Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.398.263ON49249226270.0
TDEL0F039008.263ON55948917530.0
TPHA0A018008.263ON49848917330.0
YLR089C (ALT1)8.263ON59248917270.0
Skud_12.1578.263ON59248917250.0
NCAS0B050208.263ON56849017160.0
Smik_12.1488.263ON59248917140.0
NDAI0B019908.263ON58848917110.0
Suva_10.1738.263ON59248917060.0
SAKL0H17006g8.263ON53149016960.0
ZYRO0C01628g8.263ON53448716850.0
NCAS0B038408.263ON49748916690.0
CAGL0L12254g8.263ON57449516750.0
KNAG0G020408.263ON59149116680.0
KLLA0F19162g8.263ON52848816490.0
KAFR0B055308.263ON51449216290.0
KAFR0B05520singletonON51049116270.0
Skud_4.3728.263ON50749116230.0
NDAI0J013608.263ON50149116190.0
Kpol_392.58.263ON51248716130.0
KNAG0M012108.263ON52149216090.0
YDR111C (ALT2)8.263ON50749116050.0
Smik_4.3578.263ON50749216000.0
KLTH0G13662g8.263ON51948215970.0
TPHA0J007508.263ON52249015950.0
Suva_2.2718.263ON50749115900.0
Kwal_56.237918.263ON51848215850.0
KAFR0B027308.263ON53949215830.0
TBLA0E044408.263ON56248615800.0
AGR085W8.263ON52149015530.0
Ecym_43078.263ON53449115300.0
TBLA0F030608.263ON50049614980.0
TBLA0G01630singletonON50049614830.0
Kwal_34.160181.472ON3791601383e-08
CAGL0J05126g1.321ON4333611232e-06
Suva_6.1361.321ON4441371133e-05
Ecym_6319singletonON3542981107e-05
KAFR0A017101.321ON4353371108e-05
Skud_10.1561.321ON4603041081e-04
KNAG0B053201.321ON4331631072e-04
KLTH0G19646g1.472ON3791271053e-04
KLTH0H10648g1.321ON4431861044e-04
KLTH0G09614g2.252ON3892591034e-04
KLLA0F10021g3.511ON4973241035e-04
NCAS0A092001.321ON4453521026e-04
Smik_10.1801.321ON4441371027e-04
Kwal_14.25741.321ON443701018e-04
TDEL0D019001.321ON4433741000.001
SAKL0D11528g1.472ON383164990.001
YJL060W (BNA3)1.321ON444136990.001
Kpol_1035.231.321ON444137980.002
SAKL0D06886g1.321ON447325970.002
Kpol_1039.222.252ON386215970.003
SAKL0E08492g2.252ON384151970.003
NDAI0G057601.321ON448168970.003
KNAG0G005501.472ON387186960.004
TPHA0O014501.321ON443171960.004
NCAS0G040501.472ON384145950.004
Ecym_62921.321ON430293950.004
KLLA0F03509g2.252ON387204950.004
AEL170C1.321ON458149940.006
Kpol_480.11.472ON380203920.010
TPHA0F012602.252ON392261890.023
Kpol_278.23.511ON498150890.024
KNAG0E018502.252ON384238890.026
ZYRO0A01672g2.252ON386150890.027
KLLA0F01617g1.321ON444168880.035
Kpol_1032.398.204ON453354860.054
Ecym_32902.252ON386215860.055
ZYRO0G20636g1.321ON453164860.068
ADL249W2.252ON387150830.11
Kwal_23.48882.252ON389174830.14
KLLA0B04378g4.354ON68884830.18
Kwal_47.17462na 1ON492199820.20
KLTH0G19624gsingletonON46854820.21
KLTH0B00176g8.204ON448183810.26
TBLA0B080808.204ON444177800.28
Kwal_33.145822.102ON525174800.32
Skud_8.1982.102ON517173790.44
SAKL0H21824gna 1ON499125780.52
Suva_15.3342.102ON560174780.64
KAFR0J015802.252ON383279770.69
SAKL0F02156g3.511ON498122770.77
NDAI0D032604.354ON69651770.91
ZYRO0G05346g2.102ON504139760.93
CAGL0C01243g2.252ON383152760.95
TDEL0C040902.252ON383310760.98
Kwal_47.189823.511ON49645760.99
SAKL0G18172g4.354ON673126761.1
AAL154C5.198ON28397751.1
Skud_9.552.252ON385265751.3
Smik_9.532.252ON388312751.4
YJR130C (STR2)4.354ON639101751.6
TPHA0O015202.102ON503220732.0
TBLA0B009902.102ON546141732.1
KLLA0A04906gna 1ON48098732.1
KLTH0G02002g3.511ON49644732.2
NDAI0B045502.102ON565170732.3
TPHA0K013604.155ON472112732.4
TDEL0A016008.204ON47543722.7
KLTH0E07678gna 1ON492125713.6
KNAG0B006603.511ON496125713.6
Suva_2.312na 2ON128954714.0
SAKL0E12188g2.102ON530140714.5
NCAS0A059304.50ON1914132715.2
Skud_10.3534.354ON640101705.3
TDEL0D057903.511ON49759696.9
Ecym_71085.198ON28384687.4
KNAG0M003304.354ON63193688.4
TPHA0D033703.511ON49744688.6
CAGL0G01254g3.511ON50444689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.39
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...  1016   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   679   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   672   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   669   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   669   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   665   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   664   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   663   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   661   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   657   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   653   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   647   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   649   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   647   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   639   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            632   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   631   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   629   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   628   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   625   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   624   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   622   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   620   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   619   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   619   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   617   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   615   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   614   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   613   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   602   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   593   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   581   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              575   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    58   3e-08
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    52   2e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    48   3e-05
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    47   7e-05
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    47   8e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    46   1e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    46   2e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    45   3e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    45   4e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    44   4e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    44   5e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    44   6e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    44   7e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   8e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    43   0.001
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    43   0.001
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    43   0.001
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.002
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    42   0.002
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    42   0.003
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.003
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    42   0.003
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       42   0.004
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    42   0.004
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    41   0.004
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    41   0.004
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    41   0.004
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    41   0.006
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.010
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    39   0.023
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    39   0.024
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    39   0.026
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    39   0.027
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    39   0.035
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    38   0.054
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    38   0.055
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    38   0.068
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    37   0.11 
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    37   0.14 
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    37   0.18 
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    36   0.20 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    36   0.21 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    36   0.26 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    35   0.28 
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    35   0.32 
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    35   0.44 
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    35   0.52 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    35   0.64 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   0.69 
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    34   0.77 
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    34   0.91 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    34   0.93 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    34   0.95 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    34   0.98 
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    34   0.99 
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    34   1.1  
AAL154C Chr1 complement(74156..75007) [852 bp, 283 aa] {ON} Synt...    33   1.1  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    33   1.3  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    33   1.4  
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    33   1.6  
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    33   2.0  
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    33   2.1  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   2.1  
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    33   2.2  
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    33   2.3  
TPHA0K01360 Chr11 complement(283543..284961) [1419 bp, 472 aa] {...    33   2.4  
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    32   2.7  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    32   3.6  
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    32   3.6  
Suva_2.312 Chr2 (553989..557858) [3870 bp, 1289 aa] {ON} YDR150W...    32   4.0  
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    32   4.5  
NCAS0A05930 Chr1 complement(1165589..1171333) [5745 bp, 1914 aa]...    32   5.2  
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    32   5.3  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    31   6.9  
Ecym_7108 Chr7 complement(209729..210580) [852 bp, 283 aa] {ON} ...    31   7.4  
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    31   8.4  
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    31   8.6  
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    31   9.6  

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
           TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
           DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 481 REFHQQFYERFS 492
           REFHQQFYERFS
Sbjct: 481 REFHQQFYERFS 492

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 392/489 (80%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE L+V DLN++ + A YAVRGSIPMRAE+L  Q+  DP SLPFDKI+ ANIGNPQQ
Sbjct: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPL+F RQVLSIL+YP +L   E  E+L+  GV++RD IERA+++L  +GGSVGAYS
Sbjct: 132 LNQKPLSFYRQVLSILQYPEVLEQGE--EELISKGVFKRDAIERAKRILRDVGGSVGAYS 189

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           +SQGV G R+TVADFI +RD   + A P DIFLT GAS+AV YLLSILC G E GVLIPI
Sbjct: 190 SSQGVYGIRKTVADFITERDS-GEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS  +PYYL E + WSTNT EIE  + ES+ +G++P  +V+INPGNP
Sbjct: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TG++LS   +  I +++AKYGI +IADEVYQENIF G EFHSM+KVL  LQ E PG YDN
Sbjct: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQL SLHSTSKG  GECGQRGGYMEL GF  E+  +VLKLASIS+C VVTGQAL+DL+ C
Sbjct: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP+PGD SY+ D++ER  I ++L  RA  L+  F SLEG+ECQ+P+GAMYLFP++ LP K
Sbjct: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           AI+ A  LE  PDE+YC++LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWI++W +
Sbjct: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548

Query: 483 FHQQFYERF 491
           FH++FY+++
Sbjct: 549 FHKKFYDQY 557

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/489 (65%), Positives = 386/489 (78%), Gaps = 1/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F P  K+++ DLN   +   YAVRG IP RAE+L  Q+  DP SLPF+KII ANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           +GQKPL+FIR+VLSIL+YP+IL D   L+ L++L VYQ+DV+ RARK+L  IGGSVGAYS
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
            SQGV G +QTVAD+I KRD   ++A P DIFLT GASSAV ++L + C+GP  GVLIPI
Sbjct: 129 LSQGVPGIQQTVADYITKRDS-GEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTAT+TL  +TAI YYL E  +WS NT E+E  I+ES+ +G+KP  IVIINPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TG+IL+E D+A+IIRISAKYG+ IIADEVYQEN+F G EFHS++KVL  LQ ++ G Y+ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG IGECGQRGGYMELIG  D+V   V+KL SISICSVVTGQAL+D+V  
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP+PGD SY++DQ ERN IK DL+ R+ +L+ LF SLEGVEC RPQGAMYLFPK I P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
            I+ A +L    D  YC+ELL+ TGICTVPGSGFGQ P TYHLRTTFLVPG  WI+ WR+
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 483 FHQQFYERF 491
           FH +F ER+
Sbjct: 488 FHTEFCERY 496

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/489 (62%), Positives = 396/489 (80%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE+L++ D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPFD+II ANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQ 164

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 223 SSQGVEGIRKSVAEFITKRDEG-EISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS A+PYYL E++ WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+LS   +A I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L +LQ E PG +DN
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP  G+ S++ DQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP K
Sbjct: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           A+++A  LE+ PDE+YC++LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581

Query: 483 FHQQFYERF 491
           FH++F++++
Sbjct: 582 FHKEFFDQY 590

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 394/489 (80%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE+L++ D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPFDKII ANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 223 SSQGVEGIRKSVAEFITKRDD-GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS A+PYYL E + WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+LS   ++ I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L  LQ E PG +DN
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP  G+ S++LDQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP K
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           A+++A  LE+ PDE+YC+ LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 483 FHQQFYERF 491
           FH++F++++
Sbjct: 582 FHKEFFDQY 590

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/490 (64%), Positives = 386/490 (78%), Gaps = 3/490 (0%)

Query: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61
           +F+PA++L++ +LN + + A YAVRG+IPMRAE+L  Q+  DP SLPFD I+ ANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           Q+ QKPL+F RQVLS+L+YP IL   E   KLV  G++++D +ERA+ +L  IGG+VGAY
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQDE--SKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181
           SASQGV G R+TVA+FI KRD  +  A P DIFLT GAS+AV YLLSILC GPE GVLIP
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEP-AYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
           IPQYPLYTA+L L+NS A+PYYL E + WSTN KEIE  +  +    ++P  +V+INPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301
           PTGA+LSE  +  I  I+AKYGI +IADEVYQEN+F   +FHSM+KVL NLQ + PG YD
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361
            VQLASLHSTSKG  GECGQRGGYMEL GF  EV +++LKLASIS+C VVTGQAL+DL+ 
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421
            PP+ GD S++ DQ ER  IK +L  RA +LY  F +LEG+ECQ+PQGAMYLFP+L LP 
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481
           KA++KA  LE+ PDE+YC+ LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWIE+W+
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 482 EFHQQFYERF 491
            FHQ FY  +
Sbjct: 557 IFHQDFYNTY 566

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/489 (62%), Positives = 394/489 (80%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE+L+++D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPF+KII ANIGNPQQ
Sbjct: 105 FYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYS 222

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 223 SSQGVEGIRRSVAEFITKRDEG-EISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS A+PYYL E + WSTN +EIE  +KE++ N +K   +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNP 341

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+LS   +A I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L +LQ E PG +DN
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP  G+ S++ DQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP +
Sbjct: 462 PPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFR 521

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           A+++A  LE+ PDE+YC++LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 483 FHQQFYERF 491
           FH++F++ +
Sbjct: 582 FHKEFFDHY 590

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 384/489 (78%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE+L++ DLN++ + A YAVRGSIPMRAE+L  Q+ N+P +LPF +I+ ANIGNPQQ
Sbjct: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPL+F RQVLSIL+YP+IL + E  + L+   VY+RD I+RA+ +L  IGGSVGAYS
Sbjct: 161 LKQKPLSFYRQVLSILQYPDILKENE--QNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           ASQGV G R+TVA+FI +RDG  + A P DIFLT        YLLSILC GP+ GVLIPI
Sbjct: 219 ASQGVYGIRKTVANFITERDG-GEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS A+PYYL E + WSTN KEIE  ++++M   + P  +V+INPGNP
Sbjct: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+L+E  +  I  I+AKYGI +IADEVYQENI  G +F+SM+KVL  LQ   PG +DN
Sbjct: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG  GECGQRGGYMELIGF  EV  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP+ GDASY+ DQ ER  IK +L  RA +LY  F  LEG+ECQ+PQGAMYLFPKL LP K
Sbjct: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           A+++A  LE+ PDE+YC+ LLDATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWI++W  
Sbjct: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577

Query: 483 FHQQFYERF 491
           FH++FY+ +
Sbjct: 578 FHKEFYDNY 586

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 393/489 (80%), Gaps = 3/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PAE+L+++D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPF+KII ANIGNPQQ
Sbjct: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ ++  IGGSVGAYS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNHNE--QELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           +SQGV G R++VADFI KRDG  + A P DIFLT GAS+AV YLLSI C GPE GVLIPI
Sbjct: 223 SSQGVEGIRKSVADFITKRDGG-ETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+NS  +PYYL E++ WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+LS   +A I  ++AKYG  +IADEVYQENIFPG EF+SM+KVL +LQ + PG +DN
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP  G+ S++ DQ ERN I + L  RA  LY  F SLEG+ECQ+PQGAMYLFPK+ +P K
Sbjct: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           AI++A  LE+ PDE+YC++LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EW+++W  
Sbjct: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581

Query: 483 FHQQFYERF 491
           FH++F++++
Sbjct: 582 FHKEFFDQY 590

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/490 (64%), Positives = 389/490 (79%), Gaps = 6/490 (1%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PA+KLS+ DLN++ + A YAVRG IP +AE+L  Q+  DP SLPFD+II ANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 63  VGQKPLTFIRQVLSILEYPNILND-PELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           + QKPLTF RQVLS+L+ P++L + P   E+L Q  +Y+ D I+RA ++L +IGGSVGAY
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPR--EQLSQ--IYKPDAIDRAARLLSNIGGSVGAY 160

Query: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181
           S SQGV GFR+TVADFI KRDG ++ A   DIFLT GAS+AV Y+LSILC GP+ GVLIP
Sbjct: 161 SHSQGVYGFRKTVADFITKRDGGEE-AYAEDIFLTAGASAAVSYILSILCRGPQTGVLIP 219

Query: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
           IPQYPLYTA+L L+NS A+PYYL E ++WSTN +EIE  +  S+A GV+P  +V+INPGN
Sbjct: 220 IPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGN 279

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301
           PTGAILS   +  I  ++AKYGI +IADEVYQEN+F G EFHSMRKVL +LQ +  G +D
Sbjct: 280 PTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFD 339

Query: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361
           N+QLASLHSTSKG  GECGQRGGYMEL+GF  +V  + LKLASIS+C VVTGQAL+DL+ 
Sbjct: 340 NIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMV 399

Query: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421
           CPP+PGDASY+ DQ+ER++I   L  RA  LY  F  LEG+ECQ+PQGAMYLFP+L L  
Sbjct: 400 CPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSY 459

Query: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481
           KA++KA  L + PDE+YC+ELL+ATGICTVPGSGFGQ PGTYHLRTTFL PGT+WI+ W 
Sbjct: 460 KAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWE 519

Query: 482 EFHQQFYERF 491
           EFH++FY  +
Sbjct: 520 EFHKKFYNEY 529

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 383/487 (78%), Gaps = 3/487 (0%)

Query: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64
           PAEKL ++++N++ + A YAVRG+IPM A +L+A++  DP SLPFD I++ANIGNPQ + 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 65  QKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSAS 124
           QKPLTF RQVLS+L+YP +L + E  + L+   +YQ+D I RAR++L+ IG SVGAYS S
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENE--QVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 125 QGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQ 184
           QG+ G R+TVA FI +RDG ++ A   DIFLT GASSAV YLLSILC G E GVLIPIPQ
Sbjct: 167 QGIQGIRETVAQFITERDGGEK-AYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQ 225

Query: 185 YPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244
           YPLYTA+L L+NS  +PYYL E + WSTN  EIE  +  ++   +KP  +V+INPGNPTG
Sbjct: 226 YPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTG 285

Query: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304
           A+LSE D++ I  I+AKYGI +IADEVYQEN+F G EFHSM+K+L  LQ   PG +DNVQ
Sbjct: 286 AVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQ 345

Query: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364
           LASLHSTSKG  GECGQRGGYME+ GF +++  ++LKLASIS+C VVTGQAL+DL+  PP
Sbjct: 346 LASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPP 405

Query: 365 QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAI 424
           +PGD SY+LDQ+ER  I + L  RA +L+  F SLEG+ECQ+P+GAMYLFP+L+LP KAI
Sbjct: 406 KPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAI 465

Query: 425 EKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFH 484
           + A    + PD +YC++LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWIERW  FH
Sbjct: 466 QSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFH 525

Query: 485 QQFYERF 491
           + FYE +
Sbjct: 526 KAFYEEY 532

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/489 (61%), Positives = 382/489 (78%), Gaps = 4/489 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PA KLS+ D+N++ V A +A+RGSI ++AE L  Q+  +P  LPFD+I  ANIGNPQ+
Sbjct: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLTF RQV+SIL+YP +LN+ ++L K     ++  D  +RA ++L  IGGSVGAYS
Sbjct: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKE---KIFNSDSFDRAERLLRDIGGSVGAYS 127

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           ASQGV G R+T A++I KRDG  + + P DIFLT GA+SA  YLLS+LC GP+ GVLIPI
Sbjct: 128 ASQGVYGIRKTAAEYITKRDG-GEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           PQYPLYTATL L+ ST IPYYL E ++WSTNT EIE  + +S+  G+KP  IV+INPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA+LSE  +A I +I+AKYGI ++ADEVYQENIF G +FHS +KVL  LQ ++PG +DN
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362
           +QLAS+HSTSKG  GECGQRGGYMEL+GF DEV  ++LKLA +++CSVVTGQA++DL+  
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422
           PP+ GDASY+LD++ER +I   +  RA +LY +F  L+G+ECQ+PQGAMYL+P LIL  K
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482
           AI KA  L + PDE+YC ELLDATGICTVPGSGFGQ  GTYHLRTTFL PG EWI +W +
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 483 FHQQFYERF 491
           FH+ FYE++
Sbjct: 487 FHKHFYEKY 495

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/495 (62%), Positives = 386/495 (77%), Gaps = 13/495 (2%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           + F+PAE+ ++ D+N+  ++A YAVRG+IPMRAE+L  Q++ +P SLPF+ II ANIGNP
Sbjct: 87  LPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNP 146

Query: 61  QQVGQKPLTFIRQVLSILEYPNIL----NDPELLEKLVQLGVYQRDVIERARKMLDSIGG 116
           QQ+ QKPL+F RQVLS+L+YP ++    N+P+ + K        +D I+RA+++LD IGG
Sbjct: 147 QQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIK--------QDAIDRAKRLLDDIGG 198

Query: 117 SVGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEF 176
           SVGAYS+SQGVLG R+TVADFI  RD    +A P DIFLT GASSAV YLLSI C G E 
Sbjct: 199 SVGAYSSSQGVLGIRKTVADFITNRDD-GIIAYPEDIFLTAGASSAVDYLLSIFCRGEET 257

Query: 177 GVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVI 236
           GVLIPIPQYPLYTATL L NS A+PYYL E T WST+ +E+E  I +S+ N +KP  +V+
Sbjct: 258 GVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVV 317

Query: 237 INPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEF 296
           INPGNPTGA+LSE  +  I  ++AKYGI +IADEVYQEN+F   +FHSM+KVL  LQ + 
Sbjct: 318 INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQ 377

Query: 297 PGTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQAL 356
           PG YDNVQLASLHSTSKG  GECGQRGGYMEL+GF  ++  +VLKLASIS+C VVTGQAL
Sbjct: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437

Query: 357 MDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPK 416
           +DL+ CPPQ G+ SY+ DQEER  I ++L  RA  L+  F  L+G+ CQ+PQGAMYLFPK
Sbjct: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497

Query: 417 LILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEW 476
           L LP KAI++AL  ++ PDE+YC+ LL+ TGICTVPGSGFGQ+PGTYHLRTTFL PGT+W
Sbjct: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557

Query: 477 IERWREFHQQFYERF 491
           IE W +FHQ+FY +F
Sbjct: 558 IEDWVDFHQEFYNKF 572

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/491 (62%), Positives = 381/491 (77%), Gaps = 5/491 (1%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PA ++ + DLN++ + A YAVRGSIPMRAEQL  Q+  DP SLPFDKII ANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEK-LVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           + QKPL+F RQVLS+L++P +LN   L E       +Y+ D + RA K+L+ IGGSVGAY
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNS--LKENPAAATSLYKADAVRRAEKLLEDIGGSVGAY 219

Query: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181
           S SQGV+G R+TVADFI +RD   + A P DIFLT GAS+AV YLLSI C G + GVLIP
Sbjct: 220 STSQGVMGIRKTVADFITRRDN-NEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIP 278

Query: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
           IPQYPLYTATL L+NS  +PYYL E + WSTNTKEI+  + +++   +KP  +V+INPGN
Sbjct: 279 IPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGN 338

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIF-PGFEFHSMRKVLLNLQSEFPGTY 300
           PTGA+LSE  +A+I  I+AKYGI +IADEVYQENIF    +FHSM+KVL  LQ E PG +
Sbjct: 339 PTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKF 398

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           D VQLASLHSTSKG  GECGQRGG+MEL GF  E+  ++LKLASIS+C VVTGQAL+DL+
Sbjct: 399 DEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLM 458

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PPQ G+ SY+LDQ ER+ I  +L  RA++L+  F  LEG++CQ+PQGAMYLFP+L LP
Sbjct: 459 VHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLP 518

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
            KA++KA  +E+  DE+YC+ELL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEWI+ W
Sbjct: 519 FKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLW 578

Query: 481 REFHQQFYERF 491
            +FH++FY ++
Sbjct: 579 EKFHKEFYNKY 589

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 383/488 (78%), Gaps = 7/488 (1%)

Query: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64
           PA KLS++D+N++ + A YAVRG IPMRAE+L  Q+  DP SLPF KII+ANIGNPQQ+ 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 65  QKPLTFIRQVLSILEYPNILNDP-ELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSA 123
           QKPLTF R+VLS+L++P +L +  E L+ L     Y+ D I+RA+++L  +GGSVGAYS 
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEALQTL-----YKTDSIKRAKRLLSEVGGSVGAYSQ 159

Query: 124 SQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           SQGV G R+TVADFI KRD   +++ P DI+LT GAS+AV Y+LSILC GP  GVLIPIP
Sbjct: 160 SQGVQGIRETVADFITKRDD-GEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIP 218

Query: 184 QYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPT 243
           QYPLYTA+L L+NS  +PYYL+E  +WST+ +EIE  + +++  G+KP  +V+INPGNPT
Sbjct: 219 QYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPT 278

Query: 244 GAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNV 303
           GAILSE  +  I  ++AKYGI +IADEVYQEN+F G +F+SM+KVL NLQ  + G YDN+
Sbjct: 279 GAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNI 338

Query: 304 QLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCP 363
           QLASLHSTSKG  GECGQRGGYMEL+GF  ++  + LKLASIS+C VVTGQAL+DL+  P
Sbjct: 339 QLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSP 398

Query: 364 PQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKA 423
           PQPGD SY+ DQ+ER  I   L  RA +L+  F+ LEG+EC++PQGAMYL+PKL LP K 
Sbjct: 399 PQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKV 458

Query: 424 IEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREF 483
           I++A  LE+ PDE+YC+ LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W +F
Sbjct: 459 IQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKF 518

Query: 484 HQQFYERF 491
           H+ F++++
Sbjct: 519 HKAFFDKY 526

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/492 (60%), Positives = 381/492 (77%), Gaps = 7/492 (1%)

Query: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGS--LPFDKIITANIGN 59
           +F PA+K++++DLNQ+ + ++YAVRGSIP RAE+L  +++N+  S  L F+ I+ ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 60  PQQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVG 119
           PQQ+ QKPLTF RQV+SIL+YP +LN   +L   V  G+++ D +ERA  +L  IGGSVG
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNIL---VSTGIFKSDAMERAETLLCHIGGSVG 143

Query: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179
           AYS+SQGV G R+TVA++I  RD   + ASP+DIFLT GAS A  YLLS+LC     GVL
Sbjct: 144 AYSSSQGVYGIRETVANYITARDN-GETASPDDIFLTEGASKAASYLLSLLCKDKNTGVL 202

Query: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINP 239
           IPIPQYPLYTAT+TL ++  +PYYL E + WSTNT EIE  + +++A+ VKP  +V+INP
Sbjct: 203 IPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINP 262

Query: 240 GNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGT 299
           GNPTG++LS+ D+  II I AKYGI +IADEVYQENIF G EFHSM+KVL +LQ ++PG 
Sbjct: 263 GNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGK 321

Query: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359
           YD VQLASLHSTSKG  GECGQRGGYMEL+GFKDE+   +LKLASIS+CSV+TGQAL+DL
Sbjct: 322 YDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDL 381

Query: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419
           +  PP+ GD SY+LD  ER  I + L  RA++LY LF  L+GVECQ+PQGAMYLFPKL  
Sbjct: 382 MVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHF 441

Query: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479
           P   I +A+   + PDE+YC  LL+ATGICTVPGSGFGQ  GTYHLRTTFL PG +W E+
Sbjct: 442 PQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEK 501

Query: 480 WREFHQQFYERF 491
           W+ FH++F+ ++
Sbjct: 502 WKLFHEEFFSKY 513

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 383/491 (78%), Gaps = 7/491 (1%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIIN--DPGSLPFDKIITANIGNP 60
           F PA K+SV DLNQ  ++A+YAVRGSI MRAE+L  ++ +   P S PF++II ANIGNP
Sbjct: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ QKPLTF RQV+SILEYP +L   +  + L+  G+Y++D +ERA  +   IG SVGA
Sbjct: 84  QQLDQKPLTFSRQVMSILEYPGLL---KFKDVLLSQGIYKKDALERAELLQSQIGASVGA 140

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS +QGV G R+T A FI+KRD C + AS +DIFLT GAS AV YL+  LC     G+LI
Sbjct: 141 YSLAQGVYGIRETTARFISKRDNC-EAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTA++ + N+  +PYYL E + WST  +EIE ++  ++ NG+KP A+V+INPG
Sbjct: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA+LS   +  II ++AKYGI +IADEVYQ+NIF G EFHSM+K+L  LQ ++PG Y
Sbjct: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKY 318

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHSTSKG  GECGQRGGYME++GF DEV  ++LKLASI+ICSVVTGQAL+DL+
Sbjct: 319 DNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLM 378

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PP  GD SY+ DQEERN+I   L  RAD+LY  F++LEG+ECQ+PQGAMYLFP+LILP
Sbjct: 379 VDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILP 438

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
           D+AIE+A +L++  DE+YC +LL+ TGICTVPGSGFGQ  GTYH+RTTFL PGTEWI+ W
Sbjct: 439 DRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDW 498

Query: 481 REFHQQFYERF 491
           ++FH++F + +
Sbjct: 499 KKFHEKFMKEY 509

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 374/491 (76%), Gaps = 3/491 (0%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           + F PA K++  DLN     A+YAVRGSIP RA++L  ++  +PG LPFD II ANIGNP
Sbjct: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ QKPLTF RQVLSILEYP IL      EKL  L ++ +D ++RA  +L  IGGSVGA
Sbjct: 78  QQLDQKPLTFTRQVLSILEYPEILQVDH--EKLASLNLFSKDALKRAECLLKDIGGSVGA 135

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS SQGV G RQTVADFI  RDG  + A+P DI+LT GASSA   LLS+LC     G+LI
Sbjct: 136 YSHSQGVPGIRQTVADFITARDG-GEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLI 194

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTA+ +L N+  +PYYL E  +WST + EIE  +++++  G++P  +++INPG
Sbjct: 195 PIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG 254

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA+L+E  +A I  I+AKYGIA+I+DEVYQEN+F  F+FHSM+KVL  LQ  +PG +
Sbjct: 255 NPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKF 314

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSVVTGQA++DL+
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLM 374

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PPQPGD SY+ D++ER+KI  ++  RA+ LY  F  LEG+ECQ PQGAMYLFP+LILP
Sbjct: 375 VNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILP 434

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
           DKA  ++ +L + PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ W
Sbjct: 435 DKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNW 494

Query: 481 REFHQQFYERF 491
           + FHQ F+  +
Sbjct: 495 KNFHQSFFNEY 505

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/491 (59%), Positives = 380/491 (77%), Gaps = 3/491 (0%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           F PA KLS+ DLN + + A++AVRG+IPM+A++L  Q+  +P SLPF++I  ANIGNPQ+
Sbjct: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72

Query: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122
           + QKPLTF RQV+SIL+YP +LN    L       +Y  D  +RA K+L+ IGGSVGAYS
Sbjct: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTP-PIYNNDSFDRAEKLLNEIGGSVGAYS 131

Query: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           ASQGV G R+T+A++I +RD   + ASPNDIF+T GA++A  YLLSIL +GP+ GVL+PI
Sbjct: 132 ASQGVYGIRKTIANYITQRD-LGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGN 241
           PQYPLYTA L L N+T +PYYL+E + WS +T EIE  IK+ +M  G++P  +VIINPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301
           PTG+ILSE  L  I  I+AKYGI IIADEVYQEN+F G +FHS +KVL +LQ +FP  Y+
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361
           NVQLASLHSTSKG  GECGQRGGYME+IGF ++V  ++LKLA I +C VVTGQA+MDL+ 
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421
            PP+ GD SY+LD  ER +I  D++ RA +LY +F+ +EG++CQ+PQGAMYLFP+L+L  
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481
           K I++A + E+ PDE+YC ELL+ TGICTVPGSGFGQ P TYHLRTTFL PG +WI +W 
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 482 EFHQQFYERFS 492
           +FH+ F +R++
Sbjct: 491 KFHKAFLKRYT 501

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/487 (62%), Positives = 375/487 (77%), Gaps = 11/487 (2%)

Query: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64
           PA+KL ++DLN++ + A YAVRGSIP+RAE+L    +     LPFD +I ANIGNPQQ+ 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQLK 93

Query: 65  QKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSAS 124
           QKPLTF RQVLSIL+YP      ELLE      ++++D IERARK+L  IG SVG+YS+S
Sbjct: 94  QKPLTFYRQVLSILQYP------ELLES--GSNIFKKDAIERARKLLKEIG-SVGSYSSS 144

Query: 125 QGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQ 184
           QG+   R+TVA+FI KRD   ++++PNDIFLT GASSAV YLLSILC   + GVLIPIPQ
Sbjct: 145 QGIPAIRKTVANFITKRDD-GEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203

Query: 185 YPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244
           YPLYTATL L+N+ A+PYYL E   WST+  EIE  I +S+  G+KP A+VIINPGNPTG
Sbjct: 204 YPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263

Query: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304
           +ILS   +  II ++A +GI IIADEVYQEN+F   +FHSM+KVL NLQ  FPG YD VQ
Sbjct: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323

Query: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364
           LASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKL SIS+C VVTGQAL+DL+  PP
Sbjct: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383

Query: 365 QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAI 424
           Q GD SY+ DQ ER+ I  DL  RA  L+  F S+EGV CQ+P+GAMYLFPK+ LP K +
Sbjct: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443

Query: 425 EKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFH 484
           +K+ +L+I PDE+YC+ LL+ATGICTVPGSGFGQ PGTYHLRTTFL PGTEWI+RW +FH
Sbjct: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503

Query: 485 QQFYERF 491
            +FY+++
Sbjct: 504 AEFYDKY 510

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/492 (60%), Positives = 373/492 (75%), Gaps = 5/492 (1%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           ++F PA KL  +DLN++ + A+YAVRG+IPM+AE+L  Q+   P  LPF+ I  ANIGNP
Sbjct: 32  LAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNP 91

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ QKPLTF RQV+SIL+YP +L+     E+LV  G Y+RD  +RA  +L+ IGGSVGA
Sbjct: 92  QQLDQKPLTFSRQVVSILQYPPLLD---YEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGA 148

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS +QGV G R++VADFI +RD   + ASP+DIFLT GAS A  YLLSILC     G++I
Sbjct: 149 YSLAQGVYGIRESVADFITRRDE-GETASPDDIFLTDGASKAATYLLSILCRDSSTGIMI 207

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTA++T+ NS  +PYYL E + WST  +EIE  + +S+  GV P  IV+INPG
Sbjct: 208 PIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG 267

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFP-GT 299
           NPTGA+LS   +A I+ I+AKYGI ++ADEVYQ NI+ G +FHSM+KVL +LQ + P G 
Sbjct: 268 NPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGE 327

Query: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359
           YDNVQLAS+HSTSKG  GECGQRGGYMEL+GF +EV  ++LKLASISICSVVTGQAL+DL
Sbjct: 328 YDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDL 387

Query: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419
           +  PP+ GD SY+LD  ER +I  ++  R   LY  F  LEG+ECQ PQGAMYLFPKL+L
Sbjct: 388 MLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLL 447

Query: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479
             KAIE+A  L + PDE+YC  LLD TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI+ 
Sbjct: 448 SKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKD 507

Query: 480 WREFHQQFYERF 491
           W  FH+ FY+++
Sbjct: 508 WETFHKAFYDKY 519

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/491 (59%), Positives = 375/491 (76%), Gaps = 3/491 (0%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           + F PA K++  DLN     A+YAVRG+IP RA++L  ++  +P  LPFD II ANIGNP
Sbjct: 18  LDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNP 77

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ QKPLTF RQVL+ILEYP IL       +L  L ++ RD +ERA ++L+ IGGS+GA
Sbjct: 78  QQLDQKPLTFTRQVLAILEYPEILRVGH--NELASLNLFSRDALERAERLLNDIGGSIGA 135

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS SQGV G RQTVADFI +RDG  + A+P DI+LT GASSA   LLS+LC   + G+LI
Sbjct: 136 YSHSQGVPGIRQTVADFITRRDG-GEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLI 194

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTA+ +L N+  +PYYL E ++WSTN+ EIE  +++++   ++P  +++INPG
Sbjct: 195 PIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG 254

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA+LSE  +A I  I+AKYGI II+DEVYQENIF   +FHSM+KVL  LQ  +PG +
Sbjct: 255 NPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKF 314

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHS SKGF+ ECGQRGGYME+IGF  E+   + KL SISICSVVTGQA++DL+
Sbjct: 315 DNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLM 374

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PPQPGD SY+ D +ER KI  ++  RA+ LY  F  LEG+ECQ+PQGAMYLFP+L+LP
Sbjct: 375 VKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLP 434

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
            KA+ ++ +L I PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ W
Sbjct: 435 KKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDW 494

Query: 481 REFHQQFYERF 491
           +EFHQ F+ ++
Sbjct: 495 KEFHQDFFSKY 505

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/492 (59%), Positives = 376/492 (76%), Gaps = 5/492 (1%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           ++F PA K++  DLN     A+YAVRG+IP RA++L  ++   PG LPFD II ANIGNP
Sbjct: 18  LNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNP 77

Query: 61  QQVGQKPLTFIRQVLSILEYPNILN-DPELLEKLVQLGVYQRDVIERARKMLDSIGGSVG 119
           QQ+ QKPLTF RQVLSILEYP IL   P+   KL  L ++++D + RA  +L+ IGGS+G
Sbjct: 78  QQLDQKPLTFTRQVLSILEYPEILRVGPD---KLASLNLFRKDALGRAEHLLEDIGGSIG 134

Query: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179
           AYS SQGV G RQ+VA+FI KRD  +  A+P +I+LT GASSA   LLS+LC   + G+L
Sbjct: 135 AYSHSQGVPGIRQSVAEFITKRDDGEP-AAPENIYLTTGASSAATSLLSLLCKDVQTGLL 193

Query: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINP 239
           IPIPQYPLYTA+ +L N+  +PYYL E ++WST + EIE  +K+++  G+KP  +++INP
Sbjct: 194 IPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINP 253

Query: 240 GNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGT 299
           GNPTGA+LSE  +A I  I+AKYGIAII+DEVYQEN+F G +FHSM+KVL  LQ  +PG 
Sbjct: 254 GNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGK 313

Query: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359
           +DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSVVTGQA++DL
Sbjct: 314 FDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDL 373

Query: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419
           +  PPQPGD SY  D  ER KI  ++  RA  L+  F  LEG+ECQ+PQGAMYLFP+L+L
Sbjct: 374 MVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVL 433

Query: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479
           P+KA+ ++ +L I PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ 
Sbjct: 434 PEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQD 493

Query: 480 WREFHQQFYERF 491
           W+ FHQ F+ ++
Sbjct: 494 WKHFHQDFFNKY 505

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/482 (61%), Positives = 374/482 (77%), Gaps = 5/482 (1%)

Query: 8   KLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKP 67
           K ++ D+NQ  ++A YAVRG IP+RAE+L  +++ +PGSLPF+KII ANIGNPQQ+ QKP
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 68  LTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQGV 127
           LTF RQVLS+L+ P ++   E L       +++ D +ERA+KML  +GGSVGAYSASQGV
Sbjct: 99  LTFYRQVLSLLQNPALI---ESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGV 155

Query: 128 LGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187
            GFRQ+VA+FI +RDG  + AS NDIFLT GASSAV  +LS+ C+G E G LIPIPQYPL
Sbjct: 156 AGFRQSVAEFIEERDG--EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213

Query: 188 YTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247
           YTATL L+++ A+PYYL E + WS +T+++E  +K+++  GV+P  +V+INPGNPTGAIL
Sbjct: 214 YTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAIL 273

Query: 248 SESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLAS 307
           S   +  I+ ++AKY + +IADEVYQEN F   +F SM+KVL  LQ   PG YDNVQLAS
Sbjct: 274 SPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLAS 333

Query: 308 LHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPG 367
           LHSTSKG  GECGQRGGYMEL+GF +EV  + LKLASIS+C VVTGQAL+DL+  PP+ G
Sbjct: 334 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKG 393

Query: 368 DASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKA 427
           DASY+LD++ERN I   L  ++  LY  F SLEGV CQ+PQGAMYLFPKL L  KAI KA
Sbjct: 394 DASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKA 453

Query: 428 LQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQQF 487
             L + PDEYYC+ELL+ATGICTVPGSGF Q PGTYHLRTTFL PGTEW++ W++FHQ+F
Sbjct: 454 ESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKF 513

Query: 488 YE 489
            +
Sbjct: 514 VD 515

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/490 (62%), Positives = 384/490 (78%), Gaps = 4/490 (0%)

Query: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61
           +F PA+KL++NDLN++ + A YAVRG IP RAE L  Q+I++P SLPF K+I ANIGNPQ
Sbjct: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQ 94

Query: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           Q+ QKPLTF RQVLS+L+YP +L+  E      +  +Y++D IERA+++L+ IG SVG+Y
Sbjct: 95  QLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKT-LYKQDAIERAKRILNDIGSSVGSY 151

Query: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181
           S+SQGV G R+TVA++I++RDG ++ A   DIFLT GASSAV YLL+ILC G E GVLIP
Sbjct: 152 SSSQGVFGLRKTVAEYISRRDGGEK-AYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210

Query: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
           IPQYPLYTATL L+N+ A+PYYL+E++ WSTN +EIE  +  ++   + P  +V+INPGN
Sbjct: 211 IPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301
           PTGAILS   +  I  ++A +GI +IADEVYQENIFPG EFHSM+KVL +LQ   PG Y+
Sbjct: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330

Query: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361
           NVQLASLHSTSKG  GECGQRGGYMEL GF  E+   +LKL SIS+C VVTGQAL+DL+T
Sbjct: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390

Query: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421
           CPP+ G+ASY+ DQ ER+ I  +L  RA  L+  F  +EGV CQ+PQG+MYLFPK+ +P 
Sbjct: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450

Query: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481
           KA+EKA +L+I PDE YC ELL+ATGICTVPGSGFGQ PGT+HLRTTFL PGT WI++WR
Sbjct: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510

Query: 482 EFHQQFYERF 491
           EFHQ F  ++
Sbjct: 511 EFHQIFCNKY 520

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/491 (59%), Positives = 371/491 (75%), Gaps = 3/491 (0%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           + F PA KL+  DLN     A+YAVRG+IP RAE+L  ++     SLPF+ II ANIGNP
Sbjct: 18  LDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNP 77

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ QKPLTF RQVLSILEYP IL      +KL  L ++ +D ++RA+++LD IGGSVGA
Sbjct: 78  QQLDQKPLTFTRQVLSILEYPEILRVDH--DKLASLNLFAKDALKRAQRLLDDIGGSVGA 135

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS SQGV G RQTVADFI +RDG +  A P DI+LT GASSA   LLS+LC   + G+L+
Sbjct: 136 YSHSQGVPGIRQTVADFITERDGGEP-AGPEDIYLTTGASSAATSLLSLLCKDSQTGLLL 194

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTA+ +L N+  +PYYL E   WST + EIE  + +++  G++P  +V+INPG
Sbjct: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA+L+E+ +A I  I+AKYGI II+DEVYQENIF   +FHSM+K+L  LQ+  PG +
Sbjct: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSV TGQA++DL+
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PPQPGD SY  D++ER KI  +++ RA+ LY  F  LEG++CQ+PQGAMYLFPKL LP
Sbjct: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
           +KA+ ++ +L I PD  YC  LL++TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI+ W
Sbjct: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494

Query: 481 REFHQQFYERF 491
           R+FHQ F+ ++
Sbjct: 495 RQFHQDFFNKY 505

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/482 (60%), Positives = 374/482 (77%), Gaps = 5/482 (1%)

Query: 8   KLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKP 67
           K ++ D+N+  ++A YAVRG IP+RAE+L  +++ +PGSLPFDKII ANIGNPQQ+ QKP
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 68  LTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQGV 127
           LTF RQVL++L+ P++++D   L        ++ D +ERA+KML  +GGSVGAYS SQGV
Sbjct: 98  LTFYRQVLALLQNPDLISD---LSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGV 154

Query: 128 LGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187
            GFR++VA+FI +RDG  + AS  DIFLT GAS AV Y+LS+ C+GPE G LIPIPQYPL
Sbjct: 155 AGFRESVAEFIEERDG--EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212

Query: 188 YTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247
           YTA+L L+NS A+PYYL E + WS +T++IE  +++S+  G++P  +V+INPGNPTGA+L
Sbjct: 213 YTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALL 272

Query: 248 SESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLAS 307
           +   + ++I+++AKY + IIADEVYQEN F   EF SM+KVL  LQ   PG YDNVQLAS
Sbjct: 273 NTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLAS 332

Query: 308 LHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPG 367
           LHSTSKG  GECGQRGGYMEL+GF +EV  + LKLASIS+C VVTGQAL+DL+  PP+ G
Sbjct: 333 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKG 392

Query: 368 DASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKA 427
           DASY+ D++ER  I   L  R+  LY  F S+EGV CQ PQGAMYLFPKL L +KAI KA
Sbjct: 393 DASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKA 452

Query: 428 LQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQQF 487
               + PDEYYC+ELL+ATGICTVPGSGFGQ PGT+HLRTTFL PGTEWI+ W++FH++F
Sbjct: 453 ESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512

Query: 488 YE 489
            E
Sbjct: 513 TE 514

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/492 (61%), Positives = 381/492 (77%), Gaps = 3/492 (0%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           ++F PA +L++ DLN++ + A YAVRG IP RAE+L  Q+   P SLPFDKII ANIGNP
Sbjct: 50  LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNP 109

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+ Q+PL+F RQVLS+L+YP +L+  E   K     VY++D I RA+K+L  IGGSVGA
Sbjct: 110 QQLQQQPLSFYRQVLSLLQYPTLLHAIE--TKPGSSAVYKKDAILRAKKILKDIGGSVGA 167

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS SQGV G R+TVA+FI +RDG +  A P DIFLT GAS+AV+YLLSILC G + GVLI
Sbjct: 168 YSESQGVYGIRRTVANFITERDGGEP-AYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTATL L+NS A+PY+L E   WS N  EIE  IK+++ + +KP  +V+INPG
Sbjct: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA+LS+  +  I+ I+AKYGI +IADEVYQENIF G +FHS++ VL  LQ E PG +
Sbjct: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
           DNVQLASLHSTSKG  GECGQRGGYME+IGF  EV  ++LKLASIS+C VVTGQAL+DL+
Sbjct: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
             PP+ G+ S+ LDQ +R  I   L  RA+ L+  F SL+G+ECQ+P GAMYLFPKL LP
Sbjct: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
            +AI++A +LE+ PDE+YC+ELL+ TGICTVPGSGFGQ  GTYHLRTTFL PG EWI+ W
Sbjct: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526

Query: 481 REFHQQFYERFS 492
           ++FH +F E+++
Sbjct: 527 KQFHIEFMEKYN 538

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/486 (59%), Positives = 369/486 (75%), Gaps = 5/486 (1%)

Query: 6   AEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQ 65
           AE+L   DLN + V A YAVRG+IP  A++L  Q++  PG+LPF+ +I +NIGNPQQ+GQ
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 66  KPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQ 125
           KPL+F RQVLSILEYP +L+       LV    Y  D IERA+ +L  IG S+GAYS SQ
Sbjct: 141 KPLSFGRQVLSILEYPALLDHER---TLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQ 196

Query: 126 GVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQY 185
           GV G RQTVADFI  RD   ++A P+DIFLT GASSAV  +LSILC G + GVLIPIPQY
Sbjct: 197 GVHGIRQTVADFITNRDD-GEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQY 255

Query: 186 PLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGA 245
           PLYTATLTL+++TA+PYYL E   WST+  EI    ++S+  G+KP  +V+INPGNPTG+
Sbjct: 256 PLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGS 315

Query: 246 ILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQL 305
           +L+   + ++  ++AKYG+ +IADEVYQ+NIFPG EFHSM+K+L  LQ E P  YDN+QL
Sbjct: 316 VLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQL 375

Query: 306 ASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQ 365
           ASLHS SKG +GECG RGGY E IGF  EV  ++ KL+SIS+CS V GQAL+DL+ CPP+
Sbjct: 376 ASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPK 435

Query: 366 PGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIE 425
            G+ SY+LDQ ER  I+ +   R+++LY +F SLEGV CQ+PQGAMY+FP + LP  AI+
Sbjct: 436 KGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIK 495

Query: 426 KALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQ 485
            A  L+I PDE+YCRELL ATGICTVPGSGFGQ PGTYH+RTTFL PG EW++RW +FH 
Sbjct: 496 MAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHI 555

Query: 486 QFYERF 491
           +F+E++
Sbjct: 556 EFFEKY 561

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 369/490 (75%), Gaps = 8/490 (1%)

Query: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62
           FVPAE +++ D+N++ V A YAVRG IP RAE+L  ++   PGSLPF KII ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 63  VGQKPLTFIRQVLSILEYPNILNDP-ELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           +GQKPLTF RQV+S+++ P +L  P E L++      ++ DV+ RAR+ML   GGSVGAY
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-----AFKADVVVRARRMLQDAGGSVGAY 151

Query: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181
           SASQGV G+R+TVA FI +RDG    A+P++++LT GASSAV  LLS  C GPE GVLIP
Sbjct: 152 SASQGVKGYRRTVAQFIERRDGIP--ANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209

Query: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
           IPQYPLYTAT+T +N+ A+PYYL E   WSTN  E+E  I +S    + P  +V+INPGN
Sbjct: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301
           PTG++LS  D+  I+ ++AKYGI +IADEVYQ+N+F   +FHSMRKVL NLQ   P  Y 
Sbjct: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYK 329

Query: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361
           NVQLASLHS SKG  GECGQRGGYMELIGF++E+  + +KLASIS+C VVTGQAL+DL+ 
Sbjct: 330 NVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMV 389

Query: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421
            PP  GD SY+   +E   I  +L  R+  L+  F SLEG+EC  PQGA+YLFPKL LP 
Sbjct: 390 GPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQ 449

Query: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481
           KAIE A +L IP DE YC ELLD TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE W+
Sbjct: 450 KAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWK 509

Query: 482 EFHQQFYERF 491
           +FH++FY+++
Sbjct: 510 DFHKKFYDKY 519

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/491 (57%), Positives = 363/491 (73%), Gaps = 6/491 (1%)

Query: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60
           + F P + L + DLN + + A YAVRG IP RA +L  Q+  DP SLPF KII ANIGNP
Sbjct: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107

Query: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120
           QQ+GQKPL+F R+VLS+LE PN+L  P  +  L+    Y+ D + RA++M+  +  S+GA
Sbjct: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLI----YKPDAVRRAKRMMRDLQTSIGA 163

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS SQGVLGFR+TVA++++ RDG  + AS  DIFLT GAS+    ++ +LC G E GVLI
Sbjct: 164 YSHSQGVLGFRKTVAEYLSSRDG--EPASAEDIFLTTGASNGASLMIELLCKGQESGVLI 221

Query: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           PIPQYPLYTAT+TL+N+ A+PYYL E + WS N  ++E  I ES+  GVKP  +V+INPG
Sbjct: 222 PIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG 281

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGAIL    +  I  I+AKY I +IADEVYQEN+F G +F+SM+KVL +LQ  +   +
Sbjct: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELF 341

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360
            NVQL SLHSTSKG  GECGQRGGYMEL+GF D++  ++LK+ASI +CS V GQAL+DL+
Sbjct: 342 SNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLM 401

Query: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420
              P+PGD SY+ D  ER+ I+  L  R+  L+  F +LEGVEC++PQG+MYLFP+L+LP
Sbjct: 402 LSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLP 461

Query: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480
            KAI+ A  L++ PDE+YC ELL++TGICTVPGSGFGQ P T HLRTTFL PGTEWIE W
Sbjct: 462 QKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESW 521

Query: 481 REFHQQFYERF 491
             FH+ FY+++
Sbjct: 522 ELFHKSFYDKY 532

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/496 (56%), Positives = 374/496 (75%), Gaps = 9/496 (1%)

Query: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61
           +F+PA K S+ND+N+  + A+YA+RG+IP RAE+L  Q++ +  SLPF KI+ ANIGNPQ
Sbjct: 7   TFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQ 66

Query: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121
           Q+ Q+PLTF RQV+S++++P++L   ++L  L Q  +Y +D IERA K+L+SIGGSVGAY
Sbjct: 67  QLDQQPLTFQRQVMSLVQFPDLLKSKDIL--LAQ-KIYSKDSIERATKLLNSIGGSVGAY 123

Query: 122 SASQGVLGFRQTVADFINKRD----GCKQL--ASPNDIFLTGGASSAVHYLLSILCSGPE 175
           S+SQGVL  R+ VA FI KRD      + L   + +++FLT GAS+AV ++L +      
Sbjct: 124 SSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDES 183

Query: 176 FGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIV 235
            GVL+PIPQYPLYTA +TL  S  +PYYL E  +WST+ K+IE  + +++   +KP  +V
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243

Query: 236 IINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSE 295
           +INPGNPTGAIL++  + DII I+A+YGI IIADEVYQEN++  FEFHS +KVL  L+  
Sbjct: 244 VINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303

Query: 296 FPGTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQA 355
           +P  YDNVQLASLHS SKG  GECGQRGGYME+ GF ++V  ++LK+ASISICSVVTGQ 
Sbjct: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363

Query: 356 LMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFP 415
           L+DL+  PPQPGD SY+LDQ ER+ I  +L+ +++ LY +FT L G+ CQ+PQGAMYLFP
Sbjct: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423

Query: 416 KLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTE 475
           +L L + AI  A +L + PDE+YC +LL+ TGICTVPGSGFGQ PGTYHLRTTFL PG E
Sbjct: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483

Query: 476 WIERWREFHQQFYERF 491
           WI  W +FH +F E++
Sbjct: 484 WINSWEKFHLEFMEKY 499

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 361/496 (72%), Gaps = 11/496 (2%)

Query: 4   VPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQV 63
            PA K S+ND++Q  +  +YA+RG+IP RA++L  Q+   P  LPF KII ANIGNPQQ+
Sbjct: 7   TPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQL 66

Query: 64  GQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSA 123
            Q+PLTF RQVLS++EYPN++N   +L   V+  +Y  D I+RA  +L+SIGGSVGAYS+
Sbjct: 67  EQEPLTFQRQVLSLVEYPNLVNSKNIL---VENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 124 SQGVLGFRQTVADFINKRDG----CKQLA----SPNDIFLTGGASSAVHYLLSILCSGPE 175
           SQG+L  R+ VA  I +RD     C        + ++IFLT GA++AV Y+L +      
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 176 FGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIV 235
            GVL+PIPQYPLYTA +TL NS  +PYYL E  +WST+ +EIE  IK++++  +KP  +V
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 236 IINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSE 295
           IINPGNPTGAILS   +  II I+AKYGI IIADEVYQ NI+  F+FHS +K+L +L+ +
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 296 FPGTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQA 355
           +P  YDNVQLASLHS SKG  GECGQRGGY EL+GF DE+  I+LKLASI ICSVVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 356 LMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFP 415
           L+DL++ PP+ GD SYKLDQ ERN I+ +L+ +++ LY LF+ L G+ CQ+PQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 416 KLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTE 475
           +L L    I +A    + PDE+YC +LL+ TGICTVPGSGFGQ  GTYH+RTTFL  G E
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 476 WIERWREFHQQFYERF 491
           WI+ W +FH +F  ++
Sbjct: 484 WIKLWEKFHLEFMNQY 499

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 26/160 (16%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSA---VHYLLS-----ILCS 172
           Y A QG    R+ +A+  +  D      S  ++ LT GA +A    HY L+      +C 
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED---VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICI 111

Query: 173 GPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPV 232
            P +  L  IPQ  ++ A + L        +L++ T++  N  E+E  IK +        
Sbjct: 112 SPTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIKPNTK------ 156

Query: 233 AIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVY 272
            IV+  P NP  +++    L +I  ++ K+GI +  DEVY
Sbjct: 157 CIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 149/361 (41%), Gaps = 61/361 (16%)

Query: 118 VGAYSASQG--------VLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSI 169
           V  YS ++G        V  ++    DFI+ +         N +  TG     +  L+ I
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQ---------NVLVTTGANEGILSCLMGI 124

Query: 170 LCSGPEFGVLIPIPQYPLYTATLTLSNSTA--IPYYL-KEHTSWSTNTKEIEIN---IKE 223
           L +G E  V++  P +  Y   + L       +P +  KE  + +T   E +I+   +++
Sbjct: 125 LNAGDE--VIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEK 182

Query: 224 SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFH 283
           +  N  K  A++I  P NP G + +E +L  + ++  ++   +I+DEVY+          
Sbjct: 183 TFNNKTK--AVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEH--------- 231

Query: 284 SMRKVLLNLQSEFPGTYD-NVQLASLH----STSKGFIGECGQRGGYMELIGFKDEVIAI 338
                 L     FP   + N  +A+L     S  K F    G R G+  +I   D+++  
Sbjct: 232 ------LYFTESFPRIANINEDIANLTLTVGSAGKSF-AATGWRIGW--IISKNDQLLNY 282

Query: 339 VLKLASISICSVVTGQALMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTS 398
           V K A   IC   +   L +        G   + L  +   K++++   + + L   F  
Sbjct: 283 VSK-AHTRIC-FASPSPLQEACA-----GSIEHALKIDYFPKMREEYRKKFEILTTAFDK 335

Query: 399 LEGVECQRPQGAMYL---FPKLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSG 455
           L G+   +P+G  ++   F K+ +P+  +     LE   D      L++  GI  +P + 
Sbjct: 336 L-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTE 394

Query: 456 F 456
           F
Sbjct: 395 F 395

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 145 KQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL 204
           K+L + N +  TG     +  L+ +L SG E  V++  P +  Y   + L     +   +
Sbjct: 111 KELKAENVVVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPI 168

Query: 205 ---KEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISA 260
              KE    +T  +E  I+ ++   A   K  A++I  P NP G + +  +L  +  I  
Sbjct: 169 NPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPNNPIGKVFTHDELTTLGNICV 228

Query: 261 KYGIAIIADEVYQENIF 277
           K+ + II+DEVY+   F
Sbjct: 229 KHNVVIISDEVYEHLYF 245

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 120/298 (40%), Gaps = 59/298 (19%)

Query: 145 KQLASPNDIFLTGGASSAVHY-LLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYY 203
           K+   P +I +T GA+  +   L+S+L  G E  VL P     +Y   +       +P  
Sbjct: 94  KKQLKPENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLT 153

Query: 204 ----LKEH----TSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADI 255
               LK      + W+ +  +    I E      K  A++I +P NPTG + +  +L  +
Sbjct: 154 PPKDLKTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTL 207

Query: 256 IRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGF 315
             I  +  + II+DEVY+   F                     T + V+LASL       
Sbjct: 208 GNICVEKNVYIISDEVYENLYF---------------------TPECVKLASLSPEISNI 246

Query: 316 IGECGQRGGYMELIGFKDEVI----AIVLKLAS---ISICSVVTGQALMDLVTCPPQPGD 368
               G  G    + G++   I      +LKLAS   I IC              PPQ   
Sbjct: 247 TLTIGSAGKIFAVTGWRIGWIISENVELLKLASSAHIKICFSSPS---------PPQLAC 297

Query: 369 A---SYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYL---FPKLILP 420
           A      L+ +  +++++D + + + L  +F  L G+    P+G+ ++   F KL +P
Sbjct: 298 AHAIDIALNSDYFDRMRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 131/337 (38%), Gaps = 50/337 (14%)

Query: 118 VGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFG 177
           V  YS ++G L    ++  F       K  A+   +F TG   +    L+ +L  G E  
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVF-TGANEAIFSILIGLLNPGDE-- 132

Query: 178 VLIPIPQYPLYTATLTLSNSTAIPYYL-----KEHTSWSTNTKEIEINIKE-SMANGVKP 231
           V++  P +  Y   + LS    +  Y+     K   +  T  +E +I+      A   K 
Sbjct: 133 VIVFEPFFDQYIPNIELSGGKVV--YVPITPPKNLDTRVTKGEEWQIDWDSLQAAMNSKT 190

Query: 232 VAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLN 291
            AI+I  P NP G + +E +L  +  I  K  + II+DEVY+        F      +  
Sbjct: 191 KAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEH-----LYFKDSFTRIAT 245

Query: 292 LQSEFPGTYDNVQLA-SLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSV 350
           L  E        QL  ++ S  K F    G R G+   +    E+++   K A   IC  
Sbjct: 246 LSPEIG------QLTLTVGSAGKSF-AATGWRIGWA--LSLNQELLSYAAK-AHTRIC-- 293

Query: 351 VTGQALMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSL---EGVECQRP 407
                     +  P     +   +  E+ +  ++   +  R Y +FT++    G+    P
Sbjct: 294 --------FASPSPLQEAVANAFNDAEKVEYFKETRLQYIRKYEIFTNVLNELGLPYTEP 345

Query: 408 QGAMYLFPKLILPDKAIEKALQLEIPPDEYYCRELLD 444
           +G  ++               +++IPPD  Y  ELL+
Sbjct: 346 EGTYFILVNFS----------KVKIPPDYKYPEELLN 372

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 130/304 (42%), Gaps = 41/304 (13%)

Query: 147 LASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL-- 204
           L + N    TG     +  L+ +L SG E  V++  P +  Y   + L     +   +  
Sbjct: 129 LRAENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINP 186

Query: 205 -KEHTSWSTNTKEIEINIKESMANGV--KPVAIVIINPGNPTGAILSESDLADIIRISAK 261
            KE    +T  +E  I+  E   N +  K  A++I  P NP G + +  +L  +  I  K
Sbjct: 187 PKELDQRNTKGEEWTIDF-EQFENAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVK 245

Query: 262 YGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLA-SLHSTSKGFIGECG 320
           + + II+DEVY E++F    F      +  L  E        QL  ++ S  K F    G
Sbjct: 246 HNVVIISDEVY-EHLF----FTDSFTRIATLSPEIG------QLTLTVGSAGKSF-AATG 293

Query: 321 QRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPGDASYKLDQEERNK 380
            R G++  +    E+++   K A   IC   +   L +   C     DA  K+D  E  K
Sbjct: 294 WRIGWV--LSLNAELLSYAAK-AHTRIC-FASPSPLQE--ACANSINDA-LKIDYFE--K 344

Query: 381 IKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKALQLEIPPDEYYCR 440
           ++Q+ + +      +F  L G+    P+G  +     +L D +     +++IP D  Y +
Sbjct: 345 MRQEYITKFKIFTSIFDKL-GLPYTAPEGTYF-----VLVDFS-----KVKIPEDYPYPK 393

Query: 441 ELLD 444
           E+LD
Sbjct: 394 EILD 397

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 72/163 (44%), Gaps = 11/163 (6%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS ++G     + +AD      G +QL++ N    TG   +    L+ +L  G E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYG-QQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 181 PIPQYPLYTATLTLSNSTAI------PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAI 234
             P +  Y + + L+           P  L +  +  T   EI+ +I E   N  +   +
Sbjct: 134 FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEW-EIDWDILEKTINS-RTKCV 191

Query: 235 VIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIF 277
           +I  P NP G + +  +L  + +I     I II+DEVY+   F
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 146 QLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLK 205
           QL + N + +T GA  A ++L+    +GP   ++   P Y   ++  ++  +     +L+
Sbjct: 78  QLTADN-VLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLE 135

Query: 206 EHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIA 265
               ++ N ++++  ++ +         IV+ NP NP G+++S   + +II  + +  I 
Sbjct: 136 AEDGYTPNIQKLKSKVRANTK------YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIF 189

Query: 266 IIADEVY 272
           I+ DEVY
Sbjct: 190 IVCDEVY 196

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 77/186 (41%), Gaps = 23/186 (12%)

Query: 103 VIERARKMLDSIGGSVGAYSASQGVLGFRQTVADFINKRDG---CKQLASPNDIFLTGGA 159
           V+E A+K LD     V  YS ++G    R ++ + + K+       QL + N    TG  
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKG----RMSLINSLIKQYSPLYNTQLQANNIQVTTGAN 124

Query: 160 SSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL--------KEHTSWS 211
              +  L+ +L  G E  V  P     +    +     T +P +          E T W+
Sbjct: 125 EGILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWT 184

Query: 212 TNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEV 271
            +  E+   I        K  A+++  P NP G + +  +L  I +I  +  + II+DEV
Sbjct: 185 VDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEV 238

Query: 272 YQENIF 277
           Y+   F
Sbjct: 239 YEHLYF 244

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 114/259 (44%), Gaps = 40/259 (15%)

Query: 149 SPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPY-YLKEH 207
           S +++ L  G+  ++  L+   C   +  +LI  P Y +Y+    +++   I    + E 
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 208 TSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAII 267
            S+  NT ++   I+    +    +A V  +PGNPTGA++   D+A I +I +++   I+
Sbjct: 146 NSFQMNTDKV---IETLQGDSNIKIAFVT-SPGNPTGALI---DIASIEKILSQWQSGIV 198

Query: 268 A-DEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGECGQRGGYM 326
           A DE Y        +F S       L +++P       LA L + SK F G  G R G  
Sbjct: 199 AIDEAY-------IDFCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVRLG-- 242

Query: 327 ELIGFKDEVIAIVLKL--ASISICSVVTGQALMDLVTCPPQPGDASYKLDQEERNKIKQD 384
             + F  + ++ VL    A  +I S+ +   L  L +   Q    + +   EER      
Sbjct: 243 --VTFTSKDLSRVLNAMKAPYNISSMASNLVLKALSSESVQTMKDNVQEIVEER------ 294

Query: 385 LMFRADRLYGLFTSLEGVE 403
                +R+    TS+E V+
Sbjct: 295 -----ERVLKALTSMENVQ 308

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 134/324 (41%), Gaps = 35/324 (10%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAI---PYYLKEHT 208
           D+  T G + A   +L I C+    G  I   Q+  ++++++ + +  +   P  L EH 
Sbjct: 134 DVLATIGNTGAWESVLRIFCNR---GDTILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 209 SWSTNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAII 267
              +  + I  N  E  A   KP  +  +  G NPTG+ LS     +I RI+ K+   II
Sbjct: 190 IIPSKLETILDNWTEGAA---KPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 268 ADEVYQENIFPGFE----------FHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIG 317
            DE Y       +E          +   ++ + NL+  F       ++  L S SK  + 
Sbjct: 247 EDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSK--VL 304

Query: 318 ECGQRGGYMELIGFKDEVIAIVLKLASISICSVV--TGQALMDLVTCPPQPGDASYKLDQ 375
             G R G+  ++G KD ++A +L L  ++I +    T   +   +    Q G   + +  
Sbjct: 305 APGTRFGW--IVGAKD-ILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQEGYLDWLIGL 361

Query: 376 EERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKALQLEIPPD 435
                 K+D     D LY     ++ ++   P   M+ F   I   K  E A +    P 
Sbjct: 362 RHEYTKKRDCCI--DALYKYLPQVDYIKINPPIAGMF-FTVNIDASKHPEFATKYGSDP- 417

Query: 436 EYYCRELLD---ATGICTVPGSGF 456
           E   + + D   A+G+  VPG+ F
Sbjct: 418 EKVEKAIFDRSIASGVLVVPGNWF 441

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 147/352 (41%), Gaps = 54/352 (15%)

Query: 104 IERARKMLDSIGGSVGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAV 163
           I+ A+K LD     V  YS ++G +     +        G  +L   N    TG     +
Sbjct: 74  IKEAQKALDI--PLVNQYSPTRGRVSLLNALIKQYTPIYGS-ELKQENVTITTGANEGIL 130

Query: 164 HYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAI------PYYL----KEHTSWSTN 213
             L+ +L +G E  V++  P +  Y + + L     +      P  L     E T W+ +
Sbjct: 131 SCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVD 188

Query: 214 TKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQ 273
            ++     K ++ +  K  A++I  P NP G + +  +L  I  I  +  + II+DEVY 
Sbjct: 189 MEQF----KNAITSKTK--AVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY- 241

Query: 274 ENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLA-SLHSTSKGFIGECGQRGGYMELIGFK 332
           E+++   EF      +  L  E        QL  ++ S  K F    G R G+  +I   
Sbjct: 242 EHLYFTDEFTR----IATLSPEIG------QLTLTVGSAGKTF-AATGWRIGW--VISLN 288

Query: 333 DEVIAIVLKLASISICSVVTGQALMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRL 392
            E++  V K A   IC   +   L +   C     DA   L+     K++Q+ + +    
Sbjct: 289 SELLQYVSK-AHTRIC-FASPSPLQE--ACANSINDA---LESNYFEKMRQEYIQKFKIF 341

Query: 393 YGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKALQLEIPPDEYYCRELLD 444
             +F  L G+   +P+G  +     +L D +     +++IP D  Y +E+L+
Sbjct: 342 TSVFEEL-GLPYTKPEGTYF-----VLADFS-----KVKIPEDYPYPKEILN 382

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 145 KQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL 204
           K L + N    TG     +  L+ +L +G E  V++  P +  Y + + L     +   +
Sbjct: 111 KDLTTENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPI 168

Query: 205 ---KEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISA 260
              KE    +T  +E  I+ ++   A   K  A++I  P NP G + +  +L  +  I  
Sbjct: 169 NPPKELDLRNTRGEEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICV 228

Query: 261 KYGIAIIADEVYQENIF 277
           K+ + II+DEVY+   F
Sbjct: 229 KHNVIIISDEVYEHLYF 245

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 208 TSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAII 267
           T W+ N  E+E  I        K  A+++  P NP G + +  +L  I  I  K+ + II
Sbjct: 181 TEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVII 234

Query: 268 ADEVYQENIF 277
           +DEVY+   F
Sbjct: 235 SDEVYEHLYF 244

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 87/374 (23%), Positives = 142/374 (37%), Gaps = 72/374 (19%)

Query: 104 IERARKMLDSIGGSVGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAV 163
           I  A+K +D     V  YS ++G +   +++    +      +L + N    TG     +
Sbjct: 72  ITEAKKAVDI--PLVNQYSPTRGRVSLLESLIKLYSPLYNA-ELKAENVTVTTGANEGIL 128

Query: 164 HYLLSILCSGPEFGVLIP-----IPQYPLYTATLT---LSNSTAIPYYLKEHTSWSTNTK 215
             L+ IL  G E  V  P     IP   L    +    ++    +   + + T W+ +  
Sbjct: 129 SCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDY- 187

Query: 216 EIEINIKESMANGV--KPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQ 273
                  E  AN +  K  A++I  P NP G + +  +L  I  I  K  + II+DEVY+
Sbjct: 188 -------EQFANAITDKTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYE 240

Query: 274 ENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLA-SLHSTSKGFIGECGQRGGYMELIGFK 332
                   F      +  L  E        QL  S+ S  K F    G R G+  ++   
Sbjct: 241 H-----LYFTDSFTRIATLSPEIG------QLTLSVGSAGKSF-AATGWRVGW--VVSLN 286

Query: 333 DEVIAIVLKLASISICSVVTGQALMDLVTCPPQPGDASYKLDQEERN---KIKQDLMFRA 389
            E+++ V K A   IC              P Q   A+   D  E N    ++Q+   + 
Sbjct: 287 PELLSYVSK-AHTRICFASPS---------PLQEAVANSINDALEINYFENMRQEYKHKY 336

Query: 390 DRLYGLFTSLEGVECQRPQGAMYL---FPKLILP----------DKA---------IEKA 427
           D    +F  L G+    P+G  ++   F K+ +P          +KA         I + 
Sbjct: 337 DIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLINEL 395

Query: 428 LQLEIPPDEYYCRE 441
             + IPP E+Y +E
Sbjct: 396 GVVAIPPTEFYIKE 409

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 14/164 (8%)

Query: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179
            Y A +G    R  VA   + ++        +++ +T GA  A ++L+S   +GP   V+
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKE---VKLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVI 109

Query: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINP 239
              P Y   ++   +  +      L     +  +  +++  IK +         IV+ NP
Sbjct: 110 CVDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNP 163

Query: 240 GNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFH 283
            NP G+++  + L +I  ++ K  I +I DEVY+    P F  H
Sbjct: 164 NNPLGSVIPTATLEEIAALARKNEIRVICDEVYR----PLFHSH 203

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 6/136 (4%)

Query: 146 QLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL- 204
           +L + N    TG     +  L+ +L +G E  V++  P +  Y   + L     +   + 
Sbjct: 112 ELKAENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPIN 169

Query: 205 --KEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAK 261
             KE    +T  +E  I+ ++   A   K  A++I  P NP G + +  +L  +  I  K
Sbjct: 170 PPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVK 229

Query: 262 YGIAIIADEVYQENIF 277
           + + II+DEVY+   F
Sbjct: 230 HNVVIISDEVYEHLYF 245

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 6/137 (4%)

Query: 145 KQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYL 204
           KQL   N +  TG     +  L+ I+  G E  V++  P +  Y   + L     +   +
Sbjct: 111 KQLTPENVLVTTGANEGILSCLMGIINPGDE--VIVFEPFFDQYIPNIELCGGKVVYVPI 168

Query: 205 ---KEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISA 260
              KE  +  T   E  ++  E + A   K  A++I  P NP G + +  +L  +  I  
Sbjct: 169 NPPKELDNRVTKGTEWTVDFDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 261 KYGIAIIADEVYQENIF 277
           +  + IIADEVY+   F
Sbjct: 229 ENNVIIIADEVYEHLYF 245

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/325 (20%), Positives = 127/325 (39%), Gaps = 51/325 (15%)

Query: 150 PNDIFLTGGASSAV-HYLLSILCSGPEFGVLIPIPQYPLYTATLTL--SNSTAIPYY--- 203
           P+++ +T GA+ A+   L+ +L  G E  V++  P +  Y + + +     T +P +   
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 204 -----LKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRI 258
                +   T W+ +  E+   I        K  A+++  P NP G + +  +L +I  I
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 259 SAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGE 318
             +  + II+DEVY+                L   SEF       ++A+L          
Sbjct: 230 CVENNVVIISDEVYEH---------------LYFTSEF------TRIATLSPEIGNLTLS 268

Query: 319 CGQRGGYMELIGFKDEVI----AIVLKLASISICSVVTGQALMDLVTCPPQPGDASYKLD 374
            G  G      G++   I    A +LK AS++   +           C      A   L 
Sbjct: 269 VGSAGKTFAATGWRIGWIVSQNAELLKYASMAHTRICFASPSPFQEACAKSIEIA---LQ 325

Query: 375 QEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYL---FPKLILPDKAIEKALQLE 431
                K++Q+ + + D    +F  L G+   +P+G  ++   F K+ +P+        L 
Sbjct: 326 NNYFEKMRQEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLS 384

Query: 432 IPPDEYYCRELLDATGICTVPGSGF 456
              D      L++  G+  +P + F
Sbjct: 385 KAKDFRISYWLINELGVVAIPPTEF 409

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 130 FRQTVADFINKRD---GCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYP 186
           F+  +A F N+ D   G + L   N + L  G+   +  L+   C      +L   P Y 
Sbjct: 62  FKTLLAGFRNRLDKTPGIEPLTEDN-LCLGVGSDECIDSLIRACCRPEVDKILTLPPTYS 120

Query: 187 LYTATLTLSNSTAIPY-YLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGA 245
           +Y+    +++   +    + E  S+  N  E+      ++ N  K   + I +PGNPTG 
Sbjct: 121 MYSVCANINDVEIVECPLITEDNSFQMNVPEV----LSTLKNDPKIKLLFITSPGNPTGK 176

Query: 246 ILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQL 305
           ++++ D+  I+  +   G+ ++ DE Y +        +SM K    L +++P       L
Sbjct: 177 LVNKKDIEFILE-NWTNGL-VVVDEAYIDFADAEGTTYSMAK----LVTKYP------NL 224

Query: 306 ASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVL 340
             L + SK F G  G R G    + F  E  + VL
Sbjct: 225 TVLQTLSKSF-GLAGIRLG----VTFASEEFSSVL 254

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 70/151 (46%), Gaps = 13/151 (8%)

Query: 128 LGFRQTVADFINKRDGCKQLASP----NDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           L  +  +A++ NK    K    P     +I L  G+  ++  L+ + C   +  ++I  P
Sbjct: 61  LELKNLMANYRNKHSSFKDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPP 120

Query: 184 QYPLYTATLTLSNSTAIPYYL-KEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
            Y +Y+    +++   +   L  E  S+  +T ++     E++A       I I +PGNP
Sbjct: 121 TYGMYSICADINDVGCVKVPLVAEDNSFQMDTSKV----LETLAQDPTIKLIFITSPGNP 176

Query: 243 TGAILSESDLADIIRISAKY-GIAIIADEVY 272
           T A++   D A+I ++   + G  ++ DE Y
Sbjct: 177 TAALI---DTAEIEKVLNNWTGGLVVVDEAY 204

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 23/168 (13%)

Query: 118 VGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFG 177
           V  YS ++G      ++    +   G K+L   N    TG     +  L+ +L +G E  
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYG-KELKQENITITTGANEGILSCLMGLLNAGDE-- 145

Query: 178 VLIPIPQYPLYTATLTLSNSTAI----------PYYLKEHTSWSTNTKEIEINIKESMAN 227
           V++  P +  Y + + L     +             + E T W+ +         E   N
Sbjct: 146 VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDF--------EQFRN 197

Query: 228 GVKPV--AIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQ 273
            + P   A+++ +P NP G + ++ +L  +  I  +  + II+DEVY+
Sbjct: 198 AITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE 245

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 33/186 (17%)

Query: 149 SPNDIFLTGGASSA---VHYLL-----SILCSGPEFGVLIPIPQYPLYTATLTLSNSTAI 200
           S +++ +T GA  A   ++Y L      ++C  P +  L  +P+  ++ A +TL      
Sbjct: 78  SADNVLVTNGAIGANFLLYYTLVGKGDHVICVHPTYSQLYSVPK--MFGAEVTLLE---- 131

Query: 201 PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISA 260
              L E  S+  N   ++  IK +         I+I NP NP G ++S+  L  I  +  
Sbjct: 132 ---LSEKDSFLPNLDTLKKAIKSNTK------LIIINNPNNPLGCVISDELLTSICELCK 182

Query: 261 KYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGECG 320
           +  + +  DEVY+        FHS+   +   +S     YDN  ++   S SK F    G
Sbjct: 183 EKNVYLHCDEVYRP------IFHSLPSGVTTPRSA-AQIYDNAVVSG--SMSKAF-SLAG 232

Query: 321 QRGGYM 326
            R G++
Sbjct: 233 IRLGWI 238

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 21/171 (12%)

Query: 118 VGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAV-HYLLSILCSGPEF 176
           V  YS ++G     +++ D  +     K    P ++ +T GA+  +   L+ IL    E 
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPL--YKLTLKPENVLVTTGANEGILACLMGILNQNDE- 140

Query: 177 GVLIPIPQYPLYTATLTLSNSTAI------PYYLKEH----TSWSTNTKEIEINIKESMA 226
            V++  P +  Y   + L     +      P  L +     T W+ + ++ E      + 
Sbjct: 141 -VIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFE----NVIT 195

Query: 227 NGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIF 277
           N  K  AI+I  P NP G + +  +L  I  I  K+ + II+DEVY    F
Sbjct: 196 NKTK--AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 68/145 (46%), Gaps = 29/145 (20%)

Query: 149 SPNDIFLTGGASSA---VHYLL-----SILCSGPEFGVLIPIPQYPLYTATLTLSNSTAI 200
           + +++ +T GA +A   ++Y L      ++C  P +  L  +P+  ++ A ++L      
Sbjct: 77  NKDNVLVTNGAIAANFLIYYTLVGPGDHVICVDPTYAQLYSVPK--MFGAEVSLLK---- 130

Query: 201 PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISA 260
              L++   +  N + ++  IK +         I+I NP NP G+ +S   L DI ++  
Sbjct: 131 ---LQKEDGFIPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCE 181

Query: 261 KYGIAIIADEVYQENIFPGFEFHSM 285
           +  I +  DEVY+        FHSM
Sbjct: 182 ENNIYLHCDEVYKP------IFHSM 200

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 117/293 (39%), Gaps = 49/293 (16%)

Query: 146 QLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLT--------LSNS 197
           QL + N +  TG   + +  L++++  G E  V+ P     ++   +         L+N 
Sbjct: 95  QLTNENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNP 154

Query: 198 TAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIR 257
                 + E   W  + + +     +      K   ++I NP NP G + +  +L ++  
Sbjct: 155 NQGKKRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMAT 208

Query: 258 ISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIG 317
           +    G  IIADEVY+   F  F  + + ++  NL           +  ++ S  K F  
Sbjct: 209 LCVNNGAYIIADEVYE---FLQFTPNPLSRI-SNLSEAIAQ-----KTITIGSAGKIF-R 258

Query: 318 ECGQRGGYM-----ELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPGDASYK 372
             G R G+M     EL+  K   + + +   S SI  V +G  +   + C        Y 
Sbjct: 259 VTGWRVGWMISKNRELVE-KVTAVHVRMGFCSPSISQVASGLGIQRALEC-------GYF 310

Query: 373 LDQEERNKIKQDLMFRA-DRLYGLFTSLEGVECQRPQGAMYL---FPKLILPD 421
           L        K  ++++A D L        GV   +PQGA ++   F K+ +P+
Sbjct: 311 LSMPNEFDRKFSIIYKALDYL--------GVSYTKPQGAHFIITDFSKVKIPE 355

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 92/204 (45%), Gaps = 26/204 (12%)

Query: 128 LGFRQTVADFINK----RDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           L F++ ++D+ NK    +D   +    +++ L  G+  ++  L+   C   +  +LI   
Sbjct: 61  LEFKKLLSDYRNKTSIFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPA 120

Query: 184 QYPLYTATLTLSNS--TAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
            Y +YT    +++     +P  L E   +  +    E  I E++ N      + I +PGN
Sbjct: 121 TYGMYTICSQVNDVEYVTVPLLLSEEDKFQID----EEKILETLQNDPSIKLVFITSPGN 176

Query: 242 PTGAILSESDLADIIRISAKYGIA-IIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           PTG  +   D+  I +I +++    ++ DE Y +     F   S +  L  L ++    Y
Sbjct: 177 PTGTFI---DVNRIEKILSQWQTGLVVVDEAYID-----FVEGSDKGSLAPLATK----Y 224

Query: 301 DNVQLASLHSTSKGFIGECGQRGG 324
           +N+  A L + SK F G  G R G
Sbjct: 225 ENI--AVLQTLSKSF-GLAGIRLG 245

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 62/149 (41%), Gaps = 28/149 (18%)

Query: 204 LKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYG 263
           + E T W  +   +   I E      K  A++I +P NP G + +  +L  +  I  + G
Sbjct: 192 VTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 264 IAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGE----C 319
           I II+DEVY+                L    EF       +  S H+ + G  G+     
Sbjct: 246 IYIISDEVYEH---------------LYFTDEFTRIATLSEEISQHTLTVGSAGKSFAAT 290

Query: 320 GQRGGYMELIGFKDEVIAIVLKLASISIC 348
           G R G+  +I    E++A+  K A + IC
Sbjct: 291 GWRIGW--VISRNKELLALASK-AHVRIC 316

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 31/203 (15%)

Query: 151 NDIFLTGGASSA---VHYLL-----SILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPY 202
           +DI LT GA  A     Y L      ++C  P +  L  +P+  ++ A + L        
Sbjct: 79  DDILLTNGAIGANFLAFYTLVGAGDHVICVEPTYSQLYSVPE--MFGAEVDLLT------ 130

Query: 203 YLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKY 262
            LK+   +  N + ++  IK    N  K   I+I NP NP G+++ +  L  I ++  + 
Sbjct: 131 -LKKEDDFLPNLQTLKSMIK----NNTK--LIIINNPNNPLGSVIKKDLLKQICKLCEEN 183

Query: 263 GIAIIADEVY-------QENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGF 315
            I + +DEVY       ++ + P        K +++       +   ++L  L S  K F
Sbjct: 184 DIYLHSDEVYRPIFHSLEDEMVPPSACELYSKAIVSGSMSKAYSVAGIRLGWLVSKDKQF 243

Query: 316 IGECGQRGGY-MELIGFKDEVIA 337
           + +   R  Y M  +   D+ IA
Sbjct: 244 LRDAASRRDYNMISVSMIDDQIA 266

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 112/261 (42%), Gaps = 29/261 (11%)

Query: 130 FRQTVADFINKRDGCKQL--ASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187
           F+   A + N +D    +   S  ++ L  G+   +  L+   C      +++  P Y +
Sbjct: 62  FKTLFAHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSM 121

Query: 188 YTATLTLSNSTAI--PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGA 245
           Y+    +++   +  P  +++++      + +E   K+ +        + I +PGNPTG 
Sbjct: 122 YSVCANINDVDVVNCPLIVEDNSFQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGK 176

Query: 246 ILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQL 305
           I++  D+  ++    K G+ ++ DE Y +  F  +     +K      ++    Y N  L
Sbjct: 177 IIAIKDIIYVLE-HWKNGL-VVVDEAYVD--FSTYFNEETKKTEYFSVAKLVTKYPN--L 230

Query: 306 ASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKL--ASISICSVVTGQALMDLVTCP 363
             L + SK F G  G R G    + F  E +A +L    A  +I S  +  A+  +    
Sbjct: 231 TVLQTLSKSF-GLAGIRLG----VTFASEELARILNAMKAPYNISSTTSNHAIKAV---- 281

Query: 364 PQPGDASYKLDQEERNKIKQD 384
            QP   S +L ++  N++ ++
Sbjct: 282 -QP--ESLRLMEDNANEVNKE 299

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 60/150 (40%), Gaps = 10/150 (6%)

Query: 129 GFRQTVAD---FINKRDGC--KQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           GF Q   D   F+ +  G   K   S  DI LT G ++     L + C+  +  +L    
Sbjct: 104 GFTQGHPDLLNFLKEHTGLIHKMNYSDWDIILTTGNTNGWESTLRVFCNKGDV-ILAEAH 162

Query: 184 QYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG-NP 242
            +    A+      T  P  + EH       +EI   +        KP  +  I  G NP
Sbjct: 163 SFSSSLASAEAQGITTFPIPIDEHGIIPEKLEEI---LDNWTPGAPKPKLLYTIPTGQNP 219

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVY 272
           TG  L++    +I RI+ K+   II DE Y
Sbjct: 220 TGTSLADERKVEIYRIACKHDFLIIEDEPY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 103/238 (43%), Gaps = 36/238 (15%)

Query: 128 LGFRQTVADFINKR-----DGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           L F+  +A++ N+      D C +  +  +I L  G+  ++  ++   C      +L+  
Sbjct: 60  LQFKTAIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLP 119

Query: 183 PQYPLYTATLTLSNSTAI--PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240
           P Y +Y+    +++   +  P   ++++    + K ++I     + N  +   + I +PG
Sbjct: 120 PTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDKVLDI-----LNNDQEIKLLFITSPG 174

Query: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300
           NPTGA +  + +  +++ +   G+ ++ DE Y +  F G              S  P   
Sbjct: 175 NPTGAQIETARIEKVLQ-NWDRGL-VVVDEAYVD--FCG-------------GSTAPLVT 217

Query: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKL--ASISICSVVTGQAL 356
               L +L + SK F G  G R G    + F  E +A +L    A  +I +V +  AL
Sbjct: 218 KYQNLVTLQTLSKSF-GLAGIRLG----MTFASEDLARILNAMKAPYNISAVTSDYAL 270

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 70/150 (46%), Gaps = 11/150 (7%)

Query: 128 LGFRQTVADFINKRDG-CKQLASP---NDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           L F+  +A+F N  +   K L  P    ++ L  G+  ++  ++   C   +  +L+  P
Sbjct: 60  LAFKTAMANFRNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPP 119

Query: 184 QYPLYTATLTLSNSTAIPYYL-KEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
            Y +Y+    +++   +   L     S+  NT E+   IK +  N      I I +PGNP
Sbjct: 120 TYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEV---IKTAQ-NDPSIKLIFITSPGNP 175

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVY 272
           TGA +  S +  I++ +   G+ ++ DE Y
Sbjct: 176 TGAKVETSRIEKILQ-NWDRGM-VVVDEAY 203

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 12/168 (7%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           YS ++G     +++ DF +     + L   N    TG     +  L+ +L  G E  V++
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYN-ETLNESNVTITTGANEGILASLVGLLNPGDE--VIV 144

Query: 181 PIPQYPLYTATLTLSNSTA------IPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAI 234
             P +  Y + + +            P  L E  +     K I+ +I     N  +   I
Sbjct: 145 FEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWK-IDFDILNKTINE-RTKCI 202

Query: 235 VIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEF 282
           ++  P NP G + +  +L  +  I  K  I II+DEVY E+++ G EF
Sbjct: 203 ILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEF 249

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 136/354 (38%), Gaps = 63/354 (17%)

Query: 120 AYSASQGVLGFRQTVADFINK------RDGCKQLASPNDIFLTGGASSAVHYLLSILCSG 173
            Y +++G L  R  + +F+N+      RD  K  + P  + LT GAS  V  +L +  + 
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDD-KARSKPEYLNLTSGASYGVLNIL-LQATL 107

Query: 174 PEFGV----LIPIPQYPL---------YTATLTLSNSTA--------IPYYLKEHTSW-- 210
           P  GV     I  P Y L         +   LT  +           +   LK   S   
Sbjct: 108 PHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDP 167

Query: 211 ---STNTKEIEINIKE-----SMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKY 262
              + N KE+ I IK       +    K V  VI    NP+G   +      +I ++ KY
Sbjct: 168 NPVNENGKELSI-IKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 263 GIAIIADEVYQ------ENIFPGFEFHSMRKVLLNLQSEF---PGTYDNVQLASLHSTSK 313
            + II D+VY        N    FE  +  K  +++  E      +Y N    ++ + S 
Sbjct: 227 DMLIITDDVYDLLNYSINNDPDKFELPTPIKRFVHIDRETNNDESSYGN----TVSNASF 282

Query: 314 GFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPGDASYKL 373
             I   G R GY E I   ++++A  L     ++      Q    +V      GDA   L
Sbjct: 283 SKIIAPGLRFGYHESI---NKLLATQLSAGGANVSGGTPSQLTSMIVGTLLTNGDAEKIL 339

Query: 374 DQEERNKIKQDLMFRADRLYGLFTSL--EGVECQRPQGAMYLFPKLILPDKAIE 425
               RN I Q    RAD +Y        +G E ++ +G  + + KL     A+E
Sbjct: 340 ----RNLI-QTYCERADAMYNAMIKYLPKGTEIRKTEGGYFNWMKLTESYNALE 388

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 29/215 (13%)

Query: 129 GFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLY 188
            +R   + F  K +G   ++  N I L  G+   V  L+   C      VL+  P Y +Y
Sbjct: 69  NYRNNTSAF--KSEGLAPISYKN-ICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMY 125

Query: 189 TATLTLSNSTAIPY-YLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247
           +    ++++  +    + E  S+  +      N+ E+++N      + I  PGNPTGA +
Sbjct: 126 SVFAMINDTEVVECPLITEDNSFDMDLD----NVLETLSNDDSIKLLFITTPGNPTGASI 181

Query: 248 SESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLAS 307
           S   +  ++  +   GI ++ DE Y        +F S       L +++P       L  
Sbjct: 182 STQKIEMLLN-NWSAGI-VVVDEAY-------IDFSSSDSA-APLVNKYP------NLVV 225

Query: 308 LHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKL 342
           + + SK F G  G R G    + F  E I+ VL +
Sbjct: 226 IQTLSKSF-GLAGVRLG----LTFASEDISKVLNV 255

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 15/164 (9%)

Query: 118 VGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFG 177
           V  YS ++G      ++    +   G ++L   N    TG     +  L+ IL  G E  
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYG-QELKDENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 178 VLIP-----IPQYPLYTATLT---LSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGV 229
           V  P     IP   L    +    ++    +   + E   W+ + +E+      + A   
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEEL------AKAFTS 204

Query: 230 KPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQ 273
           K  A+++  P NP G + ++ +L  I  +  +  + II+DEVY+
Sbjct: 205 KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYE 248

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 11/150 (7%)

Query: 125 QGVLG-FRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           +G+L  +R   + F  + +G   L + N I L  G+  ++  ++   CS  E  V++  P
Sbjct: 64  KGLLASYRNAASAF--REEGLAPLTAKN-ICLGVGSDESIDAIIRATCSPREQKVMLLPP 120

Query: 184 QYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVII-NPGNP 242
            Y +Y     +++      Y++     S N+ +I+ +      N  K + +V I +PGNP
Sbjct: 121 TYGMYKVCADINDVG----YVEVPLISSDNSFQIDEDRILEQLNLDKSIKVVFITSPGNP 176

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVY 272
           TGA +    +  ++R +   GI ++ DE Y
Sbjct: 177 TGACIEVGRVEKLLR-NWTAGI-VVVDEAY 204

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 77/174 (44%), Gaps = 21/174 (12%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLK-EHTSW 210
           ++ L  G+   +  L+   C   +  +LI  P Y +Y+    +++   +   L  E  S+
Sbjct: 89  NLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNSF 148

Query: 211 STNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADE 270
             +T+++     E++ N      + I +PGNPTGA++   ++  +  +S      ++ DE
Sbjct: 149 QMDTEKV----IETLQNDPSIKLVFITSPGNPTGALIKPENIEKL--LSQWQSGFVVVDE 202

Query: 271 VYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGECGQRGG 324
            Y        +F +    +  L +++P       LA L + SK F G  G R G
Sbjct: 203 AY-------IDFCTTGGSVAPLVNKYP------NLAVLQTLSKSF-GLAGIRLG 242

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 188 YTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247
           YT TL++       ++L +  S + N       +KE +  G + +A+ I +P NP   +L
Sbjct: 391 YTDTLSILRKFNHTHFLGQGDSQAMN------ELKEILHGGEQILAVFIESPSNP---LL 441

Query: 248 SESDLADIIRISAKYGIAIIADEV 271
              DL ++ R+S  YG  I+ DE 
Sbjct: 442 KMGDLVELKRLSDLYGFYIVIDET 465

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 81/199 (40%), Gaps = 30/199 (15%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNS---TAIPYYLKEHT 208
           DI  T G++      L I C+    G  + + +Y  Y++++  +++     IP  L    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNK---GDTVLLEEY-TYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 209 SWSTNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAII 267
                 +E+ IN  +   +   P  +  I  G NPTG  LS+S    I  ++ KY + II
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 268 ADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLASLHSTSKGFIGECGQRGGYME 327
            DE Y                 L +    P      Q AS   T   FIG  G+   ++E
Sbjct: 248 EDEPY---------------YFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGK--SFLE 290

Query: 328 LIGFKDEVIAIVLKLASIS 346
           L     +V   V++L S+S
Sbjct: 291 L-----DVEGRVVRLDSVS 304

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 219 INIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           IN ++      + V  ++    NPTGAI S S    ++ ++ KY I II+D+VY
Sbjct: 176 INAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 74/183 (40%), Gaps = 32/183 (17%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLAS----PNDIFLTGGASSAVHYLLSILCSGPEF 176
           Y +  G    R  +A+F NK       +S    P+ + LT GAS  +  +L +  + P  
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 177 G----VLIPIPQYPLYT-ATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKP 231
           G      I  P Y L   A L    +  I    ++         E ++ + E+ ANG + 
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 232 V----AIVIINP------------------GNPTGAILSESDLADIIRISAKYGIAIIAD 269
                ++ IIN                    NPTGAI S S    ++ ++ KY I II+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 270 EVY 272
           +VY
Sbjct: 228 DVY 230

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 67/177 (37%), Gaps = 25/177 (14%)

Query: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLL---SILCSGPEF 176
            Y + +G L  RQ V + IN+  G    + P  I LT GAS  +  +L   ++  +G   
Sbjct: 50  TYGSDEGALWVRQEVCNMINQI-GSDINSKPEYINLTSGASYGILNILLQTTLPHTGYTK 108

Query: 177 GVLIPIPQYPLYTATLTL----SNSTAIPY---------YLKEHTSW--------STNTK 215
              I  P Y L           S  TAI           YLKE   +          N+ 
Sbjct: 109 QAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNST 168

Query: 216 EIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           +I  N         K V   I    NP+G          +I+I+ KY + II D+VY
Sbjct: 169 DIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 21/174 (12%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180
           Y+A++G+        DFI+  +      +  D+ L  G S ++  +   LC   E  VL+
Sbjct: 126 YTATRGMPPLIDFCKDFISYVN--PPAYADWDLTLANGTSDSLFKIFETLCDQGE-AVLV 182

Query: 181 PIPQYPLYTATLTLSNSTA---IPYYLKEHTSWSTNTKEIEI-NIKESMANGV------- 229
                  +T   TLSN  A   +P  +K + S     + I+I ++ E + N V       
Sbjct: 183 E-----EFTFAPTLSNIRAAGGVPVPVKLNISADPQVQGIDIGHLTELLDNWVQGPYAHL 237

Query: 230 -KPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFE 281
            +P  +  I  G NPTG  LS      I  ++ K+   I+ D+ Y    FP ++
Sbjct: 238 SRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYGYLKFPQYD 291

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 79/173 (45%), Gaps = 16/173 (9%)

Query: 121 YSASQG---VLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFG 177
           Y+ S+G   +L F + +   IN+     ++ S  D+ L+GG++ ++  +   +C      
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETICDEST-T 160

Query: 178 VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEIN----IKESMANG----- 228
           VLI    +    + +  + +  +P  +K + +   +++ I+++    + ++ + G     
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVP--IKINLTLDRDSQGIDVDHLTQLLDNWSTGPYKHL 218

Query: 229 VKP-VAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGF 280
            KP V   I    NPTG  + +     I R++ K+   I+ D+ Y    FP F
Sbjct: 219 AKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGYLYFPPF 271

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 8/125 (6%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNS---TAIPYYLKEHT 208
           DI  T G++ A    L I C+    G  + + ++  Y++++  +++     IP  +    
Sbjct: 133 DIITTTGSTQAWDASLRIFCNK---GDTVLLEEF-TYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 209 SWSTNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAII 267
                 +E+  N  +       P  +  I  G NPTG  LSE     I R++ KY I I+
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 268 ADEVY 272
            D+ Y
Sbjct: 249 EDDPY 253

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 78/174 (44%), Gaps = 16/174 (9%)

Query: 121 YSASQGV---LGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFG 177
           Y+ ++G+   L F + +   IN+     +  S  D+ L+GG++ +++ +    C      
Sbjct: 150 YAETKGMPPLLQFTKDMVARINRPAFSDETDSNWDVILSGGSNDSMYKVFETFCDEST-T 208

Query: 178 VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEIN----IKESMANG----- 228
           V+I    +    + +  + +T +P  +K + S    T+ ++++    + E+ + G     
Sbjct: 209 VMIEEFTFTPAVSNVEATGATVVP--IKINLSADRETQSVDVDYLSQLLENWSTGPYRHL 266

Query: 229 VKP-VAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFE 281
            KP V   I    NPTG  + +     I  ++ ++   I+ D+ Y    FP F+
Sbjct: 267 NKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYLYFPPFD 320

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 120/279 (43%), Gaps = 40/279 (14%)

Query: 130 FRQTVADFINKRDGCKQL----ASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQY 185
           F++ +A + NK    +       +  +  L  G+  ++  ++   C   +  +L+  P Y
Sbjct: 62  FKKAMASYRNKTSVFRSYDLVPLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTY 121

Query: 186 PLYTATLTLSNSTAIPY-YLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244
            +Y+    +++   +    + E  S+  +  EI +NI   +AN      + I +PGNPTG
Sbjct: 122 SMYSVCANINDVDVVTCPLITEDNSFQIDATEI-LNI---LANDPLIKLVFITSPGNPTG 177

Query: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304
           A + E D  + +  +   G+ +I DE Y +  F G            L +++P       
Sbjct: 178 AKI-EIDRIEYLLKNWDQGL-VIVDEAYID--FSGGSTAP-------LVTKYP------N 220

Query: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364
           L +L + SK F G  G R G M +   K   I   +K A  +I +V +  AL  +     
Sbjct: 221 LVTLQTLSKSF-GLAGIRLG-MTIATKKLSKILNAMK-APYNISTVTSDMALKAV----- 272

Query: 365 QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVE 403
                ++ L++ E+N   Q L     RL    TSL+ V+
Sbjct: 273 ----QNHNLEKMEQN--AQILNKEKLRLLNALTSLKYVD 305

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWS 211
           D+  T G ++A    L + C+    G  I    Y  ++++L  + +  +  +      + 
Sbjct: 135 DVLATAGNTNAWESTLRVFCNR---GDTILAEAYS-FSSSLYAAEAQGVNVFPVPLDEFG 190

Query: 212 TNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADE 270
              +++E  +        KP  +  I  G NPTG+ LS+   A I RI+ K+   II DE
Sbjct: 191 IIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDE 250

Query: 271 VY 272
            Y
Sbjct: 251 PY 252

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 221 IKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEV 271
           +KE + +G + +A+ I  P NP   +L   DL ++ R+S  YG  II DE 
Sbjct: 425 LKEILHSGEQILAVFIEAPSNP---LLKMGDLIELKRLSDMYGFFIIVDET 472

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 60/139 (43%), Gaps = 13/139 (9%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWS 211
           ++ +  G+S A++ +  +LC      +L      P+  + + L  ++ +P  +K   S  
Sbjct: 123 NVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQGASVVP--VKMQLSAD 179

Query: 212 TNTKEIEINIKESMANGV---------KPVAIVIINPG-NPTGAILSESDLADIIRISAK 261
              + I+++    + +           KP A+  +  G NPTG  LS +    I  I+ K
Sbjct: 180 PEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQNPTGMTLSPTKRRRIYEIAQK 239

Query: 262 YGIAIIADEVYQENIFPGF 280
           +   I+ D+ Y    FP +
Sbjct: 240 HDFLIVEDDPYGYLFFPPY 258

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 128 LGFRQTVADFINKRDGCKQLASP----NDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183
           L F++ +A + N     K L+ P    +++ L  G+  ++  ++   C   +  +L   P
Sbjct: 60  LEFKRQMATYRNNSSSFKDLSLPPLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPP 119

Query: 184 QYPLYTATLTLSNSTAI--PYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241
            Y +Y+    +++   +  P   ++++    + K I I   + +        + + +PGN
Sbjct: 120 TYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK-----LVFLTSPGN 174

Query: 242 PTGAILSESDLADIIRISAKY-GIAIIADEVY 272
           PTGA +   D   II+I   + G  ++ DE Y
Sbjct: 175 PTGAKI---DSNIIIKILESWDGGFVVVDEAY 203

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 134/310 (43%), Gaps = 52/310 (16%)

Query: 130 FRQTVADFINKRDGCKQLA--SPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187
           F+  +A++ N+    K +   +  ++ L  G+  ++  ++   C   +  ++   P Y +
Sbjct: 62  FKTAMANYRNRTSSFKDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGM 121

Query: 188 YTATLTLSNSTAIPYYL-KEHTSWSTNTKEIEINIKESMANGVKPVA--IVIINPGNPTG 244
           Y+   ++++   +   L     S+  +T+ +   +K+       P+   + I +PGNPTG
Sbjct: 122 YSVCASVNDVEIVKCPLVTSDNSFQVDTEAVLDTLKKD------PLIKLVFITSPGNPTG 175

Query: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304
           A +  S +  I++ +   GI ++ DE Y +  F G            L +++P       
Sbjct: 176 AKIETSRIEKILQ-NWDQGI-LVVDEAYID--FCGGSTAP-------LVNKYP------N 218

Query: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLK--LASISICSVVTGQALMDLVTC 362
           + +L + SK F G  G R G    + F  +  A VL    A  +I S+ +  AL  +   
Sbjct: 219 ICTLQTLSKSF-GLAGIRVG----MTFTSKEFAKVLNSMKAPYNISSITSEYALKAV--- 270

Query: 363 PPQPGDASYKLDQEER--NKIKQDLMFRADRLYGLFTSLEGVECQRPQG--AMYLFPKLI 418
                DA   +++  +  NK KQ       RL    TSL+ V+ Q   G  + +L  ++ 
Sbjct: 271 ---EDDAFTAMEENAKAVNKEKQ-------RLLKSLTSLDFVDDQYVGGIDSNFLLLRIN 320

Query: 419 LPDKAIEKAL 428
             D  + KAL
Sbjct: 321 KGDNKLAKAL 330

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 229 VKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVY 272
            KP  +  I  G NPTG+ LS+    +I RI+ K+ + II DE Y
Sbjct: 208 AKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 27/126 (21%)

Query: 148 ASPNDIFLTGGASSAVHYLLSILCSGPEFG--VLIPIPQYPLYTATLTLSNSTAIPYYLK 205
           ASPN      G++S V Y       GP +   V+   P    YT TL++ +     ++L 
Sbjct: 353 ASPNQ-----GSASVVGY-------GPPYKKTVMFGFP----YTDTLSILSKFNHTHFLG 396

Query: 206 EHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIA 265
              S + +T      +KE + +G + +A+ +  P NP   +L   DL ++ R++  YG  
Sbjct: 397 MGDSTAMDT------LKEILHSGEQILAVFMETPSNP---LLKMGDLLELKRLADIYGFY 447

Query: 266 IIADEV 271
           ++ DE 
Sbjct: 448 VVVDET 453

>AAL154C Chr1 complement(74156..75007) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR022C
          Length = 283

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 16  QHAVHADYAVRGSIPM---RAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKPLTFIR 72
           Q  V  +   RG I +     +Q+H +I N+  +L     ++A   NP    + P T I 
Sbjct: 117 QEVVIKEILSRGEIQLSEKERQQMHGKITNELLTL-----VSAKCVNPNSKKRYPPTMIH 171

Query: 73  QVLSILEYPNILNDPELLEKLVQLGVY-QRDVIERAR 108
           + L+ L++  + N P  L+ L  + +  QR +I  AR
Sbjct: 172 KALAELKFNVVTNKPAKLQALEAIKLLVQRQIIPIAR 208

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 112/265 (42%), Gaps = 32/265 (12%)

Query: 128 LGFRQTVADFINK-----RDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182
           L F+  +  + NK      D   +    +++ L  G+  ++  ++   C   +  +L+  
Sbjct: 60  LDFKTAMTKYRNKTSSYSNDPTVKPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLP 119

Query: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242
           P Y +Y+    +++   +   L    +      E  + I   + N      I + +PGNP
Sbjct: 120 PTYSMYSVCANINDVEVVQCPLTVSDNSFQMDTEAALTI---LKNDPLIKLIFVTSPGNP 176

Query: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302
           TGA +    +  I++ + + G+ ++ DE Y +  F G            L +++P     
Sbjct: 177 TGAKIKTCLIEKILQ-NWENGL-VVVDEAYID--FCGGSTAP-------LVTKYP----- 220

Query: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKL--ASISICSVVTGQALMDLV 360
             L +L + SK F G  G R G    + +    +A +L    A  +I S+ +  AL  + 
Sbjct: 221 -NLVTLQTLSKSF-GLAGIRLG----MTYATSDLANILNAMKAPYNISSLASEYALKAVQ 274

Query: 361 TCPPQPGDASYKLDQEERNKIKQDL 385
               Q  +A+ KL  EE+ ++ +DL
Sbjct: 275 DSSLQKMEATSKLINEEKMRLLKDL 299

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 136/312 (43%), Gaps = 44/312 (14%)

Query: 126 GVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQY 185
            +  +R   + ++N  D   +  S +++ L  G+  ++  ++   C   +  +L+  P Y
Sbjct: 65  AMTAYRNETSSYLN--DPTVKPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTY 122

Query: 186 PLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVI-INPGNPTG 244
            +Y+    +++   +   L    + S N+ ++      ++ N    + I+   +PGNPTG
Sbjct: 123 SMYSVCANINDVEVVQCPL----TVSDNSFQMNTEAVLTILNNDPLIKIMFATSPGNPTG 178

Query: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304
           A +    + ++++     GI ++ DE Y +  F G            L +++P       
Sbjct: 179 AKIKTCLIEEVLQ-KWDNGI-VVVDEAYVD--FCGGSTAP-------LVTKYP------N 221

Query: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKL--ASISICSVVTGQALMDLVTC 362
           L +L + SK F G  G R G    + +    +A +L    A  +I S+ +  AL  +   
Sbjct: 222 LVTLQTLSKSF-GLAGIRLG----MTYATAELAKILNAMKAPYNISSLASEYALKAVQES 276

Query: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQG--AMYLFPKLILP 420
             +  +A+ K+  EE+ ++ ++L           TSL+ V+ Q   G  A +L  ++   
Sbjct: 277 NLRKMEATSKVINEEKMRLLKEL-----------TSLDYVDDQYVGGLDANFLLIRINGG 325

Query: 421 DKAIEKALQLEI 432
           D A+ K L  ++
Sbjct: 326 DNALAKKLYYQL 337

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 173 GPEFG--VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVK 230
           GP F   V+   P    YT TL++       ++L +  S S N       +K  + +G +
Sbjct: 334 GPPFKKTVMFGFP----YTDTLSILRKFNHTHFLGQGDSTSMNA------LKNILHSGEQ 383

Query: 231 PVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEV 271
            +A+ I  P NP   +L   DL ++ R+S  Y   I+ DE 
Sbjct: 384 ILAVFIEAPSNP---LLKMGDLQELKRLSDLYSFYIVVDET 421

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 86/220 (39%), Gaps = 41/220 (18%)

Query: 82  NILNDPEL----LEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQG---VLGFRQTV 134
           NI+N P+      EK   +G+Y+      AR            Y  S+G   V+ F +++
Sbjct: 62  NIVNKPQFGDVKTEK-ASIGLYEPKTFPMARSF---------QYMESKGPPAVINFAKSI 111

Query: 135 ADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTL 194
            + INK           D+ L  G+S  +  +   L       +L+    +         
Sbjct: 112 IERINKPKYDNW-----DLTLASGSSDGMFKIFETLLDENS-SILMEEFTFTPAAFVAIA 165

Query: 195 SNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGV------------KPVAIVIINPG-N 241
           + ++ IP  +K     S N  E  I+I + MAN +            KP  +  I  G N
Sbjct: 166 TGASCIPLKMK----LSENAAEQGIDI-DYMANLLDNWETSQFKDKPKPKMLYTIATGQN 220

Query: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFE 281
           PTG  LS      I  I  K+ I I+ D+ Y   +FP ++
Sbjct: 221 PTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFPKYD 260

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 64/141 (45%), Gaps = 17/141 (12%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWS 211
           D+ L  G+S ++  L   L +     VL+    +    + +T + ++ +P  L    +++
Sbjct: 141 DLLLANGSSDSMFKLFDTL-TDETTTVLVEEFTFSPVLSNITATGASCVPLQL----NFT 195

Query: 212 TNTKEIEINIK------ESMANG-----VKPVAIVIINPG-NPTGAILSESDLADIIRIS 259
           +N     IN+       E+  +G      +P  +  I+ G NPTG  +S  + A I +++
Sbjct: 196 SNPSNQGINVTYLQHLLENWQSGPYKHLNRPSILYTISTGQNPTGLTISMENRARIYKLA 255

Query: 260 AKYGIAIIADEVYQENIFPGF 280
            KY   I+ D+ Y    +P +
Sbjct: 256 QKYNFLIVEDDPYSYMSYPTY 276

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 13/98 (13%)

Query: 235 VIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVY---QENIF-------PG--FEF 282
            I N  NPTG  L E    +++R++++Y   II D+ Y   Q N F       PG   E 
Sbjct: 210 TIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEM 269

Query: 283 HSMRKVLLNLQSEFPGTYDNV-QLASLHSTSKGFIGEC 319
              ++  +N        +D+V ++  L S SK F   C
Sbjct: 270 QWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGC 307

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 230 KPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           KP  +  I  G NPTG+ LS+    +I RI+ K+   II DE Y
Sbjct: 209 KPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 121 YSASQGVLGFRQTVADFINKRDGCKQL-ASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179
           YS +QG+      +  FI K +       +  DI L  G+S ++  +   LC      ++
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLM 196

Query: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEI--NI------KESMANGVKP 231
                 P+ +  +  + +  IP  LK + ++     +IE   N+      K +  +  KP
Sbjct: 197 EEFTFVPVISNVMA-TGAKCIP--LKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 232 VAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGF 280
             +  I+ G NP G  LS      I  I+ ++ + I+ D+ Y    FP +
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFPKY 303

>TPHA0K01360 Chr11 complement(283543..284961) [1419 bp, 472 aa] {ON}
           Anc_4.155 YGR019W
          Length = 472

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 20/112 (17%)

Query: 168 SILCSGPEFGVLIPI-----PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTK-EIEINI 221
           S+ CS P   + +P        YP+Y             Y L+++  ++     E  +N+
Sbjct: 197 SVTCSKPIHKLDLPAFNWPHAPYPVYK------------YPLEDNQEFNKKVDDECVLNV 244

Query: 222 KESMANGVKPVAIVIINPGNPTGAILSESDL--ADIIRISAKYGIAIIADEV 271
           +E +     PVA +II P    G     S L  A   RI+ KYGI  I DEV
Sbjct: 245 EEIIKTWYCPVAALIIEPIQSEGGDNHASALFFAVFERITLKYGIVYIIDEV 296

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%)

Query: 230 KPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           K V   I    NPTG   S      +I I+ KY + IIAD+VY
Sbjct: 191 KYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 8/125 (6%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNS---TAIPYYLKEHT 208
           DI  T G++      L I C+    G  + +  Y  Y++++  +++     +P  L    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNK---GDTVLLEDY-TYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 209 SWSTNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAII 267
              +  +E+  N          P  +  I  G NPTG  LS++    I R++ +Y I II
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 268 ADEVY 272
            D+ Y
Sbjct: 248 EDDPY 252

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 11/125 (8%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAI---PYYLKEHT 208
           D+  T G ++A    L + C     G +I + +   +++ L  + +  I   P  + EH 
Sbjct: 132 DVVATTGNTNAWESTLRVFCDK---GDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 209 SWSTNTKEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAII 267
                 ++I  N  E      KP  +  I  G NPTG+ LS+     I +++ K+   II
Sbjct: 188 IIPEKLEQILDNWTEGAP---KPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 268 ADEVY 272
            DE Y
Sbjct: 245 EDEPY 249

>Suva_2.312 Chr2 (553989..557858) [3870 bp, 1289 aa] {ON} YDR150W
           (REAL)
          Length = 1289

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%)

Query: 221 IKESMANGVKPVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQE 274
           +K+S  N V   A   +   +   ++ S  D+ D+ R + K+G+++I+DE ++E
Sbjct: 687 MKDSSMNLVNKEAPSFVRDNDDEISVASSIDIEDLSRKAEKWGMSLISDEEFKE 740

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 57/140 (40%), Gaps = 13/140 (9%)

Query: 152 DIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWS 211
           D+ L  G+S ++  +   LC     GV + + ++        ++ S      +K   +  
Sbjct: 161 DVLLANGSSDSLFKIFETLCDE---GVTVLMEEFTFSPTIFNVTASGGKVVPIKVEITHD 217

Query: 212 TNTKEIEI----NIKESMANG-----VKPVAIVIINPG-NPTGAILSESDLADIIRISAK 261
             T+ I++    ++ E+   G      KP  +  I  G NPTG  LS      I  ++  
Sbjct: 218 PETQGIDVQYLCDLLENWEVGPYKHLSKPRVLYTIATGQNPTGMTLSPEKRKAIYELAET 277

Query: 262 YGIAIIADEVYQENIFPGFE 281
           +   I+ D+ Y    FP ++
Sbjct: 278 HNFIIVEDDPYGYLKFPAYD 297

>NCAS0A05930 Chr1 complement(1165589..1171333) [5745 bp, 1914 aa]
           {ON} Anc_4.50 YLR305C
          Length = 1914

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 61/132 (46%), Gaps = 16/132 (12%)

Query: 27  GSIPMRAEQLHAQI-INDPGSLPFDKIITANIGNPQQV-GQKPLTFIRQVLSILEYPNIL 84
            S+  RA +  A++ +N+ G  P  + ++A       + G  P+++   +  +   P  L
Sbjct: 11  SSLRARALKKLAELSLNNKGQQPLQRDVSAKDHTLDLILGSLPISYSTNISKLYTIPLTL 70

Query: 85  NDPELLEKLVQL--GVYQRDVIERARKMLDSIGGSVGAYSASQGVLGFRQTVADFINKRD 142
           N+ ELL  + Q+  G +       A+K+LD +   +  Y         RQ ++D ++ + 
Sbjct: 71  NEWELLTAVCQVIPGSFT-----SAKKLLDEL---ISPYFLDSP----RQRISDVLSAKF 118

Query: 143 GCKQLASPNDIF 154
              QL SPN++ 
Sbjct: 119 KLDQLKSPNELL 130

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 15/101 (14%)

Query: 173 GPEFG--VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVK 230
           GP F   V+   P    YT TL++       ++L +  S S +       +K+ + +G +
Sbjct: 335 GPPFKKTVMFGFP----YTDTLSILRKFNHTHFLGQGDSTSMDA------LKKILHSGEQ 384

Query: 231 PVAIVIINPGNPTGAILSESDLADIIRISAKYGIAIIADEV 271
            +A+ I  P NP   +L   DL ++ R+S  Y   I+ DE 
Sbjct: 385 ILAVFIEAPSNP---LLKMGDLQELKRLSDLYSFYIVVDET 422

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 215 KEIEINIKESMANGVKPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           +++E  + E      +P  +  I  G NPTG  L++    +I RI+ K+   II DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>Ecym_7108 Chr7 complement(209729..210580) [852 bp, 283 aa] {ON}
           similar to Ashbya gossypii AAL154C
          Length = 283

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 15  NQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKPLTFIRQV 74
           +Q A+ A+   RG IP+  ++   Q++ +  +     +++A   NP+   + P T I + 
Sbjct: 109 DQTAIIAEILNRGEIPLSEKE--RQLMLEKLTNEILTMVSAKCINPKSKKRYPPTMINKA 166

Query: 75  LSILEYPNILNDPELLEKLVQLGV 98
           L+ L++  ++N P  L+ L  + V
Sbjct: 167 LTELKFGIVVNKPAKLQALEAIKV 190

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 13/93 (13%)

Query: 178 VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVII 237
           V++ +P +  Y    TLS S  IP           N  +    +KE + +G + +A++  
Sbjct: 348 VVLGVPCHDTYEMVTTLSKSYFIP----------ENGTDGLSKLKEILHSGEQILAVIT- 396

Query: 238 NPGNPTGAILSESDLADIIRISAKYGIAIIADE 270
               PT  +L  ++L ++ ++S  +G  I+ DE
Sbjct: 397 --ETPTNGLLDVTNLVELKQLSELFGFYIVVDE 427

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 230 KPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           KP  +  I  G NPTG+ LS+     I +I+ K+   II DE Y
Sbjct: 206 KPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 230 KPVAIVIINPG-NPTGAILSESDLADIIRISAKYGIAIIADEVY 272
           KP  +  I  G NPTG+ L+     +I RI+ K+   II DE Y
Sbjct: 206 KPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,183,697
Number of extensions: 2234537
Number of successful extensions: 5229
Number of sequences better than 10.0: 123
Number of HSP's gapped: 5262
Number of HSP's successfully gapped: 123
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)