KFQEICQAYETLKDNH 62

Query: 72 KRNEYD 77
           R+ YD
Sbjct: 63 LRSLYD 68

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 123/279 (44%), Gaps = 28/279 (10%)

Query: 101 RYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIEC 160
            + +R  DIK  L     ELY GKT K   +R RIC  C+G G   K            C
Sbjct: 178 HHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRK----------YTC 227

Query: 161 QKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDD 220
           + C GQG +    ++ P    + +  C+ C G G + K     K+ C+ C G   IK   
Sbjct: 228 KPCKGQGIQTQTKRMGP-LVQSWSQTCADCGGAGTFVKN----KDICEQCQGLGFIKQRK 282

Query: 221 PIVVSIPRGSSNGDNIILKGEADEELGKKNA-------GDLIFEINEIIDSNNDLERYGN 273
            + V++  GS +   I+L GE DE +  K         GD++  I  + D    +    +
Sbjct: 283 ILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCD 342

Query: 274 HLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP--MDK 331
            +     + L  ++ G    +I      + + +    G+V++PG    V+N G P  ++ 
Sbjct: 343 LICKKCEVDLMTSLCG-GIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFING 401

Query: 332 YGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEK 370
             + FG+LYV  ++ +P      E  +  K+++IL N+K
Sbjct: 402 VRSGFGHLYVKFDVTYPER---LEPENAAKVKSILANDK 437

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTLSDED 71
          Y+ L V   A+  EIKK YR  AL+YHPDK+   +E ++     KF++I  AY+ L D  
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKR-----KFQEICQAYEVLKDNH 62

Query: 72 KRNEYD 77
           R+ YD
Sbjct: 63 LRSLYD 68

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 111/417 (26%), Positives = 167/417 (40%), Gaps = 108/417 (25%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
           D   YE L V   AT  +IKK Y+KLAL+YHPDK+        ++ KF+ +  AY+ L+D
Sbjct: 4   DTKLYETLNVPITATTLDIKKAYKKLALKYHPDKN---NHSEDSKTKFQAVCQAYEILND 60

Query: 70  EDKRNEYD------------------------NKKNFEPY-------FESDFANNHDG-- 96
           +  R  YD                            F P        F   F NN++   
Sbjct: 61  KQSRAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAK 120

Query: 97  -----------NYNSRYR----------SRSKDIKVELSLKTSELYNGKTIKFNNSRNRI 135
                      N+ S              R  DIK  L     ELYNGK  K   +R R+
Sbjct: 121 QPSQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRL 180

Query: 136 CKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGK 195
           C  CNG G   +            C+ C G G++    ++ P    T    C+ C G G 
Sbjct: 181 CLPCNGFGGLQR----------TTCESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGC 229

Query: 196 YYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEEL------GKK 249
           + K    P + C  C+G+  I+      V +  G  +G ++I++GEADE +       K 
Sbjct: 230 FIK----PNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKV 285

Query: 250 NAGDLIFEINEIIDSNNDLERYGNH--LINHTHISLAEAITGFENKFIVKTFDDRDLYLS 307
             GD++  I +  D NN  +   N   L+N   + L  ++ G E            +Y+ 
Sbjct: 286 IPGDVVITIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGE------------VYID 333

Query: 308 T-PKGKVIR----PGDILE------VKNEGWPM-----DKYGASFGNLYVILEIEFP 348
             P GK+I+    PG+IL+      ++  G P      D      G+LY+  +I++P
Sbjct: 334 NHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYP 390

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 110/445 (24%), Positives = 170/445 (38%), Gaps = 117/445 (26%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQT 66
           +D   Y++L V  DA+   IKK +   AL+ HPDK+   +E +K     +F++I+ AY+ 
Sbjct: 3   KDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKK-----QFQEISKAYEV 57

Query: 67  LSDEDKRNEYDNKKN-----------------------------------FEPYFESD-- 89
           LSD   R  YD                                       F  +F S   
Sbjct: 58  LSDPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGD 117

Query: 90  ------FANNHDGNYNSRYRSRSKD--------IKVELSLKTSELYNGKTIKFNNSRNRI 135
                 F +  DG  NS     ++D        IK  L    S+LY GK  K   +R R+
Sbjct: 118 AGPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRV 177

Query: 136 CKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGK 195
           C +C+G G                C+ C GQG      ++ P    T +  C+ C G G 
Sbjct: 178 CSSCDGKGGMRVA----------SCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGT 226

Query: 196 YYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE------ELGKK 249
           + K      + C  C G  + K      V +  G ++   I+L GEADE       L K 
Sbjct: 227 FIKD----SDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKV 282

Query: 250 NAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTP 309
             GD++  I+ + ++   +    + ++ +  + L   + G E            +    P
Sbjct: 283 QPGDVVIVIDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEI-----------MIEGHP 331

Query: 310 KGKVIR----PGDILEVKN----EGWPMDKYGA-------------SFGNLYVILEIEFP 348
            GK+I+    P ++L+       EG  M K  A              +GNLYV  +++FP
Sbjct: 332 SGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFP 391

Query: 349 PDNWINEKNDIIKIRNIL---PNEK 370
                 E   I K++ IL   PN K
Sbjct: 392 ER---LEDTTITKLQEILEQDPNVK 413

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 137/321 (42%), Gaps = 37/321 (11%)

Query: 76  YDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRI 135
           + N+   + +F S+  + +    + +   R  DIK  L    S LY+GK  K    R R 
Sbjct: 200 FSNRPTGDAFFNSNINSLNKCISDDKNLKRGPDIKHTLKCTLSNLYSGKRSKLRLERTRC 259

Query: 136 CKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGK 195
           C  C G G    K           C KCNG+G      +  P    T    C  C GNG 
Sbjct: 260 CLKCKGFGSLNIK----------SCSKCNGRGSLTQTKKFGP-MTQTFTQTCDGCGGNGT 308

Query: 196 YYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE----ELGKKNA 251
           +       ++ C +C G+  +       V I  G ++G  IIL GEADE     LGK+  
Sbjct: 309 FA----DAQDICNECQGEGFLNEKKIFEVEITPGMTDGQLIILTGEADEVISTNLGKERV 364

Query: 252 --GDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTP 309
             GD+I  IN + D    + +  + L  +  I+L  ++ G  + +I     +  + ++  
Sbjct: 365 IPGDIILTINLLPDPTFKVVQGADLLYANYKINLLTSLCG-GSIYIKNHPSEHLIKINII 423

Query: 310 KGKVIRPGDILEVKNEGWPMDKYGASF------------GNLYVILEIEFPPDNWINEKN 357
            G++I+ G I  V+N G P                    GNL +  EI +P    + E +
Sbjct: 424 PGELIKNGAIKTVENLGMPKIDLSVGHSNDIQANKPTLKGNLVIHFEIVYPD---MLETD 480

Query: 358 DIIKIRNILPNEKTKRNNIVD 378
            +I+++NIL N+K  +N I +
Sbjct: 481 TVIELQNILNNDKYIQNQITE 501

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 5/72 (6%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDK-SIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          Y+IL V  D+    IKK YR LAL+YHPDK ++ E  K +    F+ I+ AY  LS++DK
Sbjct: 8  YDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQM----FQKISEAYVVLSNKDK 63

Query: 73 RNEYDNKKNFEP 84
          R  YD     +P
Sbjct: 64 RQMYDKYGTVDP 75

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 162/406 (39%), Gaps = 89/406 (21%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           +D   Y  L +   A+  +IKK YR  AL+YHPDK+ +  +   ++ KF+DI+ AY  L 
Sbjct: 3   KDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEE---SKKKFQDISEAYSILR 59

Query: 69  DE--------------------------------------------DKRNEYDNKKNFEP 84
           DE                                            D +N    + N  P
Sbjct: 60  DENQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSP 119

Query: 85  YFESDFANNH----------DGNYNSRYRSRSK------DIKVELSLKTSELYNGKTIKF 128
            F   F ++           DG +   + ++S+      DI   L     +LY GK  K 
Sbjct: 120 PFGFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKL 179

Query: 129 NNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCS 188
              R+++C  C G G   +            C +C+G G      +L P   T  +  C+
Sbjct: 180 RLERSKLCSICKGDGGVKRS----------MCNQCHGDGNITETTRLGPMLQTFTHT-CN 228

Query: 189 YCKGNGKYYKKPNSPKNFCKDCNGKCL---IKIDDPIVVSIPRGSSNGDNIILKGEADEE 245
            C GNG       +    C+ CNG      +KI D   V I  G  +G  I+   E DE 
Sbjct: 229 ICNGNGWVIISQET----CQGCNGVGFYNEMKIFD---VEIYPGMKDGTQIVFNNEGDEI 281

Query: 246 LGKKNA--GDLIFEINEIIDSNNDLERYGNHLINHTH-ISLAEAITGFENKFIVKTFDDR 302
           + K+    G++I  INEI D+       G  L    + I L  ++ G    +I    +++
Sbjct: 282 VNKRRVIPGNVIIHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCG-GVIYIKGHPNNK 340

Query: 303 DLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
            + +    G++I  G +  V++ G P +K G  +G LY+  ++++P
Sbjct: 341 LIKVDILPGEIIESGSVKGVESLGMPKNK-GNEYGILYIQFQVKYP 385

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 120/278 (43%), Gaps = 27/278 (9%)

Query: 101 RYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIEC 160
            + +R  DIK  L     ELY GKT K   +R RIC  C G G   K            C
Sbjct: 182 HHLNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQK----------YTC 231

Query: 161 QKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDD 220
           + C GQG +     + P    + +  C+ C G G + +     K+ C+ C G   IK   
Sbjct: 232 KTCKGQGVQTQTKCMGP-LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFIKQRK 286

Query: 221 PIVVSIPRGSSNGDNIILKGEADEELGKKNA------GDLIFEINEIIDSNNDLERYGNH 274
            + V++  G+S+   I+L GE DE + K         GD++  I  + D    +    + 
Sbjct: 287 ILQVTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSL 346

Query: 275 LINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP--MDKY 332
           +     + L  ++ G    +I      + + L    G+V++P     ++  G P  ++  
Sbjct: 347 IYKKCKVDLMTSLCG-GIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGV 405

Query: 333 GASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEK 370
            + FG+LYV  ++ +P      E  + +K++ IL ++K
Sbjct: 406 RSGFGHLYVKFDVSYPER---LEPENAMKLQKILAHDK 440

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTLSDED 71
          Y+ L V   A+  EIKK YR  AL+YHPDK+   +E ++     KF++I  AY+ L D  
Sbjct: 8  YDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEESKR-----KFQEICQAYEVLKDNH 62

Query: 72 KRNEYD 77
           R+ YD
Sbjct: 63 LRSLYD 68

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 102/406 (25%), Positives = 158/406 (38%), Gaps = 97/406 (23%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +D Y++LG+ +DA   EIKK Y KLA +YHPD + D+G    ++ KF DIT AY+ LSDE
Sbjct: 46  KDPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEILSDE 101

Query: 71  DKRNEYD-----------------------------------------NKKNFEPYFESD 89
            K+ +YD                                            NFE  F + 
Sbjct: 102 KKKMQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPFGFGGINFEDLFGAA 161

Query: 90  FANNHD------------------GNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNS 131
           F+  +                   G + S  R  + ++   LS K + ++  + +  N S
Sbjct: 162 FSKANGAAGRGGGRSSGRGNGSPFGGFYSEVRGDNVEVIHTLSFKDA-VFGSRNVTLNVS 220

Query: 132 RNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCK 191
               CKTC G G +             EC  C+G G     V +  GF       C  C 
Sbjct: 221 SIEQCKTCTGSGMKPGSH-------RSECSSCHGTG---TTVHVRAGFQMAST--CMSCG 268

Query: 192 GNGKYYKKPNSPKNFCKDCNGKCL--IKIDDPIVVSIPRGSSNGDNIILKGEA------- 242
           G G+   +    ++ C++C+G+      +   + V +P G  +GD I + G+        
Sbjct: 269 GTGENIAR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAI 324

Query: 243 ---DEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTF 299
                +  K   GDL+  I    D    + R GN L     I +  A+ G     ++ T 
Sbjct: 325 APEQRDQVKVTRGDLLVRIRVKQDKVFSI-RNGNELWQTREIPVTTAVLG--GNVVIPTL 381

Query: 300 DDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEI 345
           D   L L    G   R G+ + V  +G P  + G S G++ V   +
Sbjct: 382 DGNQLRLRVRSG--TRDGETVSVPGQGVPRGRGGLSRGDMKVQWRV 425

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/334 (27%), Positives = 141/334 (42%), Gaps = 69/334 (20%)

Query: 104 SRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKC 163
           SR  DIK  L+    ELY GK  K   +R R C +CNG+G              I C +C
Sbjct: 168 SRGPDIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMGGMNT----------IICNEC 217

Query: 164 NGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIV 223
            G+G       L P    + +  C  C G G +       ++ CK+C G+  ++      
Sbjct: 218 QGKGINTETKMLGP-MVQSWSSTCFNCSGMGYFI----DSQSGCKECQGEGYLRERTIFT 272

Query: 224 VSIPRGSSNGDNIILKGEADEEL--GKKNA-----GDLIFEINEI----------IDSNN 266
           V++  G  N   I+LKGEAD+ +  GK N      GD+I  IN+I          ID   
Sbjct: 273 VTVKPGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGE 332

Query: 267 DLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLST-PKGKVIR----PGDILE 321
           +  ++   +IN   + L           ++ +    ++Y+   P GK+I+    P +IL+
Sbjct: 333 NKNKFHFEIINEKDLLLRNCQID-----LITSLCGGEIYIKNHPSGKLIKLDIIPSEILK 387

Query: 322 ------VKNEGWPMDKY-------GASF---GNLYVILEIEFPPDNWINEKNDIIKIRNI 365
                 V+N G P  +Y       G  +   G+LY+  ++++P      E   I K+R+I
Sbjct: 388 PDCLKCVENLGMP--RYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSI 442

Query: 366 LP------NEKTKRNNIVDPINSEYISTFEIVKS 393
           L       NE  K   I+D    + I   E V S
Sbjct: 443 LSEDIHMKNELQKEKVIIDQQLDDCIEVEEHVLS 476

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y IL V   AT  EIK  Y+KLAL+YHPDK+    +   +++KF++I  AY+ L D+DK+
Sbjct: 15 YSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEE---SKLKFQEICKAYEVLHDKDKK 71

Query: 74 NEYD 77
            YD
Sbjct: 72 LLYD 75

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 117/280 (41%), Gaps = 68/280 (24%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +D Y+ LGV+ DA+  +IK+ Y KLA +YHPD + + G     +  F ++  AY+ LSDE
Sbjct: 47  KDPYKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGA----DKTFHNLQNAYEILSDE 102

Query: 71  DKRNEYD----------------------------------NKKNFEPYF-----ESDFA 91
            K+ +YD                                     NFE  F      S F 
Sbjct: 103 KKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFR 162

Query: 92  NNHD-GNYNSR------YRSRSKDIKVELSLKTSEL-YNGKTIKFNNSRNRICKTCNGLG 143
           N  D G +N R      Y+  S +I+  +S K +    N  ++K+ +     C TC+G G
Sbjct: 163 NGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDP--CGTCHGSG 220

Query: 144 WRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSP 203
            +  +  K        C  CNG G    +V +  GF       C +C G G    + ++ 
Sbjct: 221 LKNGEQHK-----RKTCSYCNGTG---TQVHVKSGFQMAST--CMHCHGEGTTIAREDT- 269

Query: 204 KNFCKDCNGKCL-IKIDDPIVVSIPRGSSNGDNIILKGEA 242
              C  C+G  + I     + V+ P G S+GD I + GE 
Sbjct: 270 ---CSACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEG 306

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 104/402 (25%), Positives = 160/402 (39%), Gaps = 93/402 (23%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           E RD YE LGV+ DA+  +IKK Y KLA +YHPD + DEG     E KF D+  AY+ LS
Sbjct: 48  EIRDPYETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEGA----EKKFHDLQNAYEILS 103

Query: 69  DEDKRNEYDN--------------------------------------KKNFEPYFESDF 90
           DE KR++YD                                         NFE  F + F
Sbjct: 104 DESKRSQYDQFGAAAFSQGGAAGPGNGAGGFQGGFAGFGGFEGFGDFGGINFEDLFGAAF 163

Query: 91  -----------ANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTC 139
                         +  N+   Y+  S  +   +S K + ++  K IK   S    C TC
Sbjct: 164 RGGSGSGASGARGRNGANFVREYKGDSIHVPFNVSFKDA-VFGLKGIKLKYSAYDQCGTC 222

Query: 140 NGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKK 199
            G G ++             C  C+G G    ++ +  GF       C+ C G G   ++
Sbjct: 223 AGSGLKSGAK-------RSSCSICHGTG---TQMHVRAGFQMAST--CTQCNGEGSSIRR 270

Query: 200 PNSPKNFCKDCNGKCLI-KIDDPIVVSIPRGSSNGDNIILKGEA-------DEELG---K 248
            +     C  C G+ ++      I V +P G  +GD + +  +        D E+    +
Sbjct: 271 SDQ----CSSCRGEGVVFNRQKEIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIR 326

Query: 249 KNAGDLIFEINEIIDSNNDLERYGNHLINHTH---ISLAEAITGFENKFIVKTFDDRDLY 305
              GDL+ +I   ++ +   +   N+ I +T    I+ A A+ G  N   + T D   L 
Sbjct: 327 TRRGDLLIQIR--VERDPRFQIRNNYDIWYTQDIPITTA-ALGGVVN---IPTVDGEQLR 380

Query: 306 LSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEF 347
           L    G   +   ++ V N+G P     AS G++ V  +I  
Sbjct: 381 LKIAPG--TQHEQVVSVPNKGVP-KGLTASRGDMKVQYKISL 419

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           E RD YE LGVA+DA+  +IKK Y KLA Q+HPD + DEG     E KF D+  AY+ LS
Sbjct: 38  EIRDPYETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILS 93

Query: 69  DEDKRNEYDN 78
           DE+KR +YD 
Sbjct: 94  DENKRRQYDQ 103

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%), Gaps = 2/73 (2%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTLS 68
           ++YY++LGV + AT ++I+K+Y  +  +YHPDK   + E QK+ N+ K  +I  AY+ LS
Sbjct: 504 KNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILS 563

Query: 69  DEDKRNEYDNKKN 81
           DE KR EYD++++
Sbjct: 564 DEGKRKEYDDQRS 576

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY+IL V+ DA+ +EIKK+YRKLA++ HPDK+ D+ Q    + KF+++  AYQ L D
Sbjct: 4  DTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQA---QTKFQELAKAYQVLID 60

Query: 70 EDKRNEYDN 78
          +D R +YD 
Sbjct: 61 DDLRKKYDQ 69

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 127/311 (40%), Gaps = 78/311 (25%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
           +D Y+ LG+  +A+  +IKK Y KLA +YHPD + +E      E KF D+  AY+ LSDE
Sbjct: 46  KDPYKTLGINSNASQSDIKKAYYKLAKKYHPDINKEENA----EAKFHDLQNAYEILSDE 101

Query: 71  DKRNEYDN-------------------------------------KKNFEPYFESDFANN 93
            KR +YD                                        NFE  F + F   
Sbjct: 102 QKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQ 161

Query: 94  H-------DGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRT 146
           H       + N+   ++  +  +   L+ K S ++  K +K N +    C TCNG G + 
Sbjct: 162 HSNNTSNSNRNFFREFKGDTIHLNYNLNFKDS-VFGKKNVKLNFNSFDPCNTCNGSGLK- 219

Query: 147 KKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNF 206
                 +   +  CQ CNG G    +V +  GF       C+ C G G        P ++
Sbjct: 220 ------HNAHKSTCQTCNGTG---TRVHIRGGFQMMS--TCNDCNGEGTKI----DPNDY 264

Query: 207 CKDCNGKCL-IKIDDPIVVSIPRGSSNGDNIILKGEA-------DEELGKKN-----AGD 253
           C  C+G  +  K +  I V +P    +GD I +  +        D +L   N      GD
Sbjct: 265 CNHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGD 324

Query: 254 LIFEINEIIDS 264
           ++ +IN I D+
Sbjct: 325 ILIKINVINDT 335

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YYEILGV   AT  EIKK YRK ++Q HPDK+ D+   +  E +F+ I+ AYQ LSD
Sbjct: 4  DTGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDD--PMATE-RFQAISEAYQVLSD 60

Query: 70 EDKRNEYD 77
          ED R +YD
Sbjct: 61 EDLRGKYD 68

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 2/73 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTL 67
           D+DYY+ILGV + AT ++++++Y +L  ++HPDK   +++ Q+  NE K  +I  AY+ L
Sbjct: 526 DKDYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEIL 585

Query: 68  SDEDKRNEYDNKK 80
           SD+DKR +YDN +
Sbjct: 586 SDDDKRTKYDNAR 598

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 51/70 (72%), Gaps = 2/70 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTL 67
           ++DYY+ILG++++AT ++I+K Y +L  +YHPDK   + E ++  N  K  +I  AY+TL
Sbjct: 557 NKDYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETL 616

Query: 68  SDEDKRNEYD 77
           SDE K++EYD
Sbjct: 617 SDEAKKSEYD 626

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  AT  EIKK YRK A+Q HPDK+ D+ +    E KF+ +  AYQ LSD
Sbjct: 4  DTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPE---AETKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYDN 78
           + R+ YD 
Sbjct: 61 TELRSRYDQ 69

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
          +D  YY++LGV  DAT E+IKK YRK A+Q HPDK+ ++ +    + KF++++ AY+ LS
Sbjct: 3  KDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEA---QAKFQEVSKAYKVLS 59

Query: 69 DEDKRNEYD 77
          D + R+ YD
Sbjct: 60 DGELRSRYD 68

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YEIL +  DAT EEIKK YR   L  HPDK        +N +    I  AY+ LS+  K
Sbjct: 9  HYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQK 68

Query: 73 RNEYDNKKNFEPYFESDFANNHDG 96
          R EYD K   E Y +  F N  DG
Sbjct: 69 RGEYD-KTILENYKKQGFHNCGDG 91

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 2/72 (2%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQTLS 68
           ++YY++L V   AT ++I+K+Y  +  +YHPDK   + E QKL N+ +  +I  AY+ LS
Sbjct: 502 KNYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILS 561

Query: 69  DEDKRNEYDNKK 80
           DE KR EYD+++
Sbjct: 562 DEGKRKEYDDQR 573

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +EIKK YRK ALQYHPDK         N  KFK I+ AY+ LSD +KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALQYHPDKPTG------NTEKFKQISEAYEILSDSNKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDQ 66

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + + RG   G  I  K E D          L F + E   ++   +R G +L+    +
Sbjct: 205 IDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQE--KAHPLFKRDGENLLYTVPL 262

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     V+T D R L LS  + + I+P +      +G P  K     G+L +
Sbjct: 263 SFQESLLGFSK--TVQTIDGRSLSLS--RTQPIQPTETTTYPGQGMPNPKNPNQRGDLII 318

Query: 342 ILEIEFP 348
             +I++P
Sbjct: 319 TYKIDYP 325

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTL 67
           D+DYY+IL V ++A  ++I+K Y +L  +YHPDK   + E +++ NE K   I  AY+ L
Sbjct: 505 DKDYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEIL 564

Query: 68  SDEDKRNEYD 77
           SDE KR EYD
Sbjct: 565 SDESKRKEYD 574

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 51/88 (57%), Gaps = 20/88 (22%)

Query: 6   GSSED--RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK----------SIDEGQKLIN 53
           GSS D  +DYY+ILGV+ +A  +EI+K Y  L  +YHPDK          SI E    IN
Sbjct: 534 GSSYDPKKDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQIN 593

Query: 54  EIKFKDITAAYQTLSDEDKRNEYDNKKN 81
           E        AY+TLSDEDKR EYD  K+
Sbjct: 594 E--------AYETLSDEDKRKEYDLSKS 613

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (59%), Gaps = 5/87 (5%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  E+KK YRK ALQYHPDK+ D  Q+     KF  I AAY+ LSD  +
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATE--KFAIIRAAYEVLSDPQE 62

Query: 73 RNEYDNKKNFEPYFESDFANNHDGNYN 99
          R  YD+ K       +D A + DG Y+
Sbjct: 63 RAWYDSHK---EQILNDTAPDADGYYD 86

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY+ILGV  DAT  EIKK YR+ A+Q HPDK  D+      + KF+ +  AYQ LSD
Sbjct: 4  DTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPD---AQAKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
             R+ YD
Sbjct: 61 PGLRSRYD 68

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  E+KK YRK ALQYHPDK+ D  ++     KF  I AAY+ LSD  +
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATE--KFAIIRAAYEVLSDSQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  ++KK YR+ ALQYHPDK+I   Q+   EI F  I AAY+ LSD  +
Sbjct: 5  YYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQ-ATEI-FASIRAAYEVLSDAQE 62

Query: 73 RNEYDNKKNFEPYFESDFANNHD 95
          R  YD  +  E     DF N+ +
Sbjct: 63 RAWYDAHR--EQILNDDFENDEE 83

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 6/64 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A+  EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD +KR
Sbjct: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61

Query: 74 NEYD 77
          + YD
Sbjct: 62 SVYD 65

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 269 ERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP 328
           +R G+++I    ++  E++ GF     ++T D R L LS  + + ++P +      +G P
Sbjct: 263 KRDGDNIIYTLPLTFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMP 318

Query: 329 MDKYGASFGNLYVILEIEFP 348
           + K     GNL +  +I +P
Sbjct: 319 ISKNPGQRGNLIIKYKINYP 338

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY+ILG+   AT  EIKK YRK A++ HPDK  D+      + KF+ +  AYQ LSD
Sbjct: 4  DTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPD---AQSKFQSVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
          +D R  YD
Sbjct: 61 DDLRKRYD 68

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  E+KK YRK ALQYHPDK+ D  ++     KF  I AAY+ LSD  +
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQ--KFAIIRAAYEVLSDSQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 11 RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
          +D Y +LGV   A+  EIKK Y KLA QYHPD + + G     E KF D+  AY+ LSDE
Sbjct: 34 KDPYGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGA----EKKFHDLQNAYEILSDE 89

Query: 71 DKRNEYDN 78
           KR ++D 
Sbjct: 90 SKRKQFDQ 97

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 6/77 (7%)

Query: 6   GSSED--RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDI 60
           G S D  +DYY++LGVA  AT +EI+K Y  L  +YHPDK   + ++ ++ I+E     I
Sbjct: 527 GPSHDPQKDYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHET-MSQI 585

Query: 61  TAAYQTLSDEDKRNEYD 77
             AY+TLSD+DKR EYD
Sbjct: 586 NEAYETLSDDDKRKEYD 602

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTL 67
           D+DYY+IL + ++A  +EI+K Y      YHPDK   + E Q+  N+ K  +I  AY+TL
Sbjct: 473 DKDYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETL 532

Query: 68  SDEDKRNEYD 77
           SDE KR EYD
Sbjct: 533 SDEGKRREYD 542

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV   A  +EIKK YRK AL+YHPDK   + +      KFK I+ AY+ LSD +KR
Sbjct: 8  YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSNKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 16/118 (13%)

Query: 241 EADEELGKKNAGD----------LIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290
           +A  +L  KN GD          L F I+E    +   +R  ++L+    ++  E++ GF
Sbjct: 235 KAGTKLTYKNKGDYNPRTHGRKTLQFIIDE--KPHPTFQREDDNLVCTVPLTFKESLLGF 292

Query: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
                V+T D R+L +S  + + I+P +I     +G P+ K     G+L V  +I +P
Sbjct: 293 SK--TVQTIDGRNLPIS--RSQPIQPTEITRYPGQGMPISKKPGQRGDLIVKYKIAYP 346

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  E+KK YRK ALQYHPDK+ D  ++     KF  I AAY+ LSD  +
Sbjct: 5  YYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQ--KFAVIRAAYEVLSDPQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 111/284 (39%), Gaps = 75/284 (26%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPD--KSIDEGQKLINEIKFKDITAAYQTLS 68
           +D Y+ LG+ + AT  EIKK Y KLA +YHPD  K +D       E KF D+  AY+ LS
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEVDA------EKKFHDLQNAYEILS 113

Query: 69  DEDKRNEYDNKK-----------------------------------------NFEPYFE 87
           DE+KR +YD                                            NFE  F 
Sbjct: 114 DENKRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFGGINFEDLFG 173

Query: 88  SDFANNHDGNYNS--------RYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTC 139
           + F      +           +YR    +I  ++S K + ++    ++   S    C TC
Sbjct: 174 AAFGGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDA-VFGSNNVQLKFSALDPCSTC 232

Query: 140 NGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKK 199
           +G G +           ++ C  C+G G     V +  GF       C  C G G   + 
Sbjct: 233 SGTGMKPNTH-------KVNCSTCHGTG---TTVHIRGGFQMMST--CPTCNGEGTMKR- 279

Query: 200 PNSPKNFCKDCNGKCL-IKIDDPIVVSIPRGSSNGDNIILKGEA 242
              P++ C  C+G+ + +     I V +P G  +GD + + G+ 
Sbjct: 280 ---PQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQG 320

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 152/382 (39%), Gaps = 91/382 (23%)

Query: 8   SEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTL 67
           S  +D Y+ LGVA  A+  EIKK Y KLA +YHPD + +       E  F ++  AY+ L
Sbjct: 52  SSFKDPYKTLGVARSASQSEIKKAYYKLAKKYHPDINKEPDA----EKTFHNLQNAYEIL 107

Query: 68  SDEDKRNEYDN---------------KKNFEPYF-----------------------ESD 89
           SDEDKR ++D                   F P+                           
Sbjct: 108 SDEDKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGG 167

Query: 90  FANNHDGNYNSR------YRSRSKDIKVELSLKTSEL-YNGKTIKFNNSRNRICKTCNGL 142
            +   +G + SR      Y+  + +I   LS K +    N  ++ FN      C TC+G 
Sbjct: 168 ASGRSNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDP--CDTCHGS 225

Query: 143 GWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNS 202
           G +  ++ K        C  CNG G    ++ +  GF       C++C G G       +
Sbjct: 226 GLKKGENHK-----RRSCSYCNGTG---TQIHVRSGFQMAST--CNHCHGEGTII----A 271

Query: 203 PKNFCKDCNGKCLIKID--DPIVVSIPRGSSNGDNIILKGEA----------DEELGKKN 250
            ++ C  C+G   +K+D    I V++P   S+GD I + GE           D++  K +
Sbjct: 272 FEDMCTKCHGDG-VKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLS 330

Query: 251 AGDLIFEINEIIDSN----NDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYL 306
            GDL+  I    D +    N  + +    I  T  +L   IT       +KT DD+ + L
Sbjct: 331 RGDLLVRIRVKPDPDYTIKNKYDIWSVKEIPITTAALGGTIT-------IKTIDDKQIRL 383

Query: 307 STPKGKVIRPGDILEVKNEGWP 328
               G   +   +  + N G P
Sbjct: 384 KVMAG--TQHDQVTSIPNMGVP 403

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD++KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKNKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDQ 66

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (44%), Gaps = 12/161 (7%)

Query: 204 KNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEAD---EELGKKNAGDLIFEINE 260
           K+F     G+  I     I + +  G   G  I  K + D   +  G+K    ++ E N 
Sbjct: 206 KSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNH 265

Query: 261 IIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDIL 320
            +      +R G+ L     ++  E++ GF  +  ++T D R L +S  + + I+P +  
Sbjct: 266 PV-----FKREGDDLTCTLPLTFKESLLGFNKQ--IQTIDGRTLPIS--RTQPIQPSETS 316

Query: 321 EVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDIIK 361
               +G P+ K  +  GNL V  +I++P      +KN I++
Sbjct: 317 VYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNAILQ 357

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
          +D   Y++LGV+  A   E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+
Sbjct: 3  KDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILN 56

Query: 69 DEDKRNEYDN 78
          D  KR  YDN
Sbjct: 57 DPQKREIYDN 66

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 229 GSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAIT 288
           G   G  I  K E D          + F I E    + +  R GN LI    ++  E++ 
Sbjct: 222 GWKAGTKITYKNEGDYNPRTGRRQTMQFIIQE--KPHENYTRDGNDLIYTLPLTFKESLL 279

Query: 289 GFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348
           GF NK  ++T D R L +S  + + ++P D+     +G P+ K  +  GNL V  +I++P
Sbjct: 280 GF-NK-TIQTIDGRTLPIS--RVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYP 335

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 4/89 (4%)

Query: 11 RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS---IDEGQKLINEIKFKDITAAYQTL 67
          R +YEILG+  DA++ EIK+ YR + L+ HPDKS    +      +     DI  AYQTL
Sbjct: 3  RSFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTL 62

Query: 68 SDEDKRNEYDNKKNFEPYFESDFANNHDG 96
           D+D R +YD +   E + +  F N  DG
Sbjct: 63 IDQDLRKKYDEELA-ESFKKLGFHNAGDG 90

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV   AT  EIKK YR+ A+Q HPDK  D+ +    + KF+++  AYQ LSD
Sbjct: 4  DTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPE---AQAKFQEVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
             R+ YD
Sbjct: 61 PGLRSRYD 68

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV  +AT  +IKK YRK A+Q HPDK  D+ +    + KF+ +  AYQ LSD
Sbjct: 4  DTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPE---AQSKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYDN 78
             R++YD 
Sbjct: 61 PGLRSKYDQ 69

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +EIKK YRK AL+YHPDK         N  KFK+I+ A++ LSD +KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------NTEKFKEISEAFEILSDSNKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDQ 66

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 224 VSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISL 283
           + +  G   G  I  K   D          L F I E +  N   +R  + L+ +  ++ 
Sbjct: 222 IQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEKVHPN--FKREDDTLVYYLPLTF 279

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
            E++ GF+    ++T D R L +S  + + ++P D      +G PM K     G++ V  
Sbjct: 280 KESLLGFQK--TIQTIDGRTLPIS--RVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVKY 335

Query: 344 EIEFP 348
           +IE+P
Sbjct: 336 KIEYP 340

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  A+  EIKK YRK A++ HPDK  D+      + KF+ +  AYQ LSD
Sbjct: 4  DLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
          E+ R  YD
Sbjct: 61 EELRKRYD 68

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
          +D   Y++LG++  A   EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LS
Sbjct: 3  KDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56

Query: 69 DEDKRNEYDN 78
          D  KR  YD 
Sbjct: 57 DAQKREVYDT 66

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 50/73 (68%), Gaps = 4/73 (5%)

Query: 8   SEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS---IDEGQKLINEIKFKDITAAY 64
           + ++DYY+IL V++DA  ++I+K+Y  L  ++HPDK     ++ QK I E K  +I  AY
Sbjct: 523 ASNKDYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQE-KMSEINEAY 581

Query: 65  QTLSDEDKRNEYD 77
           + LSDE KRNEYD
Sbjct: 582 EVLSDETKRNEYD 594

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LG++  A  +EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD  KR
Sbjct: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDQ 66

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 268 LERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGW 327
             R GN LI    ++  E++ GF NK  ++T D R L +S  + + I+P +      +G 
Sbjct: 258 FTRDGNDLIYTLPLTFKESLLGF-NK-TIQTIDGRTLPVS--RIQPIQPSEKSTYPGQGM 313

Query: 328 PMDKYGASFGNLYVILEIEFP 348
           P+ K     G++ V  ++++P
Sbjct: 314 PIPKTPGQRGDMIVNYKVDYP 334

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LG+  DA+  EIKK YRK A+  HPDK  D+ +    + KF+ I  AYQ LSD
Sbjct: 4  DTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGQAYQVLSD 60

Query: 70 EDKRNEYD 77
           + R+ YD
Sbjct: 61 PELRSRYD 68

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTL 67
           +DYY+ILGV+  A+ +EI+K Y  L  +YHPDK   + ++ Q+ I+E     I  AY+TL
Sbjct: 537 KDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHET-MSQINEAYETL 595

Query: 68  SDEDKRNEYD 77
           SD+DKR EYD
Sbjct: 596 SDDDKRKEYD 605

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YEIL +  DAT EEIK+ YR   L  HPDK        I+ +    I  AY+ LSD   
Sbjct: 9  HYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRS 68

Query: 73 RNEYDNKKNFEPYFESDFANNHDG 96
          R EYD +   E Y +  F N  DG
Sbjct: 69 RCEYD-RLILENYKQQGFHNCGDG 91

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LG+  DAT  EIKK YR+ A+Q HPDK  D+      + KF+ +  AYQ LSD
Sbjct: 4  DMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPD---AQSKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYDN 78
             ++ YD 
Sbjct: 61 PQLKSRYDQ 69

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY+ILGV  +AT  EIKK YR+ A++ HPDK  ++      + KF+ +  AYQ LSD
Sbjct: 4  DTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPN---AQAKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYDN 78
          ++ R  YD 
Sbjct: 61 DELRKRYDQ 69

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LG+  DA+  +IKK YRK A+  HPDK  D+ +    + KF+ I  AYQ LSD
Sbjct: 4  DTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEA---QAKFQAIGEAYQVLSD 60

Query: 70 EDKRNEYD 77
           D R+ YD
Sbjct: 61 PDLRSRYD 68

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YEIL +  DAT EEIKK YR   L  HPDK   +    +N +    I  AY+ LS+   
Sbjct: 9  HYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKT 68

Query: 73 RNEYDNKKNFEPYFESDFANNHDG 96
          R EYD K   E Y    F N  DG
Sbjct: 69 RGEYD-KLILENYKHQGFHNCGDG 91

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK Y+K AL+YHPDK   + +      KFK+I+ AY+ LSD  KR
Sbjct: 8  YDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSSKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K E D          L F + E   S+   +R G++LI    +
Sbjct: 222 IDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQE--KSHPLYKRDGDNLIYSLPL 279

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L +S  K + ++P ++     +G P+ K     G+L V
Sbjct: 280 SFKESLLGFSK--TIQTIDGRTLPIS--KIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVV 335

Query: 342 ILEIEFP 348
             +I++P
Sbjct: 336 KYKIDYP 342

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEI--KFKDITAAYQTL 67
           DRDYY+ILG+ + AT ++I++ Y     +YHPDK     +K  ++I  K   I  AY+TL
Sbjct: 492 DRDYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETL 551

Query: 68  SDEDKRNEYDNKKN 81
           SD+ +R EYD  ++
Sbjct: 552 SDDTRRKEYDQARS 565

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY+ILGV  +AT  EIKK YR+ A++ HPDK  D+ +    + KF+ +  AYQ LSD
Sbjct: 4  DTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPE---AQSKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
             R+ YD
Sbjct: 61 PGLRSRYD 68

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A+  E+KK YRK AL+YHPDK   + +      KFK+I+ A++ LSD +KR
Sbjct: 8  YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPNKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDT 66

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 6/145 (4%)

Query: 204 KNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIID 263
           K+F     G+  I     I + +  G   G  I  K E D          + F I E   
Sbjct: 196 KSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQE--K 253

Query: 264 SNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVK 323
            +   +R GN LI    ++  E++ GF+    V+T D R +  S  K + ++P + +   
Sbjct: 254 PHEFFKRDGNDLIYTLPLTFKESLLGFDK--TVRTIDGRQI--SIHKTQPVQPSEEMRYP 309

Query: 324 NEGWPMDKYGASFGNLYVILEIEFP 348
            +G P+ K  +  G+L V  + ++P
Sbjct: 310 GQGMPLSKNPSERGDLIVKYKTDYP 334

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTL 67
           ++DYY+ILGV +++  +EI+K+Y  L  +YHPDK   + E ++  N  K + I  AY+ L
Sbjct: 602 NKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECL 661

Query: 68  SDEDKRNEYD 77
           SDE KR EYD
Sbjct: 662 SDESKRKEYD 671

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV  +AT  E+KK YR+ ALQ+HPDK+ D  ++      F  + AAY+ L+D  +
Sbjct: 5  YYELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETT--AIFASVRAAYEVLADPQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDDHK 70

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   AT  E+KK YRK ALQ+HPDK+ D  ++   EI F  I +AY+ LSD  +
Sbjct: 5  YYELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEE-ATEI-FATIRSAYEVLSDPQE 62

Query: 73 RNEYDNKKN 81
          R  YD  KN
Sbjct: 63 RAWYDAHKN 71

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKS----IDEGQKLINEIKFKDITAAYQTLS 68
          +YE+LGV  DA+ +EIK TYRK+ L  HPDKS    ID   K+ + +    I  AY+ LS
Sbjct: 11 HYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLS 70

Query: 69 DEDKRNEYDNKKN 81
          ++  R  Y+   N
Sbjct: 71 NDQLRAAYNRALN 83

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY+ILG+   AT  EIKK YRK +++ HPDK+ ++        +F+ I+ AYQ LSD
Sbjct: 4  DTTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTAT---ERFQQISEAYQVLSD 60

Query: 70 EDKRNEYDN 78
          E  RN YD 
Sbjct: 61 EHLRNNYDQ 69

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY+ LG++  AT  EIKK YR+ A++ HPDK  D+ +    E KF+ +  AYQ LSD
Sbjct: 4  DTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEA---ENKFQAVGEAYQVLSD 60

Query: 70 EDKRNEYD 77
          E  R  YD
Sbjct: 61 ESLRARYD 68

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
          +D   Y++LGV+  A   E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+
Sbjct: 3  KDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAE------KFKEISEAFEILN 56

Query: 69 DEDKRNEYDN 78
          D  KR  YD 
Sbjct: 57 DPQKREVYDT 66

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 224 VSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISL 283
           + +  G   G  I  K E D          L F + E   SN    R GN LI    ++ 
Sbjct: 220 IQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPHSN--YTRDGNDLIYSLPLTF 277

Query: 284 AEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVIL 343
            E++ GF     ++T D R L +S  + + ++P D      +G P+ K  +  GNL V  
Sbjct: 278 KESLLGFSK--TIQTIDGRTLPIS--RVQPVQPSDSSTYPGQGMPIAKTPSQRGNLIVKY 333

Query: 344 EIEFP 348
           +I++P
Sbjct: 334 KIDYP 338

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          +YY+ILG+  DAT  EIKK YR+ A++ HPDK  D+      + KF+ +  AYQ LSD  
Sbjct: 6  EYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 72 KRNEYD 77
           R++YD
Sbjct: 63 LRSKYD 68

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D ++Y++LG++ +AT  EIKK YRK+A+  HPDK  D+ +    + KF+ +  AYQ L+D
Sbjct: 4  DTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPE---AQAKFQAVGEAYQVLND 60

Query: 70 EDKRNEYD 77
             R +YD
Sbjct: 61 PALRKQYD 68

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 8   SEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS--IDEGQKLINEIKFKDITAAYQ 65
           S  ++YY+ILG+  DA  ++I++ Y  L  +YHPDK   + + ++   E K   I  AY+
Sbjct: 505 STKKNYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYE 564

Query: 66  TLSDEDKRNEYD 77
            LSDE KR EYD
Sbjct: 565 VLSDESKRKEYD 576

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 6/64 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++L V+  A  +EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD +KR
Sbjct: 8  YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEKR 61

Query: 74 NEYD 77
            YD
Sbjct: 62 EVYD 65

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          +YY+ILG+  +AT  EIKK YR+ A++ HPDK  D+      + KF+ +  AYQ LSD+ 
Sbjct: 6  EYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDQG 62

Query: 72 KRNEYD 77
           R++YD
Sbjct: 63 LRSKYD 68

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 8/71 (11%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLSD 69
          YYE+LGV   AT  E+KK YRK ALQ+HPDK   ++DE  ++     F  I +AY+ LSD
Sbjct: 5  YYELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATEI-----FATIRSAYEVLSD 59

Query: 70 EDKRNEYDNKK 80
            +R  YD  K
Sbjct: 60 PQERAWYDAHK 70

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+L V+E A+  E+KK YRK ALQYHPDK+ +  ++      F +I AAY+ LSD  +
Sbjct: 5  YYELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEAT--AIFSEIRAAYEVLSDPQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K + D          L F I E   S+ + +R G+ LI    +
Sbjct: 217 IDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQE--KSHPNFKRDGDDLIYTLPL 274

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L LS  + + ++P        +G P  K  +  GNL V
Sbjct: 275 SFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 330

Query: 342 ILEIEFP 348
             ++++P
Sbjct: 331 KYKVDYP 337

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K + D          L F I E   S+ + +R G+ LI    +
Sbjct: 231 IDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQE--KSHPNFKRDGDDLIYTLPL 288

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L LS  + + ++P        +G P  K  +  GNL V
Sbjct: 289 SFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 344

Query: 342 ILEIEFP 348
             ++++P
Sbjct: 345 KYKVDYP 351

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 8/71 (11%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLSD 69
          YYE+LGV   A+  E+KK YRK ALQ+HPDK   ++DE  +      F  I AAY+ LSD
Sbjct: 5  YYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATE-----NFATIRAAYEVLSD 59

Query: 70 EDKRNEYDNKK 80
            +R  YD  K
Sbjct: 60 PQERAWYDAHK 70

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 2/77 (2%)

Query: 6   GSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAA 63
           G   ++D+Y++L +   AT +EI+K Y  L  +YHPDK   +   Q+  N  K   I  A
Sbjct: 554 GEFGNKDFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEA 613

Query: 64  YQTLSDEDKRNEYDNKK 80
           Y+ LSDE+KR +YDN +
Sbjct: 614 YEILSDENKRRDYDNSR 630

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + + +G   G  I  K E D          L F + E   ++   +R G++LI    +
Sbjct: 234 IDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVLQE--KAHPLFKRDGDNLIYTLPL 291

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L +S  + + I+P +      +G P+ K     G+L V
Sbjct: 292 SFKESLLGFSK--TIQTIDGRTLPIS--RVQPIQPSESSRYPGQGMPITKKPGQRGDLIV 347

Query: 342 ILEIEFP 348
             +I++P
Sbjct: 348 KYKIDYP 354

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +  ++YEIL V + AT  EIKK YRKLA++ HPDK+        +E  FK I  A++ 
Sbjct: 16 SKDKHEFYEILRVDKKATDGEIKKAYRKLAIKLHPDKN---SHPRASE-AFKVINRAFEV 71

Query: 67 LSDEDKRNEYD 77
          LS+E+KR+ YD
Sbjct: 72 LSNEEKRSIYD 82

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 222 IVVSIPRGSSNGDNIILKGEAD--EELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHT 279
           I + +  G   G  I  K + D   + G++    L F I E    + + +R G+ LI   
Sbjct: 233 IDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQE--KGHPNFKRDGDDLIYTL 288

Query: 280 HISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNL 339
            +S  E++ GF     ++T D R L LS  + + ++P        +G P  K  +  GNL
Sbjct: 289 PLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNL 344

Query: 340 YVILEIEFP 348
            V  ++++P
Sbjct: 345 IVKYKVDYP 353

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D+ KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  +  K   D          L F I E   ++   +R G+ L     +
Sbjct: 228 IDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQE--KTHPLYKRNGDDLEYTLPL 285

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           +  E++ GF     ++T D R L LS  +   ++P +      +G PM K  +  G+L V
Sbjct: 286 TFKESLLGFSK--TIQTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMPKMPSQRGDLVV 341

Query: 342 ILEIEFP 348
             +I++P
Sbjct: 342 RFKIDYP 348

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +  ++YEIL V   AT  EIKK YRKLA++ HPDK+         E  FK I  A++ 
Sbjct: 16 SKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKN---SHPKAGE-AFKVINRAFEV 71

Query: 67 LSDEDKRNEYD 77
          LS+E+KR+ YD
Sbjct: 72 LSNEEKRSIYD 82

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 10  DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTL 67
           D+DYY+ILGVA+++  + I+K Y  L  +YHPDK   + + ++  N  K  +I  AY+ L
Sbjct: 552 DKDYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEIL 611

Query: 68  SDEDKRNEYDN 78
            DE K+ EYD+
Sbjct: 612 GDESKKKEYDD 622

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K + D          L F I E   S+ + +R G+ LI    +
Sbjct: 224 IDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQE--KSHPNFKRDGDDLIYTLPL 281

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L LS  + + ++P        +G P  K  +  GNL V
Sbjct: 282 SFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 337

Query: 342 ILEIEFP 348
             ++++P
Sbjct: 338 KYKVDYP 344

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 9  EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
          +D   Y++LGV+  A   E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+
Sbjct: 3  KDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 69 DEDKRNEYDN 78
          D  KR  YD+
Sbjct: 57 DPQKREIYDS 66

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K E D          + F I E +  +   +R GN+LI    +
Sbjct: 213 IDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEKLHPH--FKRDGNNLIYTLPL 270

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     ++T D R L +S  + + I+P +      +G P+ K  A  G+L +
Sbjct: 271 SFKESLLGFSK--TIQTIDGRTLPIS--RVQPIQPSETSTYPGQGMPLPKTPAQRGDLII 326

Query: 342 ILEIEFP 348
             ++++P
Sbjct: 327 KYKVDYP 333

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 8/71 (11%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKS---IDEGQKLINEIKFKDITAAYQTLSD 69
          YYE+LGV   A+  E+KK YRK ALQYHPDK+   ++E  ++     F  I  AY+ LSD
Sbjct: 5  YYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEI-----FATIRTAYEVLSD 59

Query: 70 EDKRNEYDNKK 80
            +R  YD+ K
Sbjct: 60 PQERAWYDSHK 70

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          +YY+ILG+  +AT  EIKK YR+ A++ HPDK  D+      + KF+ +  AYQ LSD  
Sbjct: 6  EYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 72 KRNEYD 77
           R++YD
Sbjct: 63 LRSKYD 68

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LG+   AT  EIKK YRK +++ HPDK+ ++ Q      +F+ I+ AYQ LSD
Sbjct: 4  DTAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQA---TERFQAISEAYQVLSD 60

Query: 70 EDKRNEYD 77
          E  R +YD
Sbjct: 61 ESLRLKYD 68

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (54%), Gaps = 20/84 (23%)

Query: 6   GSSED--RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK----------SIDEGQKLIN 53
           GSS D  +DYY+ LGV   AT +EI+K Y  L  +YHPDK          SI E    IN
Sbjct: 530 GSSYDPKKDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQIN 589

Query: 54  EIKFKDITAAYQTLSDEDKRNEYD 77
           E        AY+ LSD++KR EYD
Sbjct: 590 E--------AYEALSDDNKRKEYD 605

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           D +++  D YEILG++  A+  +IK  YRKL++++HPD   K +   +K + E  +  IT
Sbjct: 118 DAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQIT 177

Query: 62  AAYQTLSDEDKRNEY 76
            AY++L+DE  R  Y
Sbjct: 178 KAYESLTDELVRQNY 192

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          +YY++LG+   AT  EIKK YR+ A++ HPDK  D+        +F+ +  AYQ LSD D
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDP---TASERFQQVGEAYQVLSDPD 62

Query: 72 KRNEYD 77
           R +YD
Sbjct: 63 LRKQYD 68

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV+  A   E+KK +R+ ALQYHPDK+ D  ++      F  I AAY+ L+D  +
Sbjct: 5  YYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATE--TFAQIRAAYEVLNDPQE 62

Query: 73 RNEYDNKKN 81
          R  YD+ K+
Sbjct: 63 RAWYDSHKS 71

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 109/281 (38%), Gaps = 70/281 (24%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           E +D Y+ LGV + A+  EIKK Y KLA +YHPD + ++G       KF D+  AY+ LS
Sbjct: 30  EFKDPYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAG----DKFHDLQNAYEILS 85

Query: 69  DEDKRNEYDNKKNFEPYFE----------------SDFANNHDGNYNS------------ 100
           D DK+++YD                          SDF+    GN+              
Sbjct: 86  DADKKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGF--GNFGGINFEDLFGAAFG 143

Query: 101 ------------------RYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGL 142
                              YR    ++   +  K + ++  K +         C TC+G 
Sbjct: 144 GGGGRSSRGSPFGSSMFREYRGDPIEVSYRMPFKDA-VFGAKDVNLKFRALDPCHTCDGS 202

Query: 143 GWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNS 202
           G +T    KP       C  C+G G     V +  GF       C  C G G   K+   
Sbjct: 203 GMKT--GAKPQ-----SCPSCHGTG---TTVHVRAGFQMA--TTCQQCGGEGTTTKR--- 247

Query: 203 PKNFCKDCNGKCL-IKIDDPIVVSIPRGSSNGDNIILKGEA 242
            ++ C  C+G  +    D  + V +P+G  +GD + + G+ 
Sbjct: 248 -EDLCGSCHGDGVEWTKDKSVRVDLPQGLQDGDVVRVPGQG 287

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 4/87 (4%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  ++KK YR+ ALQYHPDK+ D  ++      F  I +AY+ L+D  +
Sbjct: 5  YYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEAT--TVFATIRSAYEVLADPQE 62

Query: 73 RNEYDNKKNFEPYFESDFANNHDGNYN 99
          R  YD+ K  +     DF   +  +Y+
Sbjct: 63 RAWYDSHK--QQILSDDFGAENGDDYD 87

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  AT  EIKK YRK ++Q HPDK+ ++ +      +F+ I+ AYQ L D
Sbjct: 4  DSEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKAT---ERFQAISEAYQVLGD 60

Query: 70 EDKRNEYD 77
          ++ R +YD
Sbjct: 61 DELRAKYD 68

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS---IDEGQKLINEIKFKDITAAYQTL 67
           +DYY++LG+++ A+ +EI+K Y  L  +YHPDK     ++ Q+ I+E K   +  AY+ L
Sbjct: 521 KDYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHE-KMSQVNEAYEIL 579

Query: 68  SDEDKRNEYDNKK 80
           SDE K+ +YDN +
Sbjct: 580 SDEGKKRDYDNSR 592

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D + R
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNTR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EVYDQ 66

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  +  K + D          L F I E   ++ D +R G+ LI    +
Sbjct: 192 IDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQE--KAHPDFKRDGDDLIYILRL 249

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           S  E++ GF     + T D R L LS  + + I+P +I     +G P+ K  +  GNL +
Sbjct: 250 SFKESLLGFSK--TINTIDGRKLPLS--RSQPIQPTEISTYPGQGMPVSKNPSQRGNLII 305

Query: 342 ILEIEFP 348
             +I++P
Sbjct: 306 KYKIDYP 312

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          +YY+ILG+  +AT  EIKK YR+ A++ HPDK  D+      + KF+ +  AYQ LSD  
Sbjct: 6  EYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 72 KRNEYDN 78
           R++YD 
Sbjct: 63 LRSKYDQ 69

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-DEGQKLINEIKFKDITAAYQTLS 68
          D +YYE+LG+   AT  EIKK YRK +++ HPDK+  D G       +F+ I+ AYQ LS
Sbjct: 4  DTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE----RFQAISEAYQVLS 59

Query: 69 DEDKRNEYD 77
          D D R  YD
Sbjct: 60 DSDLRANYD 68

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           D +++  D YEILG++  A+  +IK  YRKL++++HPD   K +   +K + E  +  IT
Sbjct: 118 DAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQIT 177

Query: 62  AAYQTLSDEDKRNEY 76
            AY++L+DE  R  Y
Sbjct: 178 KAYESLTDELVRQNY 192

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 111/294 (37%), Gaps = 84/294 (28%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD--KSIDEGQKLINEIKFKDITAAYQT 66
           E +D Y +LGV   A+  EIKK Y KLA +YHPD  K  D       E KF D+  AY+ 
Sbjct: 76  EIKDPYSVLGVNNSASTSEIKKAYYKLAKKYHPDINKQPDA------EKKFHDLQNAYEI 129

Query: 67  LSDEDKRNEYDN--------------------------------------------KKNF 82
           LSDE+KR +YD                                               NF
Sbjct: 130 LSDENKRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINF 189

Query: 83  EPYFESDFANNHDGNYNSRYRSRSK----------DIKVELSLKTSEL-YNGKTIKFNNS 131
           E  F + F N        R R +S           +I   L+ K +        +KFN+ 
Sbjct: 190 EDLFGAAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFNSM 249

Query: 132 RNRICKTCNGLGW-RTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYC 190
               C  C+G G  R  K           C  C+G G    KV +  GF       C++C
Sbjct: 250 DP--CNKCSGSGLNRNAK--------RTTCPSCHGSG---QKVHIRSGFQMVST--CNHC 294

Query: 191 KGNGKYYKKPNSPKNFCKDCNGKCL-IKIDDPIVVSIPRGSSNGDNIILKGEAD 243
            G G         K+ C  C+G  + +  +  I V++P G  +GD I + G+ +
Sbjct: 295 HGEGTIIDS----KDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGN 344

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 5/71 (7%)

Query: 8  SEDRD-YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S+DR  +YE+L +   A+  EIKK+YRKLA++ HPDK+        +E  FK I  A++ 
Sbjct: 19 SKDRQAFYEVLQIERSASDNEIKKSYRKLAIKLHPDKNP---HPRASEA-FKVINRAFEV 74

Query: 67 LSDEDKRNEYD 77
          LSDE+KR  YD
Sbjct: 75 LSDEEKRRLYD 85

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YY++L V  DA+  ++KK YR+ ALQYHPDK+ D  ++      F +I AAY+ LSD  +
Sbjct: 5  YYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEAT--TIFAEIRAAYEVLSDPQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  A+  EIKK YRK ++Q HPDK+ ++   L    +F+ I+ AYQ L D
Sbjct: 4  DTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPND---LKATERFQAISEAYQVLGD 60

Query: 70 EDKRNEYD 77
          ++ R +YD
Sbjct: 61 DELRAKYD 68

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2.15
           YNL227C
          Length = 598

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 96/217 (44%), Gaps = 47/217 (21%)

Query: 13  YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
           YYE+L V   A+  ++KK YR+ ALQYHPDK+I+  ++  +   F +I  AY+ LSD  +
Sbjct: 5   YYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATD--IFANIRTAYEILSDPQE 62

Query: 73  RNEYDNKKNF----EPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKF 128
           R  YD+ KN     EP  E       DG+Y    R      +  +    S LY     +F
Sbjct: 63  RVWYDSHKNQILNDEPIME-------DGSYEVDSRVTGVTTEELMMFFNSSLY----TRF 111

Query: 129 NNSRNRICKTCNGLGWRTKKD--------GKP----YVPPEIECQKCNGQGYKNM----- 171
           ++S   + +    +  R  KD        G P    YV    E +  N  GYK+      
Sbjct: 112 DDSPAGVFQIAGKIFSRLAKDEIVNGRKLGLPKFDKYVDDHFE-EDINTLGYKSACDKYI 170

Query: 172 ----KVQLAP--GFYTTQNVLCSYCKGNGKYYKKPNS 202
                 QL P  G+ TT+     + K    +YKK NS
Sbjct: 171 KEENDTQLFPVFGYSTTE---YEHLKS---FYKKWNS 201

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  A+  EIKK YRK ++Q HPDK+ ++        +F+ I+ AYQ L D
Sbjct: 4  DTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTAT---ERFQAISEAYQVLGD 60

Query: 70 EDKRNEYD 77
          +D R +YD
Sbjct: 61 DDLRAKYD 68

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +  ++YE+L V   A+  EIKK YR+LA++ HPDK+   G     E  FK I  A++ 
Sbjct: 18 SRDKSEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKN---GHPRSAEA-FKVINRAFEV 73

Query: 67 LSDEDKRNEYDN 78
          L DEDKR  +D 
Sbjct: 74 LGDEDKRRLFDQ 85

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  E+KK YRK AL+YHPDK+ +  ++      F  I  AY+ LSD  +
Sbjct: 5  YYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQ--AFATIRLAYEVLSDPQE 62

Query: 73 RNEYDNKKN 81
          R  YD+ KN
Sbjct: 63 RAWYDSHKN 71

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +  ++YEIL V   AT  +IKK YRKLA++ HPDK+         E  FK I  A++ 
Sbjct: 16 SKDKHEFYEILKVDRKATDSDIKKAYRKLAIKLHPDKN---SHPKAGE-AFKVINRAFEV 71

Query: 67 LSDEDKRNEYD 77
          LS+E+KR+ YD
Sbjct: 72 LSNEEKRSIYD 82

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 45/75 (60%), Gaps = 12/75 (16%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS----IDEGQKLINEIKFKDITA 62
          S +  ++Y+IL V + AT  EIKK YRKLA++ HPDK+      E  K+IN         
Sbjct: 16 SKDKHEFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEAFKIINR-------- 67

Query: 63 AYQTLSDEDKRNEYD 77
          A++ LS+E+KR  YD
Sbjct: 68 AFEVLSNEEKRGLYD 82

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLSD 69
          YY++L V  DAT  ++K+ YRK AL YHPDK   +I+E  ++     F  I AAY+ LSD
Sbjct: 5  YYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEV-----FAQIRAAYEVLSD 59

Query: 70 EDKRNEYDNKKN 81
            +R  YD  K+
Sbjct: 60 AQERAWYDAHKD 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YYE+LG++  AT  EIKK YRK ++Q HPDK+ ++        +F+ I+ AYQ LSD
Sbjct: 4  DTAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDP---TATERFQAISEAYQVLSD 60

Query: 70 EDKRNEYD 77
          +  R +YD
Sbjct: 61 DTLRLKYD 68

>NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON}
           Anc_1.297
          Length = 623

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 8   SEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQ 65
           + D+DYY+I+G+++DA  ++I+KTY  L  ++HPDK   + E ++  N+ K   I  AY+
Sbjct: 552 ATDKDYYKIMGLSKDAAAKDIRKTYLSLTKKFHPDKQGQLSEKEQKKNQEKMSAINEAYE 611

Query: 66  TLSDEDK 72
            LSDE+K
Sbjct: 612 VLSDENK 618

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY+ LG++ DAT  EIKK YRK A+  HPDK  ++      + KF+ +  AYQ LSD
Sbjct: 4  DTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPD---AQAKFQAVGQAYQVLSD 60

Query: 70 EDKRNEYD 77
             R+ YD
Sbjct: 61 PGLRSRYD 68

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGVA DA   +IKK YRK +++ HPDK+ D+        +F+ I+ AYQ LS 
Sbjct: 4  DTTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDP---TATERFQAISEAYQVLSS 60

Query: 70 EDKRNEYD 77
          E+ R +YD
Sbjct: 61 EELRMKYD 68

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YYE+LGV   A+  ++KK YRK AL YHPDK+ D  ++      F  I AAY+ L+D  +
Sbjct: 5  YYELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEAT--AIFATIRAAYEVLADPQE 62

Query: 73 RNEYDNKK 80
          R  YD+ K
Sbjct: 63 RAWYDSHK 70

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 54/88 (61%), Gaps = 13/88 (14%)

Query: 7   SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKL------INEIKFKDI 60
           S   ++YY+ILG+  +A+ +EI+K Y  L  +YHPDK   +G++L       N+ K  +I
Sbjct: 536 SQTAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDK---QGKQLSEEEEKKNDEKMSEI 592

Query: 61  TAAYQTLSDEDKRNEYDN----KKNFEP 84
             AY+ L+DE+KR EYD+     + F+P
Sbjct: 593 NEAYEVLNDEEKRKEYDSIRSGSRQFQP 620

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 6/64 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++LGV+ +    E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D +KR
Sbjct: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61

Query: 74 NEYD 77
            YD
Sbjct: 62 EVYD 65

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 6/145 (4%)

Query: 204 KNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIID 263
           K+F     G   I     I + +  G   G  I  K E D          L F I E + 
Sbjct: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKM- 252

Query: 264 SNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVK 323
            ++ L+R GN L     +S  E++ GF     V T D R +++S  K + ++P +     
Sbjct: 253 -HDFLKRDGNDLTYTLPLSFKESLLGFSK--TVHTIDGRQIFIS--KTQPVQPSEESRYP 307

Query: 324 NEGWPMDKYGASFGNLYVILEIEFP 348
            +G P+ K  +  G+L V  +I++P
Sbjct: 308 GQGMPLSKNPSERGDLIVKYKIDYP 332

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK--SIDEGQKLINEIKFKDITAAYQTLS 68
           +DYY+ LGV+++A +++I++ Y +L  +YHPDK   + + ++L  + K   I  AY+TL 
Sbjct: 503 KDYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLR 562

Query: 69  DEDKRNEYD 77
           D+ KR EYD
Sbjct: 563 DDSKRKEYD 571

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           D  S   D Y+ILG++  A+  EIK  YRKL++++HPD   K + E ++   E  +  IT
Sbjct: 112 DSVSSLFDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQIT 171

Query: 62  AAYQTLSDEDKRNEY 76
            AY+ L+DE  R  +
Sbjct: 172 KAYEALTDELTRQNF 186

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YE+L V  DA+  EIK+ YR   L  HPDK+ DE +  +N +    I  AY+ LSDE  
Sbjct: 4  HYEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKL 62

Query: 73 RNEYDNK 79
          R EYD++
Sbjct: 63 RREYDHE 69

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LG+   AT  EIKK YRK ++Q HPDK+ ++        +F+ I+ AYQ LS 
Sbjct: 4  DSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDP---TATERFQAISEAYQVLSS 60

Query: 70 EDKRNEYD 77
          E+ R +YD
Sbjct: 61 EELRAKYD 68

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YEIL +  DAT +EIKK YR   L  HPDK        ++ +    I  AY+ LS+   
Sbjct: 9  HYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKT 68

Query: 73 RNEYDNKKNFEPYFESDFANNHDG 96
          R EYD +   E Y    F N  DG
Sbjct: 69 RREYD-RLILENYKRQGFHNCGDG 91

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           D + +  D YEILG++  A+  +IK  YRKL++++HPD   K +   +K + E  +  IT
Sbjct: 118 DAAIKLFDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQIT 177

Query: 62  AAYQTLSDEDKRNEY 76
            AY++L+DE  R  Y
Sbjct: 178 KAYESLTDELVRQNY 192

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +   +YE+L V + A+  EIKK YRKLA++ HPDK+    +       FK I  A++ 
Sbjct: 17 SKDKHAFYEVLRVEKQASDLEIKKAYRKLAIKLHPDKN----KHPRASEAFKRINRAFEV 72

Query: 67 LSDEDKR 73
          LSDE KR
Sbjct: 73 LSDEQKR 79

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YE+L +  +A+  EIKK YRKLA++ HPDK+    +       FK I  A++ LSDE K
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKN----KHPRASEAFKRINRAFEVLSDEQK 78

Query: 73 RNEYDN 78
          R  +D 
Sbjct: 79 RRIFDQ 84

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S E   +Y+IL V + A   EIKK+YRKLA++ HPDK+         E  FK I  A++ 
Sbjct: 19 SKEKHAFYDILNVQKSADSVEIKKSYRKLAIKLHPDKNP---HPKAGEA-FKVINRAFEV 74

Query: 67 LSDEDKRNEYD 77
          LSD++KR+ +D
Sbjct: 75 LSDDEKRSVFD 85

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73
          Y++L V   A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 8  YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 74 NEYDN 78
            YD 
Sbjct: 62 EIYDQ 66

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281
           I + +  G   G  I  K + D          L F I+E    +   +R  ++LI    +
Sbjct: 232 IDIQLKPGWKAGTKITYKSKGDYNPKTGGRKTLQFIISE--KPHPHFKREDDNLIYTLPL 289

Query: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYV 341
           +  E++ GF     ++T D ++L LS  +G+ ++P +      +G P+ K     G+L +
Sbjct: 290 TFKESLLGFSK--TIQTIDGKNLPLS--RGQPVQPSETTTYPGQGMPITKKPGQRGDLLI 345

Query: 342 ILEIEFP 348
             ++++P
Sbjct: 346 KYKVDYP 352

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV+ +A   EIKK YRK ++Q HPDK+ ++        +F+ I+ AYQ LS+
Sbjct: 4  DTTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSAT---ERFQSISQAYQVLSN 60

Query: 70 EDKRNEYD 77
          E+ R +YD
Sbjct: 61 EELRTKYD 68

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 8/71 (11%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLSD 69
          YYE+L V   A   E+KK YR+ ALQYHPDK   +++E  ++     F  I AAY+ LSD
Sbjct: 5  YYELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATEI-----FASIRAAYEVLSD 59

Query: 70 EDKRNEYDNKK 80
            +R  YD+ K
Sbjct: 60 PQERAWYDSHK 70

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV   AT  EIKK YRK ++  HPDK+ D+        +F+ I+ AYQ LS+
Sbjct: 4  DTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAAT---ERFQSISEAYQVLSN 60

Query: 70 EDKRNEYD 77
          +D R  YD
Sbjct: 61 KDLRANYD 68

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 11/93 (11%)

Query: 8   SEDRDYYEILGV----AEDATHEEIKKTYRKLALQYHPDKSIDEGQKL-INEIKFKDITA 62
           SE  D Y++LG+     ++ T EE+K+ Y+KL LQYHPDK++   +       +F  + +
Sbjct: 78  SEGVDLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRS 137

Query: 63  AYQTLSDEDKRNEYDNKKNFEPYFESDFANNHD 95
           A+Q L D   R +YD       +  +  A+N++
Sbjct: 138 AFQILCDSSLRTQYDQ------WLRASLADNNE 164

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV+ DA   EIKK YRK ++Q HPDK+ ++ +      +F+ I+ AYQ LS 
Sbjct: 4  DTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKAT---ERFQAISEAYQVLSS 60

Query: 70 EDKRNEYD 77
          ++ R +YD
Sbjct: 61 DELRAKYD 68

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YEILGV+  A+  +IK  YRKL++++HPD   K +   +K + E  +  IT AY++L+
Sbjct: 125 DPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLT 184

Query: 69  DEDKRNEY 76
           DE  R  Y
Sbjct: 185 DELVRQNY 192

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLS 68
           D YEILGV   +T +EIKK YR L+L++HPDK   ++ E ++L  E  F  I+ AY+ L+
Sbjct: 121 DPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALT 180

Query: 69  DEDKRNEY 76
           +   +  Y
Sbjct: 181 NPATKENY 188

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YE+LG++  A+ ++IK  YRKL+L++HPD   K + E  +   E ++  IT AY++L+
Sbjct: 121 DPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLT 180

Query: 69  DEDKRNEY 76
           DE  R  Y
Sbjct: 181 DELIRFNY 188

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV+ DA   +IKK YRK ++Q HPDK+ ++        +F+ I+ AYQ LS 
Sbjct: 4  DTTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDP---TATERFQAISQAYQVLSK 60

Query: 70 EDKRNEYD 77
          +D R +YD
Sbjct: 61 DDLRAKYD 68

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 5/75 (6%)

Query: 5  DGSSEDRD-YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAA 63
          DG + D+  YY +LG+  DAT  +I+K+Y KLA + HPDKS  E   +  E+ FK +  A
Sbjct: 4  DGVTLDQTTYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSE---VAAEL-FKVVAHA 59

Query: 64 YQTLSDEDKRNEYDN 78
          +  L+D +KR +YD 
Sbjct: 60 HSILTDREKRLKYDR 74

>KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 433

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (58%), Gaps = 9/92 (9%)

Query: 12  DYYEILGVAE---DATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           D Y  +G+++    AT+++I K +RK  L+YHPDK+   G  L  +  FK I  AY+TL+
Sbjct: 97  DLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGASLDQDGFFKIIQKAYETLT 156

Query: 69  DEDKRNEYDNKKNFEPYFESDFANNHDG-NYN 99
           D +KR +YD+       FE+D A    G NY+
Sbjct: 157 DSNKRPQYDSCD-----FEADVAPPKKGTNYD 183

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           + +S   D YE+LG++  A+  +IK  YRKL++++HPD   K + E ++   E  +  IT
Sbjct: 122 EAASGMFDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQIT 181

Query: 62  AAYQTLSDEDKRNEY 76
            AY+ L+DE  R  +
Sbjct: 182 KAYEALTDEAMRENF 196

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 1  MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60
          MS  D + +   YY ILGV  +A+  EI+K+Y KLA + HPDK+  E    +    FK +
Sbjct: 1  MSINDVTIDTSTYYSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAEL----FKLV 56

Query: 61 TAAYQTLSDEDKRNEYDNKKNFEPYFE 87
            A+  L+++  R EYD K   E  FE
Sbjct: 57 VDAHSILNNDQLRAEYDKKLILEGRFE 83

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +  ++YE+L V + A+  +IKK YRKLA++ HPDK+    +       FK I  A++ 
Sbjct: 17 SKDKHEFYEMLKVGKSASESDIKKAYRKLAIKLHPDKN----RHPRASEAFKKINRAFEV 72

Query: 67 LSDEDKRNEYDN 78
          LSD+ KR  +D 
Sbjct: 73 LSDDSKRRIFDQ 84

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D +YY++LGV+  A+  EIKK YRK ++Q HPDK+ ++ +      +F+ I+ AYQ L D
Sbjct: 4  DTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKAT---ERFQAISEAYQVLGD 60

Query: 70 EDKRNEYD 77
           + R +YD
Sbjct: 61 NELRVKYD 68

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71
          ++YE+L V + A+  EIKK YRKLA++ HPDK+        +E  FK I  A++ LSD  
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNT---HPRASEA-FKRINRAFEVLSDVG 79

Query: 72 KRNEYD 77
          KR  +D
Sbjct: 80 KRRMFD 85

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YE+L + ++A+  ++KK YRKLA++ HPDK+    +       FK I  A++ LSDE+K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKN----RHPRAAEAFKKINRAFEVLSDENK 80

Query: 73 RNEYDN 78
          R  YD 
Sbjct: 81 RKVYDQ 86

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          + +YY++LG++  AT  EIKK YRK +++ HPDK+ ++        +F+ I+ AYQ LSD
Sbjct: 4  ETEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSAT---ERFQAISEAYQVLSD 60

Query: 70 EDKRNEYD 77
          +  R+ YD
Sbjct: 61 KQLRSNYD 68

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YE+LG+   AT  E++ +YRKL++++HPD   K + + ++L  E ++  IT AY+ L+
Sbjct: 115 DPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALT 174

Query: 69  DEDKRNEY 76
           +E  R  Y
Sbjct: 175 EEVTRENY 182

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 5/70 (7%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-DEGQKLINEIKFKDITAAYQTLS 68
          D  YY++LG+  +AT  EIKK YRK ++Q HPDK+  D G       +F+ I+ AYQ LS
Sbjct: 4  DTAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE----RFQAISEAYQVLS 59

Query: 69 DEDKRNEYDN 78
          +++ R +YD 
Sbjct: 60 NDELRAKYDR 69

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +   +YEIL V   +T  EIKK YRKLA++ HPDK+            FK I  A++ 
Sbjct: 16 SKDKHAFYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE----AFKIINRAFEV 71

Query: 67 LSDEDKRNEYD 77
          LSD +KR  +D
Sbjct: 72 LSDNEKRRIFD 82

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS------IDEGQKLINEIKFKDI 60
          SS    +YE+L +  DAT +EIKK Y++  L  HPDKS      I      +  +    I
Sbjct: 4  SSSRITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQI 63

Query: 61 TAAYQTLSDEDKRNEYDNKKNFEPYFESDFANNHDG 96
            AY+ LS+E  R +YD ++  E + +  + N+ DG
Sbjct: 64 QQAYKILSNESTREQYD-EELLETFKKLGYHNHGDG 98

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          +YE+L V E A+  +IKK YRK+A++ HPDK+    +       FK +  A++ LSDE K
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKN----RHPRAAEAFKKVNRAFEVLSDEKK 80

Query: 73 RNEYDN 78
          R  YD 
Sbjct: 81 RRVYDQ 86

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 12/75 (16%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS----IDEGQKLINEIKFKDITA 62
          S +   +YEIL V   A   EIKK+YRKLA++ HPDK+      E  KLIN         
Sbjct: 17 SKDKHQFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEAFKLINR-------- 68

Query: 63 AYQTLSDEDKRNEYD 77
          A++ L D +KR+ YD
Sbjct: 69 AFEVLGDSEKRSLYD 83

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 12/75 (16%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKS----IDEGQKLINEIKFKDITA 62
          S +   +YEIL V + A   EIKK YRKLA++ HPDK+      E  K+IN         
Sbjct: 17 SKDKHAFYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEAFKIINR-------- 68

Query: 63 AYQTLSDEDKRNEYD 77
          A++ LSD +KR  YD
Sbjct: 69 AFEVLSDVEKRQLYD 83

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV+ DA   +IKK YRK ++Q HPDK+ ++ +      +F+ I+ AYQ L  
Sbjct: 4  DTTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKAT---ERFQAISEAYQVLGS 60

Query: 70 EDKRNEYD 77
          ++ R +YD
Sbjct: 61 DELRAKYD 68

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFK------DITAAYQ 65
           D YEILGV+  A   EIK  YRKL++++HPDK    G  L  E + K       IT AY+
Sbjct: 122 DPYEILGVSASAADREIKSAYRKLSVKFHPDKL---GHDLAPEARTKMEEMYVQITKAYE 178

Query: 66  TLSDEDKRNEY 76
           +L+DE+ +  Y
Sbjct: 179 SLTDENVKENY 189

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
           Anc_2.350 YMR161W
          Length = 175

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 10/112 (8%)

Query: 7   SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
           S E+  YY+++GV    +  ++K +Y++L  + HPDK+   G K      F  +  AY+T
Sbjct: 18  SKENGTYYDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKE----AFALVHKAYKT 73

Query: 67  LSDEDKRNEYDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTS 118
           LS++ KR  YD       Y    F+   DG+ +  + SR     V  SL TS
Sbjct: 74  LSNKQKRAMYDK------YGNDAFSRKTDGSADKPFNSRDPHGAVIDSLITS 119

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S E  D+Y +L V   +   EIKK+YRKLA++ HPDK+            FK I  A++ 
Sbjct: 17 SKERHDFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE----AFKVINRAFEV 72

Query: 67 LSDEDKRNEYD 77
          LSD +KR  +D
Sbjct: 73 LSDNEKREIFD 83

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 4/86 (4%)

Query: 11 RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70
          R +YEILGV  D    +IKK Y+   L  HPDK    G+ + N++  ++I  AY+ L + 
Sbjct: 5  RSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKV---GKDVGNKVLIEEIKEAYRVLIES 61

Query: 71 DKRNEYDNKKNFEPYFESDFANNHDG 96
            R +YD K+  E Y +  F N  +G
Sbjct: 62 PSREKYD-KELAESYKKQGFHNAGEG 86

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 7/68 (10%)

Query: 12 DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSID--EGQKLINEIKFKDITAAYQTLSD 69
          +YY++LGV  ++T  EIKK YRK +++ HPDK+ +  +  K     KF+ I+ AYQ LSD
Sbjct: 6  EYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATK-----KFQAISEAYQVLSD 60

Query: 70 EDKRNEYD 77
          ++ R+ YD
Sbjct: 61 KNLRSNYD 68

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 94/391 (24%), Positives = 149/391 (38%), Gaps = 95/391 (24%)

Query: 9   EDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD--KSIDEGQKLINEIKFKDITAAYQT 66
           E +D Y  LGV+  AT  EIKK Y KLA +YHPD  K+ D       + KF D+  AY+ 
Sbjct: 36  ELKDPYSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAADA------QKKFHDLQNAYEI 89

Query: 67  LSDEDKRNEYDN------------------------------------------KKNFEP 84
           LSD+ KR ++D                                             NFE 
Sbjct: 90  LSDDCKRQQWDQYGPAAFSQGDAGPSGAGGGAEGFGGFGGFGGGGFGGAGGGFGGINFED 149

Query: 85  YFESDFANNHDGNYNSRYRSRSKDIK------VELSLKTS---ELYNGKTIKFNNSRNRI 135
            F + F     G   +  RSR    +      +E+S + S    ++  K +    S    
Sbjct: 150 LFGAAFGGGAGGAGGAGGRSRGSMYREYQGSPIEISHRISFKDSVFGTKNVNLKYSAYDP 209

Query: 136 CKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGK 195
           C TC+G G +              C  C+G G    +V +  GF       C+ C G G 
Sbjct: 210 CNTCDGSGLKPGAS-------RSTCPGCSGTG---TRVHVRAGFQMAST--CNQCGGEGS 257

Query: 196 YYKKPNSPKNFCKDCNGKCLIKID--DPIVVSIPRGSSNGDNIILKGE----------AD 243
             +  ++    C+ C+G+   K+D    + V +P G  +GD I + G+          A 
Sbjct: 258 VLRDADT----CQTCHGEG-AKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAM 312

Query: 244 EELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTH-ISLAEAITGFENKFIVKTFDDR 302
           ++  + + GDL+  I   +D +   +    + I  T  I +  A  G      + T D  
Sbjct: 313 KDTVRLSRGDLLLRIR--VDKDPRFQIKNKYDIWFTQDIPITTAALG--GVVTIPTVDGE 368

Query: 303 DLYLSTPKGKVIRPGDILEVKNEGWPMDKYG 333
            + L    G   +  D++ +  +G P   +G
Sbjct: 369 QVRLKVSPG--TQHHDVVSIPQKGVPRGSFG 397

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 6/66 (9%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTLSDED 71
          +Y +LGV  DAT+EEI K+YRKLA++ HPDKS  D+ ++L     FK +  A+  L++ +
Sbjct: 10 HYSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEEL-----FKLVVHAHSVLTNGE 64

Query: 72 KRNEYD 77
          +R +Y+
Sbjct: 65 ERAKYN 70

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  YY++LGV   A   +IKK YRK ++Q HPDK+ ++        +F+ I+ AYQ LS 
Sbjct: 5  DTTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDP---TATERFQAISQAYQVLSK 61

Query: 70 EDKRNEYD 77
          ED R +YD
Sbjct: 62 EDLRAKYD 69

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YE+LGV   +T +EIK  YRKL++++HPD   K ++E ++   E +F  I  AY+ L+
Sbjct: 111 DPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALT 170

Query: 69  DEDKRNEY 76
           DE  +  Y
Sbjct: 171 DEITKENY 178

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 10 DRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSD 69
          D  +Y+ILG+A DA   E+++ YR+  L+ HPDK     Q  +++     I  AY+ LSD
Sbjct: 2  DGSHYDILGIAVDAEPLEVRQAYRQRLLEAHPDK-----QGGVDKGAVTRIQQAYRVLSD 56

Query: 70 EDKRNEYDNK 79
            +R+ YD +
Sbjct: 57 PTQRSAYDGE 66

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YY ILG+   AT  EI+K+Y KLA Q HPDKS  +    +    FK +  A+  L+DE+ 
Sbjct: 8  YYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAEL----FKLVVHAHSILTDEET 63

Query: 73 RNEYDNK 79
          + +YD +
Sbjct: 64 KRKYDTQ 70

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 4/65 (6%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YY  LG++ +A+ +EI K+Y KLA + HPDKS  +G   +    FK I+ A+  L D++K
Sbjct: 14 YYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAEL----FKLISHAHSVLMDKEK 69

Query: 73 RNEYD 77
          ++ YD
Sbjct: 70 KDAYD 74

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDK 72
          YY  LG++ +A   EI K+Y  LA Q HPDKS  E     +  +FK I+ A+  L DE K
Sbjct: 14 YYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEA----SAEQFKLISHAHSVLMDEAK 69

Query: 73 RNEYD 77
          R +YD
Sbjct: 70 RLKYD 74

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 6/66 (9%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTLSDED 71
          YY ILG+  +AT  E+ K+Y KLA   HPDK+  D+ ++L     FK +  A+  L+DED
Sbjct: 14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEEL-----FKAVVHAHSILTDED 68

Query: 72 KRNEYD 77
          ++  YD
Sbjct: 69 QKLRYD 74

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (58%), Gaps = 13/99 (13%)

Query: 2  SDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSID---EGQKLINEIKFK 58
          SDT+    D D YE+LGV +  T +E+KK YRKL L+ HPDK+ D   E ++  ++I+F 
Sbjct: 4  SDTNIPFPDIDPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTPEAKEKFHKIQF- 62

Query: 59 DITAAYQTLSDEDKRNE-YDNKKNFEPYFE-SDFANNHD 95
              A++ L   DK  E YD   + E  F+ SDFA+  D
Sbjct: 63 ----AFEVL---DKFKETYDKTGSVEACFKGSDFADWKD 94

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D Y +LGVA  AT +E++  YRKL++++HPD   K + + Q+   E ++  IT AY+ L+
Sbjct: 116 DPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALT 175

Query: 69  DEDKRNEY 76
           DE  +  Y
Sbjct: 176 DEITKENY 183

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 12  DYYEILGVAE---DATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           D Y  +G+++    AT  +I K +RK  L+YHPDK    G  L  +  FK I  A++TL+
Sbjct: 97  DLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGASLDQDGFFKIIQKAFETLT 156

Query: 69  DEDKRNEYDN 78
           D  KR++YD+
Sbjct: 157 DPTKRSQYDS 166

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 47/92 (51%), Gaps = 20/92 (21%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDK---SIDEGQKLINEIKFKDITAAYQTLSD 69
          YYE+LGV  DAT  EIKK YRK AL   P+K   +I   +      KF+ I  AYQ L  
Sbjct: 7  YYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE------KFQAIAEAYQVLHS 60

Query: 70 EDKRNEYDN--------KKNFE---PYFESDF 90
          ++ R +YD         KK FE    YF + F
Sbjct: 61 KELREKYDKLGKEAAIPKKGFEDASEYFPTIF 92

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKS---IDEGQKLINEIKFKDITAAYQTLS 68
           D Y++LGV+  A+ +EIK  YRKL+L++HPDK    I E +K   E  +  I+ AY+ L+
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALT 179

Query: 69  DEDKRNEY 76
           DE  +  Y
Sbjct: 180 DELVKQNY 187

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 13 YYEILGVAEDATHEEIKKTYRKLALQYHPDKS-IDEGQKLINEIKFKDITAAYQTLSDED 71
          YY ILG+A +AT  E+ K+Y KLA   HPDK+  D+ ++L     FK +  A+  L+DE+
Sbjct: 14 YYSILGLASNATSSEVHKSYLKLARLLHPDKTKSDKCEEL-----FKAVVHAHSILTDEN 68

Query: 72 KRNEYD 77
          ++  YD
Sbjct: 69 QKLRYD 74

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 7  SSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQT 66
          S +   +Y+IL V + A   EIKK+YRKLA++ HPDK+            FK I  A++ 
Sbjct: 19 SKDKHAFYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKA----SEAFKRINRAFEV 74

Query: 67 LSDEDKRNEYD 77
          L DE KR  +D
Sbjct: 75 LGDEKKRVLFD 85

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 5   DGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDIT 61
           D ++   D Y +L V+  +T  EI+  YRKL++++HPD   K +   ++ I E ++  IT
Sbjct: 110 DAATLLFDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMIT 169

Query: 62  AAYQTLSDEDKRNEY 76
            AY+ L+DE  R  Y
Sbjct: 170 KAYKALTDEVTRENY 184

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YE+LG++  A+  +IK  YRKL++++HPD   K + + ++   E K+  IT AY+ L+
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALT 180

Query: 69  DE 70
           DE
Sbjct: 181 DE 182

>NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {ON}
           Anc_5.4 YGR285C
          Length = 431

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 12  DYYEILGVAE---DATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           D Y  +G+++    AT  +I K +RK  ++YHPDK    G  L  +  FK I  A++TL+
Sbjct: 97  DLYAAMGLSKLRFKATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDAFFKIIQKAFETLT 156

Query: 69  DEDKRNEYDN 78
           D  KR +YD+
Sbjct: 157 DSTKRQQYDS 166

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPD---KSIDEGQKLINEIKFKDITAAYQTLS 68
           D YE+L V   AT  EI+  YRKL++++HPD   K + + ++ + E ++  IT AY+ L+
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALT 174

Query: 69  DEDKRNEY 76
           D+  R+ +
Sbjct: 175 DDATRDNF 182

>KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {ON}
           Anc_5.4 YGR285C
          Length = 433

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 12  DYYEILGVAE---DATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLS 68
           D Y  +G+++   +AT  +I K +RK  ++YHPDK    G  L  +  FK I  A++TL+
Sbjct: 97  DLYAAMGLSKLRYNATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDAFFKIIQKAFETLT 156

Query: 69  DEDKRNEYDN 78
           D+ KR +YD+
Sbjct: 157 DKTKRMQYDS 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,045,938
Number of extensions: 2938390
Number of successful extensions: 9387
Number of sequences better than 10.0: 433
Number of HSP's gapped: 9125
Number of HSP's successfully gapped: 482
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)