Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.388.262ON44242821800.0
TDEL0F038908.262ON4763937383e-92
KAFR0B055408.262ON5193726986e-86
SAKL0H17028g8.262ON5503656833e-83
Ecym_43088.262ON5293966727e-82
NDAI0J013808.262ON6243956771e-81
ZYRO0C01650g8.262ON5863616489e-78
AGR086C8.262ON5343696343e-76
NCAS0B038508.262ON5883636366e-76
Smik_4.3568.262ON5763786278e-75
YDR110W (FOB1)8.262ON5663636111e-72
Kwal_56.237998.262ON4883765956e-71
Skud_4.3718.262ON5803635982e-70
Suva_2.2708.262ON6323635924e-69
KLTH0G13684g8.262ON5083765758e-68
Kpol_392.68.262ON4573615656e-67
CAGL0B01771g8.262ON5363565523e-64
KLLA0F19140g8.262ON5273765436e-63
KNAG0H032408.262ON5194055079e-58
TPHA0J007408.262ON4083464675e-53
TPHA0A018108.262ON4574254392e-48
TBLA0E044308.262ON4813184131e-44
TBLA0F030708.262ON4453733934e-42
NCAS0A06040na 1ON588125930.008
Skud_12.300singletonON39853820.16
Smik_49.2singletonON550125820.17
SAKL0F06809g2singletonON175553810.26
SAKL0B11583g2singletonON175551800.34
SAKL0C11913g1singletonON175551800.35
Kwal_39.16423singletonON7445710.50
Kwal_23.3713singletonON7845700.64
KNAG0C06675singletonON282107760.68
KNAG0G02840singletonON414107760.77
Kwal_47.17033singletonON11766710.86
SAKL0G17886g4.343ON104676751.2
ZYRO0C17270g3.401ON228792751.3
NDAI0G00550singletonON41248741.4
NDAI0B06160singletonON140348751.5
NDAI0D03010na 1ON778136741.7
Kwal_50.19418singletonON34866722.1
Kwal_55.19799singletonON35466722.4
Kwal_26.7891singletonON31066712.5
Kwal_60.24910singletonON52498722.5
Kwal_2.424singletonON23966712.6
Kwal_33.15089singletonON47866722.6
Kwal_54.19470singletonON54266722.9
Kwal_27.12438singletonON64166722.9
Kwal_14.764singletonON35866713.1
Kwal_39.16409singletonON73466713.4
Kwal_36.16338singletonON60466713.7
NDAI0D03060singletonON130349713.8
Kwal_1.407singletonON18677693.9
Kwal_47.17665singletonON62566713.9
YNL054W-BsingletonOFF174947714.0
Kwal_27.11219singletonON74466714.1
Kwal_13.691singletonON86566714.2
NDAI0D00680singletonON23449694.3
SAKL0G10912g5.277ON33752694.6
Kwal_9.616singletonON34745695.9
SAKL0A02134g6.308ON89369687.7
Ecym_15148.28ON1298129688.2
KAFR0B06620singletonON1185108688.5
KAFR0F001502.16ON57361688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.38
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   844   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   288   3e-92
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   273   6e-86
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   267   3e-83
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   263   7e-82
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   265   1e-81
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   254   9e-78
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   248   3e-76
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   249   6e-76
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   246   8e-75
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   239   1e-72
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   233   6e-71
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   234   2e-70
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   232   4e-69
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   226   8e-68
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   222   6e-67
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   217   3e-64
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   213   6e-63
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   199   9e-58
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   184   5e-53
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   173   2e-48
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   163   1e-44
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   155   4e-42
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    40   0.008
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...    36   0.16 
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    36   0.17 
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    36   0.26 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    35   0.34 
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    35   0.35 
Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B ...    32   0.50 
Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A...    32   0.64 
KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {...    34   0.68 
KNAG0G02840 Chr7 (628866..630110) [1245 bp, 414 aa] {ON}               34   0.77 
Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {O...    32   0.86 
SAKL0G17886g Chr7 (1548370..1551510) [3141 bp, 1046 aa] {ON} sim...    33   1.2  
ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON} sim...    33   1.3  
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    33   1.4  
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            33   1.5  
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    33   1.7  
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...    32   2.1  
Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {...    32   2.4  
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    32   2.5  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    32   2.5  
Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB...    32   2.6  
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    32   2.6  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    32   2.9  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    32   2.9  
Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A ...    32   3.1  
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    32   3.4  
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    32   3.7  
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              32   3.8  
Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB G...    31   3.9  
Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {...    32   3.9  
YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 a...    32   4.0  
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    32   4.1  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    32   4.2  
NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON}                31   4.3  
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    31   4.6  
Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB...    31   5.9  
SAKL0A02134g Chr1 (195606..198287) [2682 bp, 893 aa] {ON} simila...    31   7.7  
Ecym_1514 Chr1 complement(1060426..1064322) [3897 bp, 1298 aa] {...    31   8.2  
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    31   8.5  
KAFR0F00150 Chr6 complement(46123..47844) [1722 bp, 573 aa] {ON}...    31   8.7  

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/428 (96%), Positives = 414/428 (96%)

Query: 15  VPSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKE 74
           VPSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKE
Sbjct: 15  VPSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKE 74

Query: 75  YLDSIIGTLSQTVYELIRDDLLDVDTLSEKTRWSRINANAXXXXXXXXXXXXXXGTVIDL 134
           YLDSIIGTLSQTVYELIRDDLLDVDTLSEKTRWSRINANA              GTVIDL
Sbjct: 75  YLDSIIGTLSQTVYELIRDDLLDVDTLSEKTRWSRINANAKCLYLKRRYKLTKKGTVIDL 134

Query: 135 TRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNP 194
           TRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNP
Sbjct: 135 TRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNP 194

Query: 195 DKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYP 254
           DKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYP
Sbjct: 195 DKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYP 254

Query: 255 LKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPS 314
           LKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPS
Sbjct: 255 LKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPS 314

Query: 315 SFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSA 374
           SFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSA
Sbjct: 315 SFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSA 374

Query: 375 TTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNMENGDDTFLEYDDTF 434
           TTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNMENGDDTFLEYDDTF
Sbjct: 375 TTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNMENGDDTFLEYDDTF 434

Query: 435 IEGSTNFE 442
           IEGSTNFE
Sbjct: 435 IEGSTNFE 442

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  288 bits (738), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 150/393 (38%), Positives = 235/393 (59%), Gaps = 6/393 (1%)

Query: 19  NQVIDDTLAPISEFKEVNRYGKV--VFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYL 76
           N + D+  +   E K ++ Y  V   F  P +G +  EY +S  ++  LE G     +Y 
Sbjct: 13  NVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQ 72

Query: 77  DSIIGTLSQTVYELIRDDLLDVDTLSEKT-RWSRINANAXXXXXXXXXXXXXXGTVIDLT 135
           +SI G +   +YELIR + L  +TL+  + +W + +A +              G V D  
Sbjct: 73  ESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRR 131

Query: 136 RENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPD 195
           + +KIV EP   +D I+  H++N H+ Y+ I+  L  IYSN++RD+++M + +CS CNPD
Sbjct: 132 KGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPD 191

Query: 196 KVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPL 255
                LEK  H NI++  LPLERV ++IFE F+NE I N++++++Y RDY +RFVW+ PL
Sbjct: 192 GHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPL 251

Query: 256 KNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSS 315
           KNTKFK L S +G LLL +  +PI+++++T++++D+  IC+++  KY + LG+G    S 
Sbjct: 252 KNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQ 311

Query: 316 FYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSAT 375
           F+  G+ R+K LLN  K  C+ DWNMCL+ G Y+ N++  T A G+P++L       +  
Sbjct: 312 FHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRK 371

Query: 376 TFESKRTEIINSLPIQNSYKTSTNKGLVYAQDE 408
            F  K+  II+ LP QN      NKGL+Y +DE
Sbjct: 372 HFRPKQEMIIDELPAQNV--VHVNKGLLYLEDE 402

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  273 bits (698), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 141/372 (37%), Positives = 219/372 (58%), Gaps = 2/372 (0%)

Query: 15  VPSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKE 74
            P  N +  D  + + E  E N   K  +  P++G +   Y DS  ++  L+ G     +
Sbjct: 20  APVHNMIERDFASELIEAPE-NIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFK 78

Query: 75  YLDSIIGTLSQTVYELIRDDLLDVDTL-SEKTRWSRINANAXXXXXXXXXXXXXXGTVID 133
           +  SI G L++  Y+LIR D L  +TL S   +W++I A                G + D
Sbjct: 79  FQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHD 138

Query: 134 LTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCN 193
             R++KIV EP   +D I+  H++N H   + IH  L   YSN++RD     L FCS CN
Sbjct: 139 HLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCN 198

Query: 194 PDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIY 253
           P++ I  LEK  H NIY + +PLERV ++IFEPF NEKI+ +YSHI+Y RDY SR++W+ 
Sbjct: 199 PEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWML 258

Query: 254 PLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEP 313
           PLKNTKFK L   +  L L   R PI+I+T +++ +DM  IC++IA +Y++ +G+GT +P
Sbjct: 259 PLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKP 318

Query: 314 SSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECS 373
           ++F++ G+ ++K  L  ++++CL  WN+CLK GSY +N +    A GVP +L   +++  
Sbjct: 319 NTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQEC 378

Query: 374 ATTFESKRTEII 385
           +  F+ K  +I+
Sbjct: 379 SLKFKEKIIQIL 390

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  267 bits (683), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 215/365 (58%), Gaps = 3/365 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105
           PK+G +   Y  +  +V  LE G     +YL+S+ G L+Q  YELI+ D L ++TL   T
Sbjct: 29  PKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVT 87

Query: 106 -RWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
                 NA A                V D  R++ IV EP+L Y+ I+S H+LN HL ++
Sbjct: 88  DGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWR 147

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
            +H+ LK+ YSN++RD+++M   +CS CNP + +    K  H N Y+  LPLER+ ++IF
Sbjct: 148 KLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIF 207

Query: 225 EPF-ENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDT 283
           +PF  +E I+ +YSH++Y RDY SRFVW+ PL    F+ L  ++   LL LPR+PI+++T
Sbjct: 208 KPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLET 267

Query: 284 TTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCL 343
           TT++R+DM  +C+ IA KY++++G+G    S FY  G+ R+K LL  NK KC KDW MCL
Sbjct: 268 TTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCL 327

Query: 344 KLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLV 403
           K GSY+ N        G  ++L  +E+      F+ KR +II+ L   N        G+V
Sbjct: 328 KYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGGMV 387

Query: 404 YAQDE 408
           Y ++E
Sbjct: 388 YVENE 392

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  263 bits (672), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 225/396 (56%), Gaps = 7/396 (1%)

Query: 16  PSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEY 75
           P   QV  D       F+++   G   F  P+    +Y+ +       +L+ GR    + 
Sbjct: 11  PYDAQVGSDGSESFFVFQKITEEG---FKVPRFDLNVYQ-LAPELDHDWLDTGRNELIKL 66

Query: 76  LDSIIGTLSQTVYELIRDDLLDVDTLSEKTRWSRINANAXXXXXXXXXXXXXXGTVIDLT 135
           ++++ G L+Q +YELI  + L   TL E                         G V+D  
Sbjct: 67  INTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVVDHK 126

Query: 136 RENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPD 195
           RE+  V EPDL +D I++ H++N HL ++ IH+ LK +Y+N++RD+  +V  +CSHCN D
Sbjct: 127 REDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTD 186

Query: 196 KVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFE---NEKIQNRYSHIIYIRDYRSRFVWI 252
           + +    +  H N+Y+K +PLER  ++IF PF+   NEKI+++YSH++Y RDY SRFVW+
Sbjct: 187 RNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWM 246

Query: 253 YPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIE 312
            PL+   F+ L   +  LL  + R+PI+++T T++R+DM  +C+ IA KY++ +G+G   
Sbjct: 247 LPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNS 306

Query: 313 PSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMEC 372
            + F   G++R+K L  E+K++C+K+WNMCL+L     N+      RG+PS+L  +E+  
Sbjct: 307 GTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISN 366

Query: 373 SATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDE 408
            A  F+ K+ +II+ L   +  +     G++Y +D+
Sbjct: 367 IAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD 402

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  265 bits (677), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 147/395 (37%), Positives = 221/395 (55%), Gaps = 10/395 (2%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105
           P VG +  +Y+D    V  L+ G      +  SI G L + VYELIR   L  +TL+   
Sbjct: 94  PNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA--A 151

Query: 106 RWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQG 165
            +   +A                G V D  R N+IV +P L Y+ +++ H++N H  Y+ 
Sbjct: 152 NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRR 211

Query: 166 IHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFE 225
            H  L +IY+N++RD++   + FCS CNP K++  L K  H+N Y+  LPLERV ++IFE
Sbjct: 212 CHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFE 271

Query: 226 PFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTT 285
           PF  +KI+ +YSH+IY RDYRSR++ + PLKNTKFK L S I  LL +LPRIPI+I+T +
Sbjct: 272 PFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVS 331

Query: 286 IERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKL 345
           +  +D   I + I EKY+I++G+G      F++ G+ ++K LL  ++ +CL DW MCLK 
Sbjct: 332 LNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKY 391

Query: 346 GSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYA 405
           G + YN K    A GVP +L    ++        K  +II +LP  N  +     G +Y 
Sbjct: 392 GPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGN--GSIYL 449

Query: 406 QDEILTTSKNKSSNMENGDDTFLEYDDTFIEGSTN 440
           ++++      K  N++N D    E  D+  E + N
Sbjct: 450 EEKV------KDPNIDNYDAMLGEEYDSEQEDNNN 478

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  254 bits (648), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 126/361 (34%), Positives = 201/361 (55%), Gaps = 2/361 (0%)

Query: 33  KEVNRYGK-VVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELI 91
           K+VN+  +   F  P +       +    ++  LE G   + ++  ++ G L+Q +YELI
Sbjct: 27  KKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELI 86

Query: 92  RDDLLDVDTLSEKTRWSRINANAXXXXXXXX-XXXXXXGTVIDLTRENKIVYEPDLRYDY 150
           R D L +  L    +W   ++                 G V D  R+++IV EP   +  
Sbjct: 87  RSDTLSIANLERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHL 146

Query: 151 IISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIY 210
           ++ +H+ N H+    IH+ L   Y+N++RDYI   + +CS CNPD      +K  H N+Y
Sbjct: 147 VMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVY 206

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
            + LPLERV +++FEPF+ EKIQ R+SH++Y RDY SR+VWI PL+N K K +   +   
Sbjct: 207 WELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSF 266

Query: 271 LLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNE 330
           LL LPRIPI++++TTI+R  +  +C +IAE Y + LG+G      F++ G+  +K LL  
Sbjct: 267 LLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGS 326

Query: 331 NKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPI 390
           +K++CL+DWN+CLK G ++ N+    ++ G P +L    +      F  KR ++I   P 
Sbjct: 327 HKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPS 386

Query: 391 Q 391
           Q
Sbjct: 387 Q 387

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  248 bits (634), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 211/369 (57%), Gaps = 4/369 (1%)

Query: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLS 102
           F  P+    LY+ +D S    +++ GRG  ++ + ++ G L+Q +Y+LI  D L    L 
Sbjct: 29  FKVPQTDLNLYQ-LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLL 87

Query: 103 EKTRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLG 162
           E       N                 G VID  R++  V EPD  +D I+S H++N H+ 
Sbjct: 88  ECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMP 147

Query: 163 YQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLD 222
           ++ +++ +K +Y+N++R+   MV  +CSHCN D+ +    +  H N++EK +PLER  ++
Sbjct: 148 WRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVE 207

Query: 223 IFEPFENE---KIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPI 279
           +F PF++E   KIQ +YSH +Y RDY SRF+W+ PL+   F+ L   +  LL  + R+PI
Sbjct: 208 VFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPI 267

Query: 280 YIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDW 339
           +++T T++R+DM  IC+ IA +Y+  +G+G    + F   G+ R+K LL+E K++C  DW
Sbjct: 268 FLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDW 327

Query: 340 NMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTN 399
           NMCL+L     N+      RG+PS+L  +E+   +  F+ K+ +II+ L   +       
Sbjct: 328 NMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEA 387

Query: 400 KGLVYAQDE 408
            G++Y +DE
Sbjct: 388 GGMIYLEDE 396

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  249 bits (636), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 130/363 (35%), Positives = 207/363 (57%), Gaps = 3/363 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105
           P +G    +Y+D    + F++ G     E+  +I G L+++ YELI+ + L  +TLS   
Sbjct: 85  PNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATA 144

Query: 106 -RWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
            +  +  A +              G V D  R+N++V EP   YD I++ H++N H   +
Sbjct: 145 LKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPR 204

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
             H+ L  +YSN++R +++ +  FCS CNP K     +K  H+N ++  LPLERVQ+++F
Sbjct: 205 KCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVF 264

Query: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284
           EPF  EK+  +Y  I+Y RDYRSRF+W+ PL+N+KF  L   I  ++  + RIPI+ +TT
Sbjct: 265 EPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETT 324

Query: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344
           TIE +D   I ++I EKY+I++G+GT       + GL +++ LL  +K++CL DW MCLK
Sbjct: 325 TIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMCLK 384

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
            G + +N K    A GVP +L   ++    T    K  +I+  LP +N  K    +G +Y
Sbjct: 385 YGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIG--RGCIY 442

Query: 405 AQD 407
            +D
Sbjct: 443 LED 445

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  246 bits (627), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 128/378 (33%), Positives = 213/378 (56%), Gaps = 1/378 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104
           P +G +  EY+DS  ++  LE G      +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 51  PSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 110

Query: 105 TRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
            ++  + A                G V D    +KI  EP+  YD +++TH++N+HL  +
Sbjct: 111 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGK 170

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
            +H  L + ++N+S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 171 TLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 230

Query: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284
           EPF  E I+ +YS+++  RDYRS F+W+ PLK+TKFK L   I  L L   R+PI++ ++
Sbjct: 231 EPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSS 290

Query: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  +   LN  K++CL DW  CL+
Sbjct: 291 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLR 350

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
            G Y +N++     +  P+++ L E+      FE+KR  +I +   +N +KT+  KGL+Y
Sbjct: 351 YGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIY 410

Query: 405 AQDEILTTSKNKSSNMEN 422
            +D       NK+ N  N
Sbjct: 411 LEDVNTFALANKADNSYN 428

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  239 bits (611), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 205/363 (56%), Gaps = 1/363 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104
           P +G +  EY+DS  ++  LE G      +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 49  PSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 108

Query: 105 TRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
            ++  + A                G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 109 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGK 168

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
            +H  L + ++N+S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 169 TLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 228

Query: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284
           EPF  E I+ +YS+++  RDYRS F+W+ PLK+TKFK L   +  L L   R+PI++ ++
Sbjct: 229 EPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSS 288

Query: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K +CL DW  CL+
Sbjct: 289 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLR 348

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
            G Y +N++     +  P ++ L E+      FE+KR  +I +   +N +K +  KGL+Y
Sbjct: 349 YGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIY 408

Query: 405 AQD 407
            +D
Sbjct: 409 LED 411

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  233 bits (595), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 203/376 (53%), Gaps = 6/376 (1%)

Query: 37  RYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLL 96
           R   V F  PKVG TL +Y  +  +   L  GR    +Y +S+ G L+Q  ++L+R   L
Sbjct: 13  RKDGVKFRMPKVGETLEKY-GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSAL 71

Query: 97  DVDTL-SEKTRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTH 155
             + L S   +    N                 GTV D   ++ +V EP+  +D I+  H
Sbjct: 72  TAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGH 131

Query: 156 ILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLP 215
           + N H+ ++ +H  L+  Y+N +R + ++ + +CS CNP++V+    K  H NIY   LP
Sbjct: 132 LKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLP 191

Query: 216 LERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLP 275
           LERV ++I  PF  + I+  YSH++Y+RDY SRFVW+ PL + +   +       LL LP
Sbjct: 192 LERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250

Query: 276 RIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKC 335
           R+PI+++T+T++R+D+  +C+ IA +Y +S+G+G    ++F   G+ RL+ LL +N++ C
Sbjct: 251 RVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPC 310

Query: 336 LKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYK 395
           LK W+MCLK G   +N        G+P  L    +      FE KR E+I  L   N  +
Sbjct: 311 LKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVE 370

Query: 396 ---TSTNKGLVYAQDE 408
                  +G++Y +DE
Sbjct: 371 LRNEGRRRGMIYLEDE 386

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  234 bits (598), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 203/363 (55%), Gaps = 1/363 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104
           P +G +   Y+DS  ++  LE G      +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 52  PSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQIS 111

Query: 105 TRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
            ++  + A                G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 112 DKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 171

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
            +H  L + ++N S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 172 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 231

Query: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284
           EPF    I+ +Y +++  RDYRS F+W+ PLK+TKFK L   I  L L   R+PI++ ++
Sbjct: 232 EPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSS 291

Query: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K++CL DW  CL+
Sbjct: 292 TLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLR 351

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
            G Y +N++     +  P+++ L E+      FE+KR  +I +   +N +K +  KGL+Y
Sbjct: 352 YGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIY 411

Query: 405 AQD 407
            +D
Sbjct: 412 LED 414

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  232 bits (592), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 118/363 (32%), Positives = 204/363 (56%), Gaps = 1/363 (0%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104
           P +G +  EY+DS  ++  LE G      +L+S+   L+Q +YELI+   L  +TL +  
Sbjct: 102 PLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQIS 161

Query: 105 TRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
            ++  + A                G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 162 DKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 221

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224
            +H  L + ++N S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 222 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 281

Query: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284
           EP+  + I+ +Y +++  RDYRS F+W+ PLK+TKFK L   +  L L   RIPI++ ++
Sbjct: 282 EPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSS 341

Query: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K++CL DW  CL+
Sbjct: 342 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLR 401

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
            G Y +N++     +  P+++ L E+      FE+KR  +I +   +N +  +  KGL+Y
Sbjct: 402 YGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIY 461

Query: 405 AQD 407
            +D
Sbjct: 462 LED 464

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  226 bits (575), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 206/376 (54%), Gaps = 6/376 (1%)

Query: 37  RYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLL 96
           R  KV FD P VG  + +Y  +  ++  LE GR    +Y +S+ G L+Q  ++L+R   L
Sbjct: 13  RRDKVEFDMPAVGEPIEKY-HNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSL 71

Query: 97  DVDTL-SEKTRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTH 155
             D L +   +    N                 G V D    + +V EP+L +D I+  H
Sbjct: 72  TEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGH 131

Query: 156 ILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLP 215
           + N HL ++ +H  L+  Y+N +R + ++ + +CS CNP++ +   +K  H NIY   LP
Sbjct: 132 LKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLP 191

Query: 216 LERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLP 275
           LERV ++I  PF +E I+  YSH+++ RDY SRFVW+ PLK    + +   +   LL LP
Sbjct: 192 LERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLP 250

Query: 276 RIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKC 335
           RIPI+I+T+TI+R+D+   C+ +A +Y + +G+G  + S+F   G+ RL+ LL  N+++C
Sbjct: 251 RIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQC 310

Query: 336 LKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYK 395
           L+ W MCLK G+  +N        GVP  L    +      FE KR ++I  L  +N  +
Sbjct: 311 LRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVE 370

Query: 396 ---TSTNKGLVYAQDE 408
              +   +G++Y +DE
Sbjct: 371 IKVSGRRRGIIYLEDE 386

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  222 bits (565), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 126/361 (34%), Positives = 199/361 (55%), Gaps = 7/361 (1%)

Query: 67  FGRGAA--KEYLDSIIGTLSQTVYELIRDDLLDVDTLS-EKTRWSRINANAXXXXXXXXX 123
           F RG     ++  +I G LSQ +Y+LI  D L    +S EK +W+  +            
Sbjct: 82  FNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNEKYYFLKNRYY 141

Query: 124 XXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIK 183
                 TV D   ++KI+  P+   + ++ TH++N H  ++ +H+ L   Y+N+SR   +
Sbjct: 142 VSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITR 201

Query: 184 MVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEK-IQNRYSHIIYI 242
           + L +CS CNP + +  L+K+    +YE  LP ER+ ++IF+PF +EK I+  YSHI+YI
Sbjct: 202 ISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYI 261

Query: 243 RDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKY 302
           RDY SR+VW+YPLK T FK L   +      + + PIYI+++TI R D++A+ ++IA KY
Sbjct: 262 RDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKY 321

Query: 303 EISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVP 362
           ++ +GIG    S F+  GL  +K LL  ++D+CL DW MCLK G   +N        G+P
Sbjct: 322 DLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMP 381

Query: 363 SELFLDE--MECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNM 420
             L L+    ECS   ++SK+  +I+     N       K  +Y +D + +T      N+
Sbjct: 382 INLLLNSGISECS-IKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTSTPVIDEKNI 440

Query: 421 E 421
           E
Sbjct: 441 E 441

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  217 bits (552), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/356 (33%), Positives = 191/356 (53%), Gaps = 22/356 (6%)

Query: 34  EVNRYGKVVFDYPKVGATLYEYI---DSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYEL 90
           E+  Y K V   P +  T  +Y+   DS+  V FL+ G    + + + + G L+Q  Y L
Sbjct: 53  ELELYNKFVM--PALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTL 110

Query: 91  IRDDLLDVDTLSEKTR-WSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYD 149
           + ++ L ++T+ +    W    A                G + D   +N IV EPD  ++
Sbjct: 111 LMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFN 170

Query: 150 YIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNI 209
            I++ H+ N HL    + + L+ +Y+N +RD+++  L +C+ CNPD+ I  +EK  H NI
Sbjct: 171 LILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNI 230

Query: 210 YEKYLPLERVQLDIFEPFENE--------------KIQNRYSHIIYIRDYRSRFVWIYPL 255
            E+ LPLERV +++F PFE E              KI+ +YSH+ Y RD+R+R+VW +PL
Sbjct: 231 NEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPL 290

Query: 256 KNTKFKTLASEIGMLLLD-LPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPS 314
           KN KFKTL   I    +  L   PI+++++TI+R D+  I + +A KY + LG+G    +
Sbjct: 291 KNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFT 350

Query: 315 SFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEM 370
            F++ G+ R K  L+  K +C  DW MCLK G+Y  N + I    G  S +   E+
Sbjct: 351 KFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTEL 405

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  213 bits (543), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 116/376 (30%), Positives = 198/376 (52%), Gaps = 14/376 (3%)

Query: 68  GRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKTRWSRINANAXXXXXXXXXXXXX 127
           GR   ++ ++++ G L+Q +Y+L+  D L  + L   +     +                
Sbjct: 81  GRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQ 140

Query: 128 XGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLD 187
              + D+ R++ +VYEP+  +D I+S H+LN H+  +GI+  L   Y+N+++ + K+V  
Sbjct: 141 ENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTS 200

Query: 188 FCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENE----------KIQNRYS 237
           FCS CN      + +K  H NI+   +PL R  ++IF PF++           KI+ +Y 
Sbjct: 201 FCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYP 260

Query: 238 HIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKR 297
            ++Y RDY SR+VW+ PLK+     L   +  LL  + R+PI+IDT T++R+DM  +C+ 
Sbjct: 261 FVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCEN 320

Query: 298 IAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITT 357
           IA  Y+I +G+G    +SF   G+ R+K L  ++K++CL DWNMCLKL     N+     
Sbjct: 321 IARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDR 380

Query: 358 ARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDE----ILTTS 413
            RGVPS+L     +     F + +  +I+ L   +  +     G++Y +DE    +L + 
Sbjct: 381 VRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLSG 440

Query: 414 KNKSSNMENGDDTFLE 429
            + S   E+  + F E
Sbjct: 441 DDNSEESEHDSEIFDE 456

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  199 bits (507), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 210/405 (51%), Gaps = 15/405 (3%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105
           P +G     Y D    + F + G      Y  +  G +SQ +Y L ++D +  + ++   
Sbjct: 37  PVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLY 96

Query: 106 RWSRINANAXXXXXXXXXX-XXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164
              R    +               G + D T  N+IVY+P   +D I+S H++N+HLG +
Sbjct: 97  PTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSE 156

Query: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPD-KVIPNLEKTVHMNIYEKYLPLERVQLDI 223
            +++ L+  Y+N     IK  L++CS CNP  K+ P ++   ++  +EK LPLER+ ++I
Sbjct: 157 RVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYL--FEKALPLERITIEI 214

Query: 224 FEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDT 283
            EPF NEK++ +YS+++ ++D+  RF W+ PLKNTKFK +   +  ++L  PR+PI++++
Sbjct: 215 IEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVES 274

Query: 284 TTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCL 343
            T++  D+  I + I  KY I +G+G    SS  +   +R+   LN++ D+CL D+N CL
Sbjct: 275 NTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSS-AAQATARINRDLNDHHDECLFDFNNCL 333

Query: 344 KLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLV 403
           K G   YN+         P ++           F +KR  I+   P  +S   +   G +
Sbjct: 334 KYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSP--SSCVMNRGMGTL 391

Query: 404 Y------AQDEILTTSKNKSSNMENGDDTFLEYDDTFIEGSTNFE 442
           Y       Q++   +S ++ S+ ++ +D   E D++  EGS N E
Sbjct: 392 YLESPNGIQEDAAASSADELSSAKDAEDE--ERDNSTREGSGNGE 434

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  184 bits (467), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 180/346 (52%), Gaps = 20/346 (5%)

Query: 76  LDSIIGT-LSQTVYELIRDDLLDVDTLSEKTRWSRIN-------ANAXXXXXXXXXXXXX 127
           L+S+  + L+Q +Y LIR+   + +T  E  +    +       AN              
Sbjct: 54  LESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNE 113

Query: 128 XGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLD 187
            G + D   + K++  P+  YD I+  H LN HLG   IH  L+  YSN+SR  +++ L 
Sbjct: 114 LGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQ 173

Query: 188 FCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFEN-EKIQNRYSHIIYIRDYR 246
            CSHCNP     ++E T H +  +K    E++ ++IF+PFE+ +   N++SH+IYIRDY 
Sbjct: 174 NCSHCNPKSTYKHIEYTRHFSC-DKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232

Query: 247 SRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISL 306
           +R+VW+YPL+    K LA+ +   LL   RIPIYI++ T++  ++L I KRI++   + L
Sbjct: 233 TRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLIL 292

Query: 307 GIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELF 366
           G+GT +   F + G++ +K L  +N++ C  +WN  +     +YN        G+P  L 
Sbjct: 293 GVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLM 352

Query: 367 LDEMECSATTFESKRTEII------NSLPIQNS----YKTSTNKGL 402
             E      T++ KR   I      N++ ++N     YK ST   +
Sbjct: 353 AQETLADNKTYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSI 398

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  173 bits (439), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/425 (28%), Positives = 199/425 (46%), Gaps = 36/425 (8%)

Query: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105
           P++G      I        L+ G  A     +S    LS+ +Y+L+++D L    ++   
Sbjct: 34  PRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVAVAL 90

Query: 106 RWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQG 165
                NA                  V D +++NKIV +P  R+  +++TH+LN HL    
Sbjct: 91  NLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGA 150

Query: 166 IHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFE 225
           I++ L   ++NLS  +IK  +++CS CN +K     +K   ++     L  ER+ LD+  
Sbjct: 151 IYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILDVVA 210

Query: 226 PFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTT 285
           PF  +KIQ RY+HI+ I D+ ++F+W +PLKN K +T+ S++   ++ LP  P++I + T
Sbjct: 211 PFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFISSFT 270

Query: 286 IERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK- 344
           +   D+  +C  +A +Y IS+G+GT      YS     +  +LN +K +CLK W MCLK 
Sbjct: 271 LSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKSWFMCLKW 329

Query: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404
           L     N K           LF   M      +E +   II  LP +N          +Y
Sbjct: 330 LADRQSNSKFDIRPPNKNYGLF-SGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFIY 388

Query: 405 AQDE------------------ILTTSKNKSSNME------------NGDDTFLEYDDTF 434
           ++DE                  ++ +S++   N E            N DDT L+Y+DTF
Sbjct: 389 SEDEFSFDNLVEKETPKKLSESVVNSSEDSDDNYEDNQEDNYLAEGPNRDDTILDYNDTF 448

Query: 435 IEGST 439
            E  +
Sbjct: 449 TEAES 453

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  163 bits (413), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/318 (31%), Positives = 170/318 (53%), Gaps = 18/318 (5%)

Query: 129 GTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDF 188
             +ID  +  +I+ EP   YD +I+ H L  H  Y  + +RLK  +SN+ R YI     +
Sbjct: 121 NNIIDKRKPGRIICEPKYMYDIVIAYH-LKLHSSY-AVSERLKKFFSNVGRQYIDYCAKY 178

Query: 189 CSHCNPDKVIPNLE--------KTVHMNIYEKYL-PLERVQLDIFEPFENEKIQNRYSHI 239
           CS C PD+   +++        K +  NI ++ L P+ER+ ++IF PF++ KI+N+Y  I
Sbjct: 179 CSKCFPDET-EHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRI 237

Query: 240 IYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLP-RIPIYIDTTTIERRDMLAICKRI 298
           +YIRDY +R++W + LK  K K + + +    L +   +PI++ ++TI+  D+  IC++I
Sbjct: 238 LYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKI 297

Query: 299 AEKYEISLGIGT-IEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITT 357
           + +Y ISLG+GT  +   F+  G+   K L+N NK KCLK W+  L  GS  +N K  + 
Sbjct: 298 SREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSR 357

Query: 358 ARGVPSELF-LDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNK 416
               P ++   + +      F  +R  II      N  K      +++ +DE   TS  +
Sbjct: 358 ILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDE--ATSIAE 415

Query: 417 SSNMENGDDTFLEYDDTF 434
              +E G+D + ++ D +
Sbjct: 416 GLTLE-GNDKYEQFSDEY 432

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  155 bits (393), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 184/373 (49%), Gaps = 18/373 (4%)

Query: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDD-LLDVDT- 100
           F  P +G     Y DS      L+ G     E+ +++   ++  +Y  +RD+ LL+ D  
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 101 --LSEKTRWSRINANAXXXXXXXXXXXXXXGTVIDLTRENKIVYEPDLRYDYIISTHILN 158
              S K + S+                   G +I+ T+ NK++ EP   Y   +  H +N
Sbjct: 88  IPASLKIKTSK------KMYLQIRYSKNSDGDLIE-TKTNKLLCEPKYIYKLTMKAHFMN 140

Query: 159 RHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTV-HMNIYEKYLPLE 217
            H+    +++ L   Y N+    + +VL +CSHCN    I ++       N Y  YLPLE
Sbjct: 141 NHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLE 200

Query: 218 RVQLDIFEPFENE--KIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLP 275
           R+Q+DI +PF +   KI N+YSHI+ IRDY SR+ WI+PLK+   K +++E+G  L+ LP
Sbjct: 201 RLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLP 260

Query: 276 RIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSS--FYSIGLSRLKCLLN--EN 331
           R PI++ +  I    ++ I  +I  +Y+I + IG        F   G+SRL  LLN  EN
Sbjct: 261 RTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKEN 320

Query: 332 KDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQ 391
           K+KC  DW  C++  ++  N++         + L   +       FE+KR  +++ L  +
Sbjct: 321 KEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEE 380

Query: 392 NSYKTSTNKGLVY 404
           N  K      ++Y
Sbjct: 381 NVLKIGECGSIIY 393

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 14/125 (11%)

Query: 159 RHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLER 218
           RH G    H  +    S ++R  I+ V   C  CN  K +P +   V  +  +  +P E 
Sbjct: 164 RHRGVAATHDAIGEKMSGITRQLIQDVTYDCLKCNVTKGVPII--YVPDDNPKAEVPFEN 221

Query: 219 VQLDIFE--------PFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           + +DI +        P +N+K     S I++I D  + + W+Y L +T    +A    +L
Sbjct: 222 LLIDIIDLKDRSCRCPKDNKK----KSQILHIMDQYTEYTWLYILDDTHHDAIAMIFEVL 277

Query: 271 LLDLP 275
           L   P
Sbjct: 278 LYHFP 282

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTL 263
           E Y P + +  DIF P  +   ++  S+ I   D ++RF W+YPL N + +++
Sbjct: 228 ESYQPFQYLHTDIFGPVHHLP-KSAPSYFISFTDEKTRFKWVYPLLNRREQSI 279

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 156 ILNRHLGYQGIHKRLKAIYSN----LSRDYIKMVLDFCSHCNPDKVIPNLEKTVH----- 206
           +++R LG+  +    K++  N    L    I+        C PD +I    K  H     
Sbjct: 169 LIHRMLGHANVQSIQKSLKKNAVTYLKESDIEWSNASTYQC-PDCLIGKSTKHRHVKGSR 227

Query: 207 MNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASE 266
           +   E Y P + +  DIF P  +   ++  S+ I   D ++RF W+YPL + + +++ + 
Sbjct: 228 LKYQESYEPFQYLHTDIFGPVHHLP-KSAPSYFISFTDEKTRFQWVYPLHDRREESILNV 286

Query: 267 IGMLL 271
              LL
Sbjct: 287 FTSLL 291

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTL 263
           + Y P + +  DIF P  N   ++  S+ I   D ++RF W+YPL + + +++
Sbjct: 660 DSYEPFQYLHTDIFGPVHNLP-KSAPSYFITFTDEKTRFQWVYPLHDRREQSI 711

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 213 YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTL 263
           Y P + +  DIF P  N   ++  S+ I   D ++RF W+YPL + + +++
Sbjct: 662 YEPFQYLHTDIFGPVHNLP-KSAPSYFITFTDEKTRFQWVYPLHDRREQSI 711

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 213 YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTL 263
           Y P + +  DIF P  N   ++  S+ I   D ++RF W+YPL + + +++
Sbjct: 662 YEPFQYLHTDIFGPVHNLP-KSAPSYFITFTDEKTRFQWVYPLHDRREQSI 711

>Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 372] PARTIAL
          Length = 74

 Score = 32.0 bits (71), Expect = 0.50,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPL 255
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL
Sbjct: 20  EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPL 63

>Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A -
           Ty ORF [contig 254] FULL
          Length = 78

 Score = 31.6 bits (70), Expect = 0.64,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPL 255
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL
Sbjct: 20  EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPL 63

>KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {ON}
          Length = 282

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 167 HKRL----KAIYSNLSRD-----YIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLE 217
           H RL    K +Y  L+++     Y       CS C   K    L K V ++ ++   PL+
Sbjct: 34  HPRLGHPGKLVYDKLAKEIGLAKYEPSPYSLCSTCVTAK--GQLSKGV-ISDFKATAPLQ 90

Query: 218 RVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLA 264
            VQ+D+   F  E+  +     + IRD  SR+ ++ PLKN    T A
Sbjct: 91  LVQVDLCGGFRYEEYVDSKC-FLTIRDSYSRYYFVIPLKNKAAATQA 136

>KNAG0G02840 Chr7 (628866..630110) [1245 bp, 414 aa] {ON} 
          Length = 414

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 167 HKRL----KAIYSNLSRD-----YIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLE 217
           H RL    K +Y  L+++     Y       CS C   K    L K V ++ ++   PL+
Sbjct: 34  HARLGHPGKLVYDKLAKEIGLAKYEPSPYSLCSTCATAKG--QLSKGV-ISDFKTTAPLQ 90

Query: 218 RVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLA 264
            VQ+D+   F  E+  +    +  IRD  SR+ ++ PLKN    T A
Sbjct: 91  LVQVDLCGGFRYEEYVDSKCFLT-IRDSYSRYYFVIPLKNKAAATQA 136

>Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {ON}
           YDR261W-B - TyB Gag-Pol protein [contig 215] FULL
          Length = 117

 Score = 32.0 bits (71), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 20  EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 271 LLDLPR 276
           +  + R
Sbjct: 79  IAHIAR 84

>SAKL0G17886g Chr7 (1548370..1551510) [3141 bp, 1046 aa] {ON}
           similar to uniprot|P12683 Saccharomyces cerevisiae
           YML075C HMG1 One of two isozymes of HMG-CoA reductase
           that catalyzes the conversion of HMG-CoA to mevalonate
           which is a rate-limiting step in sterol biosynthesis
           localizes to the nuclear envelope overproduction induces
           the formation of karmellae
          Length = 1046

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 178 SRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYS 237
           S+ Y  M L+F +  N   ++P L+  V+ N + KYL  + V+L  F   ++E +    S
Sbjct: 99  SQHYYLMELEFDTR-NDSMLLPQLDNVVYENGHIKYLLQQSVELPEFAKTDDESVWKLRS 157

Query: 238 HIIYIRDYRSRFVWIY 253
           H   + D +  FV IY
Sbjct: 158 HRHKLYDIKDFFVSIY 173

>ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON}
           similar to uniprot|P38111 Saccharomyces cerevisiae
           YBR136W MEC1 Central regulator of the Mec1p/Tel1p
           signaling network; required for mitotic growth, DNA
           repair and mitotic recombination, regulates
           phosphorylation of Rad53p, required for dmc1 arrest and
           meiotic recombination; similar to phosphatidylinositol
           (PI)3- kinases required for DNA damage induced
           checkpoint responses in G1, S/M, intra S, and G2/M in
           mitosis
          Length = 2287

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 256 KNTKFKTLASEIGMLLLDLPRIPIYIDTT---TIERR--DMLAICKRIAEKYEISLGIGT 310
           +N++ + L + IG  L  LP +   +DT     IER   DM  +  ++A+  E       
Sbjct: 323 ENSQLENLRTLIGKKLRRLPSLQESMDTVDPGIIERSKGDMPVLLGQVAQSIENCFNTQN 382

Query: 311 IEPSSFYSIGLSRLKCLLNENKDKCLKDWNMC 342
           +     ++  L+RL CL + +    L +W +C
Sbjct: 383 VSKLVSWTKILARLACLESHSPRPQLANWTIC 414

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 210 YEKYL-PLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLK 256
           Y+KY  P E +  D+F P     I +   + I   D  +RF W++PLK
Sbjct: 284 YQKYYEPFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLK 330

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 210 YEK-YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLK 256
           Y+K Y P E +  D+F P     I +   + I   D  +RF W++PLK
Sbjct: 369 YQKSYEPFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLK 415

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 26/136 (19%)

Query: 139 KIVYEPDLRYDYIIST---------HILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFC 189
           K+++ P     Y+I+          + L +H     I   L A Y N+S+  I  V+  C
Sbjct: 152 KLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAAC 211

Query: 190 SHCNPDKVIPNLEKTVHMNIYE-KYLPL-----ERVQLDIFEPFENEKIQNR----YSHI 239
             C P         +   NI     LPL     +R+Q+ I    +   +  +     + I
Sbjct: 212 PDCKP-------LSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAI 264

Query: 240 IYIRDYRSRFVWIYPL 255
           +YI DY S  VW++ L
Sbjct: 265 LYIGDYHSGAVWLFAL 280

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 20  EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 271 LLDLPR 276
           +  + R
Sbjct: 79  IAHIAR 84

>Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 159] FULL
          Length = 354

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 203 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 261

Query: 271 LLDLPR 276
           +  + R
Sbjct: 262 IAHIAR 267

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 118 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 271 LLDLPR 276
           +  + R
Sbjct: 177 IAHIAR 182

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 180 DYIKMVLDFCSHCNPDKVIPNLEKTVHMNIY-EKYLPLERVQLDIFEPFENEKIQNRYSH 238
           D+I++    C  C   K   +       + Y EKY  LE +  DIF P  +        +
Sbjct: 382 DWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPKY 440

Query: 239 IIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPR 276
            I   D R+R+ W++PL     + + +    L+  + R
Sbjct: 441 FITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 478

>Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB
           Gag-Pol protein [contig 305] FULL
          Length = 239

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 20  EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 271 LLDLPR 276
           +  + R
Sbjct: 79  IAHIAR 84

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 118 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 271 LLDLPR 276
           +  + R
Sbjct: 177 IAHIAR 182

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 214 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 272

Query: 271 LLDLPR 276
           +  + R
Sbjct: 273 IAHIAR 278

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 279 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 337

Query: 271 LLDLPR 276
           +  + R
Sbjct: 338 IAHIAR 343

>Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A -
           Ty ORF [contig 245] FULL
          Length = 358

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 214 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 272

Query: 271 LLDLPR 276
           +  + R
Sbjct: 273 IAHIAR 278

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 279 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 337

Query: 271 LLDLPR 276
           +  + R
Sbjct: 338 IAHIAR 343

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 118 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 271 LLDLPR 276
           +  + R
Sbjct: 177 IAHIAR 182

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 210 YEK-YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKN 257
           Y+K Y P + +  D+F P   +K    +   +   D  +RF W++PL+N
Sbjct: 405 YQKNYEPFQYIHTDVFGPVSVDKPYPSW--FVAFTDEATRFRWVFPLEN 451

>Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB
           Gag-Pol protein [contig 695] FULL
          Length = 186

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 180 DYIKMVLDFCSHCNPDKVIPNLEKTVHMNIY-EKYLPLERVQLDIFEPFENEKIQNRYSH 238
           D+I++    C  C   K   +       + Y EKY  LE +  DIF P  +        +
Sbjct: 86  DWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPKY 144

Query: 239 IIYIRDYRSRFVWIYPL 255
            I   D R+R+ W++PL
Sbjct: 145 FITFTDERTRYRWVFPL 161

>Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 206] FULL
          Length = 625

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 20  EKYADLEFLHTDIFGPMHH-MPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 271 LLDLPR 276
           +  + R
Sbjct: 79  IAHIAR 84

>YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 aa]
           {OFF} TyB Gag-Pol protein; proteolytically processed to
           make the Gag, RT, PR, and IN proteins that are required
           for retrotransposition
          Length = 1749

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 213 YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTK 259
           Y P + +  DIF P  N   ++  S+ I   D  ++F W+YPL + +
Sbjct: 662 YEPFQYLHTDIFGPVHNLP-KSAPSYFISFTDETTKFRWVYPLHDRR 707

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 173 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 231

Query: 271 LLDLPR 276
           +  + R
Sbjct: 232 IAHIAR 237

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGML 270
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL     + + +    L
Sbjct: 214 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 272

Query: 271 LLDLPR 276
           +  + R
Sbjct: 273 IAHIAR 278

>NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON} 
          Length = 234

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 210 YEK-YLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKN 257
           Y+K Y P + +  D+F P   +K     S  +   D  +RF W++PL+N
Sbjct: 22  YQKNYEPFQYIHTDVFGPVSVDKPYP--SWFVAFTDEATRFRWVFPLEN 68

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 28  PISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSI 79
           P +  +E+  Y   + D PK  A LY+  D+S  +  LEF +   K  L  I
Sbjct: 225 PPAHIQEIEDYELQMIDNPKSVAELYDEFDNSLKLQILEFEKKFGKGQLSRI 276

>Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB
           Gag-Pol protein [contig 351] FULL
          Length = 347

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 211 EKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPL 255
           EKY  LE +  DIF P  +        + I   D R+R+ W++PL
Sbjct: 279 EKYADLEFLHTDIFGPMHHMP-SGVPKYFITFTDERTRYRWVFPL 322

>SAKL0A02134g Chr1 (195606..198287) [2682 bp, 893 aa] {ON} similar
           to uniprot|P27514 Saccharomyces cerevisiae YNR013C PHO91
           Low-affinity phosphate transporter deletion of pho84
           pho87 pho89 pho90 and pho91 causes synthetic lethality
           transcription independent of Pi and Pho4p activity
           overexpression results in vigorous growth
          Length = 893

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 166 IHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFE 225
           + KRL AI++ LS   +K  +D  +H    K+    +K++  +I  +YLP    +  +F+
Sbjct: 252 LKKRLVAIFTQLSE--LKSFIDL-NHTGFSKICKKFDKSLDTSIKSQYLPTLSQKTHVFQ 308

Query: 226 PFENEKIQN 234
           P   + ++N
Sbjct: 309 PETLKNLEN 317

>Ecym_1514 Chr1 complement(1060426..1064322) [3897 bp, 1298 aa] {ON}
           similar to Ashbya gossypii ACR224C
          Length = 1298

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 55/129 (42%), Gaps = 17/129 (13%)

Query: 246 RSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIY-IDTTTIER--RDMLAICKRIAEKY 302
           +S+  W Y ++      + S +  +L+++ R+ +  ID  T E    +  AIC     + 
Sbjct: 541 QSKVFWPYQIR----AKIGSLLISMLINVARVEVTGIDPVTKEAVYGEAPAICHTFQYRT 596

Query: 303 EISLGIGTIEPSSFYSIGLSRLKCLLNEN------KDKCLKDWNMCLKLGSYYYNKKSIT 356
              +G+  +  S  Y +G  RL   +         K +    WN     G YYY++ ++ 
Sbjct: 597 GSKIGVLKLHRSLTYQLGGERLNASVQPQHLPMLVKPRPWTSWNS----GGYYYSQSTLI 652

Query: 357 TARGVPSEL 365
            ++  P +L
Sbjct: 653 RSKDSPEQL 661

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 155 HILNRHLGYQGIHKRL-KAIYSNLSRDYI--KMVLDF-CSHCNPDKVIPNLEKTVHMNIY 210
           H    H+  + I K + K +  N++ D I  + +  F C  C   K+  +         Y
Sbjct: 601 HRFFGHVNVKDIRKSVEKGMIQNITADKIDWRGIDKFQCKECLAGKMRRHKHTVGSRLKY 660

Query: 211 EKYL-PLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKN 257
           +++  P + +  D+F P  +         I ++ D  +RF W+YPL++
Sbjct: 661 QQFFEPFQYIHTDLFGPMSDVSATTPTYFISFV-DENTRFRWVYPLRS 707

>KAFR0F00150 Chr6 complement(46123..47844) [1722 bp, 573 aa] {ON}
           Anc_2.16 YNL225C
          Length = 573

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 13/61 (21%)

Query: 37  RYGKVV-FDYPKVGATLYEYIDSSYSVPF-----------LEFGRGAAKEYLDSIIGTLS 84
           R GK+V F+ P +G  L EY+DSS  + F           L F   +  +Y  S++ +L 
Sbjct: 235 RLGKIVLFNVP-LGPVLEEYLDSSTDIDFNVLFKKKNEKILSFSESSLDQYTTSVLSSLK 293

Query: 85  Q 85
           +
Sbjct: 294 E 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,964,456
Number of extensions: 2203587
Number of successful extensions: 6639
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6775
Number of HSP's successfully gapped: 75
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)