Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.378.261ON57857828640.0
TDEL0F038808.261ON57957918150.0
SAKL0H17050g8.261ON58457718010.0
YLR088W (GAA1)8.261ON61461317820.0
Smik_12.1478.261ON61361217580.0
Skud_12.1568.261ON61261117510.0
TBLA0F030808.261ON58358317310.0
KNAG0H032508.261ON58557017220.0
ZYRO0C01672g8.261ON56957917120.0
Suva_10.1728.261ON61461317160.0
KLLA0F19118g8.261ON57857317020.0
NCAS0B038608.261ON58358116990.0
KLTH0G13706g8.261ON58456716600.0
Ecym_43098.261ON57757816570.0
CAGL0L12232g8.261ON59157816570.0
AGR087C8.261ON57757816550.0
TPHA0A018208.261ON58158116470.0
Kwal_56.238048.261ON57857816230.0
NDAI0J013908.261ON58358316030.0
KAFR0B055508.261ON55550715150.0
Kwal_23.43815.62ON437139790.54
KLLA0D15180g3.443ON2379119742.7
CAGL0L13090g2.135ON74838706.8
KNAG0A014103.53ON51563697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.37
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...  1107   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   703   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   698   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   691   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   681   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   679   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   671   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   667   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   664   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   665   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   660   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   659   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   644   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   642   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   642   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   642   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   639   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   629   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   622   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   588   0.0  
Kwal_23.4381 s23 complement(694167..695480) [1314 bp, 437 aa] {O...    35   0.54 
KLLA0D15180g Chr4 (1284273..1291412) [7140 bp, 2379 aa] {ON} wea...    33   2.7  
CAGL0L13090g Chr12 (1397800..1400046) [2247 bp, 748 aa] {ON} som...    32   6.8  
KNAG0A01410 Chr1 complement(49093..50640) [1548 bp, 515 aa] {ON}...    31   7.5  

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/578 (95%), Positives = 553/578 (95%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           MSILENLQRRLIDAG                         YLPMDGQFRRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480
           LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480

Query: 481 PMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLG 540
           PMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLG
Sbjct: 481 PMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLG 540

Query: 541 SWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKHL 578
           SWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKHL
Sbjct: 541 SWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKHL 578

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/579 (58%), Positives = 434/579 (74%), Gaps = 5/579 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           MS++  L RR+ID G                          LP++G++RRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRETEWN LRGYR +IE L++ +S ERN  ++ WL EFG+KT++Y+++++GD+L
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +A RGDGTE+++LA PW NA+   N+SG ++G++L RF SRWPVWSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDYPGV+DYF+++E+HY+G NG  PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISI EHEG+KVSLHG++ D++ + D+WSRL ++  G KN AL+G+R+V GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359
           QA+TLKA G +  HDVTTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPRYFVSI SYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419
            AV LSISFA+AS+D+ +NN Y  +  SS YNLLS   W +S++ CF +   F  +  P 
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479
           +L+  + +IS +PL   K   I+EPLAYRLK+++F++ SLV+TSLL+VNF LAF MGL A
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 YPMTLVMLNNTDN--LRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537
           +PMTLV  ++ +N  LR+K +NSILL +SNPFIA ++F    E  L G         AW 
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576
           +LG WTWF+ CIGW PSW++VA+S L  +  Q +   KK
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/577 (57%), Positives = 434/577 (75%), Gaps = 4/577 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXX-XXXYLPMDGQFRRTYISENALM 59
           M+++E L RR ID G                          ++P DGQFRRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119
           PSQAYSYFRETEWN+LRGYR +IE+    S+ ERN  +SSWL++FG KT++Y N+EYG++
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           LYG+ +APRGDGTE+MVLA PWYN+E+++N  G AL VSL+RF SRWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239
           +P+ ALRSWVEAYHTSLDLTGGSIEAAVV+D+PG +D+F+Y+E+H++G NG LPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299
           +A+ I EHEG+KVSLHG++ +E+G  D++SR+K I LG KN+AL+G+++ +GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           I ++TLKA G D   D+TTFGR+ EA+FRS+NNLLEKFHQSFFFY LLAPR FVSIGSYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PAAV LS+SFA+AS+++ +NN+Y S+   S YN+ + + +AV++ V F    +F Y PQP
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
            LLL  NV++  +P+   + + I  P +YRLK+ +++Y S+V+TSLLVVNF LAFG+G  
Sbjct: 421 ELLLSLNVLLLLMPIIFTR-VKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+PMTLV    + NLR + +N +LL ISNPFIA WLF   V+ +L G++  YGL  AW  
Sbjct: 480 AFPMTLVR-TTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKD 538

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSK 575
           LG WTWF+ CIGW PSW+LVA S +    +    + K
Sbjct: 539 LGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/613 (54%), Positives = 434/613 (70%), Gaps = 37/613 (6%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M++LE L RR++D G                          LPMDGQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNILRGYR +I+ + + +S+ERN +M SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLAVPW+N++DEFN+ GAALGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           PR ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++ N ++WSRLK++ LG ++ AL+GV++ +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           Q++TLKA G++ HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AV LSI+FA++S+++F+NN Y ++   S YNL++ + W VS+++ F +  +F   P   L
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480
           L+  ++    +PL   + + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLV------------------------------MLNNTDNL-------RLKTRNSILL 503
           PMT V                              + N+ D         + K +N +LL
Sbjct: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLL 540

Query: 504 AISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISAL 563
            ++NPFI+  LF    + +  G + I  LV AW  L  W+WF+ CIGW P W+L+  S+ 
Sbjct: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600

Query: 564 KVEQVQTEPNSKK 576
           + + V      K+
Sbjct: 601 ESKSVVVRSKEKQ 613

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/612 (53%), Positives = 437/612 (71%), Gaps = 36/612 (5%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M++LE L RR++D G                          LPMDGQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNILRGYR +IE + + +S+ERN IM SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLAVPW+N++D+FNV GAALGVSLARF SRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P  ALRSWVEAYHTSLDLTGGSIEAAVV+DY    D+FEY+E+ Y+G NG LPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++   +YWSRLK++ LG ++ AL GV+  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           Q++TLKA G++ HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AV LS++FA++S+++F+NN Y S+   S YNL++ + W +S+++ F +   F   P   L
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480
           L+  +++   +PL   K + ISEPL+YRLK ++F+Y SLV+TSLL++NF +A  +G  A+
Sbjct: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLV-----------------------------MLNNTDNL-------RLKTRNSILLA 504
           PMTLV                             ++ N +++       R + +N +LL 
Sbjct: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLLV 540

Query: 505 ISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISALK 564
           ++NPFI+  +F +  + +  G + I  LV AW  L  W+WF+ CIGW P W+LV  S+ +
Sbjct: 541 LTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSFE 600

Query: 565 VEQVQTEPNSKK 576
            ++V  +   K+
Sbjct: 601 SKRVMLKSKEKQ 612

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/611 (54%), Positives = 429/611 (70%), Gaps = 35/611 (5%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M++LE L RR++D G                          LPMDGQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWN+LRGYR +IE + + +S ERN  M SWL+EFG KT++Y++Q+YG++L
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLA+PW+N++DEFNV GAALGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           PR ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++ N D+WSRLK++SLG ++ AL+GV+  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           Q++TLKA G   HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AV  S++FA++S+++F+NN Y S+   S YNL++ + W +S++V F +   F   P   L
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480
           L+  ++    +PL   + + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480

Query: 481 PMTL---------------------VMLNNTDNL--------------RLKTRNSILLAI 505
           PMT                      V   + D+L              R + +N +LL +
Sbjct: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLLVL 540

Query: 506 SNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISALKV 565
           +NPFI+  LF  + +++  G + +  L+ AW  L  W WF+ CIGW P W+L+  S+ + 
Sbjct: 541 TNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFES 600

Query: 566 EQVQTEPNSKK 576
             V  +   K+
Sbjct: 601 RSVVVKSKEKQ 611

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/583 (55%), Positives = 432/583 (74%), Gaps = 5/583 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M++L  + RR+ID G                          LPMDGQ+R TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNILRGYR EI++  S  S +RN +M+ WLEEFG KTSVY N EYGD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YG+FNAPRGDGTE++VLA+PWYNA+ EFN  GAALG++L+RF SRWP+WSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DYP  SD+F+Y+E++Y+G NG LPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AI I EHEG++VSLHGL  + +   +Y+SRL+ + LGTK+  L+G++  +GNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QALTLKAR---GDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSY 357
           QA+TLKA+    + +HD+T+FGR+AEA FRS+NNLLEKFHQSFFFY +LAP+YFVSI SY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQ 417
           LP+AV  S++FA++S+ S++NN Y ++   S YNLL+ + + +S+   FF+      + +
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 PLLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477
           P LL+LG+V +S +P       +I EPL+YRLK+I+F+Y+SLV+TSLLV+NF LAFG+G+
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 FAYPMTLV-MLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAW 536
             + MT V  +    ++R++ RN++ L +SNPF +  LF  I +  + GI+  Y  + +W
Sbjct: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540

Query: 537 NKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPN-SKKHL 578
           N L  WTWFI C+GW P WILV+IS+++   V   P+  KK L
Sbjct: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQL 583

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/570 (57%), Positives = 420/570 (73%), Gaps = 9/570 (1%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M + E LQR+ +  G                          +PM+GQ+R TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSH--SSIERNAIMSSWLEEFGLKTSVYKNQEYGD 118
           SQAYSYFRETEWNILRGYR EIEVL+S   S+ +R  I++ WL EFG KT+VY+N+E GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 SLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFS 178
           +LYGV +APRGDGTE+MVL  PW N+E EFN+ G+AL ++L+R+ SRWPVWSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLV 238
           +NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDYP  +DYF Y E+H+ G NG LPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGW 298
           N+A+ I +HEG+KVSLHGL   E+   +YWSRLK++ LG K+  L G+++ +GNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           RIQA+TLKARG+   D+TTFGR+ EAMFRSINNLLEKFHQSFFFYFLL+P  FVSI SYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTY-YPQ 417
           P+AV+LSI+FA+A++D+ VNN Y S +  + Y LL+ +   +S++V F + + F Y    
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYASALHIT-YTLLAALASVISLLVSFLVAHWFLYSTTS 419

Query: 418 PLLLLLGNVVISTIPLAAPK-NLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMG 476
           PL L+LG+VV++  PL   + N ++ EP+ YR++T+ ++Y SL++TSLL++NFPLAF +G
Sbjct: 420 PLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIG 479

Query: 477 LFAYPMTLVM---LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVE-SKLDGIEAIYGL 532
           LF YPMTLV    + +   + LK RNS+LL ISNPF+A WL  T+VE S+   ++    L
Sbjct: 480 LFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAAL 539

Query: 533 VDAWNKLGSWTWFIFCIGWFPSWILVAISA 562
             AW  L  WTWF+ C+GW P+W+LV  S+
Sbjct: 540 FSAWKDLNCWTWFVLCLGWLPTWLLVTFSS 569

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/579 (56%), Positives = 417/579 (72%), Gaps = 13/579 (2%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M+++E LQRR+++ G                          LP++GQFRRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNILRGYR +IE     S+ ERN  M+ WL+EFG KTS+Y N+EYGDSL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YG+ +A RGDGTE+++LAVPWYNAE + NV GA+LG+SL+RF SRWPVWSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDYPG +DYF+Y E+ Y G NG LPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           A+SI EHEG+ VSLHG+TP+ + +  YWSRLK++  G    A  G+  + GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QALTLKARGDT--NHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           Q++T+KA G    N+D+TTFGR+ EAMFRSINNLLEKFHQS+FFY L+APRYFVSI SYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PA VVL+  FA+AS++S + NQY ++   S+YNL + +FW VS++V F     F Y P  
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
           +LL+   VV+  +PLAA +  +I+EPL++RL+  +F+Y+SLV+TSL++VNF LAF +G+ 
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+PMT V    +    L  +   LL ISNP ++F  FI     +L     +  L+ AW  
Sbjct: 481 AFPMTAVGTQRS----LTFKKYALLIISNPLVSF--FIVKPHPQL-----LQKLISAWQD 529

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577
           LG WTWF+ C+GW PSW L+A+SA     +     SKK 
Sbjct: 530 LGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKE 568

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/613 (53%), Positives = 427/613 (69%), Gaps = 37/613 (6%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M++LE L RR++D G                          LPMDGQ+RRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRETEWNILRGYR +IE   + +S ERN +M SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLA+PW+N+E EFNV GA+LGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P  ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+EV Y+G NG LPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  +++G+ D++SRLK++ LG ++ AL+GV+  +GNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           Q++TLKA G   HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AV LS++FA++S+++F+NN Y S+   S YNL++ + W ++++V F +   F       L
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480
           L+  ++ I  +P+A    + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLVM-----------LNNTDNLRLKTRNS--------------------------ILL 503
           PMT +                 N+ +KT  +                          +LL
Sbjct: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLLL 540

Query: 504 AISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISAL 563
            ++NPFI+  +F  + + +  G + I  LV AW  L  W+WFI C+GW P W+L+  S+ 
Sbjct: 541 ILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASSF 600

Query: 564 KVEQVQTEPNSKK 576
           + + V  +   K+
Sbjct: 601 ESKSVVVKSKEKQ 613

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/573 (54%), Positives = 415/573 (72%), Gaps = 3/573 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXY-LPMDGQFRRTYISENALM 59
           M+++E L RR+I  G                         + LP DGQFRRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSI-ERNAIMSSWLEEFGLKTSVYKNQEYGD 118
           PSQAYSYFRE+EWNILRGYR ++++    S+  + NA +S WL+EFG+KT++Y +++YG+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 SLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFS 178
           +LYG+F+APRGDGTE+MV+A PWYN   E+N  GAAL +SL RF SRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLV 238
           E+P+ +LRSWV AYHTSLDLTGGSIE+A+VLDYPG SD F+Y+E+HY+G NG  PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGW 298
           N+A+ IAEHEG+KVSLHGL   E+   DY SRLK + LG K+  L+G++  YGNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSY 357
           RIQ+LTLKA+G D  HD+TTFGRV EA+ RS+NNLLEKFHQSFFFY LLAPRYF+SIG+Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQ 417
           L  AV +S++F  A+++  +NN+Y  +   S YN+ S + + +S++  F     F Y+P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 PLLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477
           P +LL  + + S +PL +   L I EP +YR K  +++Y+++V+TSLLV+NF LA  MGL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 FAYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537
            A+PMT        NLRL  +N +LL ISNPFIA W  +  VE +L G +  Y L++A  
Sbjct: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540

Query: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQT 570
           +LG WTW+I C+GW+PSW+LV  +++   +VQT
Sbjct: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQT 573

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/581 (56%), Positives = 426/581 (73%), Gaps = 4/581 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M + E +QR++I  G                          LP +GQ+R TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNI+RGYR +I  L + S++ERNAIMS WL++FG KT +Y+N E GD+L
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGVF+APRGDGTESMVLA+PW+NA+ EFNV+GAALGV+LAR+ SRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P+ ALRSWVEAYHTSLDLTGGSIEAA+VLD+ G  D F+Y+E++Y+G NG LPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
            +  AEHEG+KVSLHG   D++     +SRLK++    KN AL+GV++ YGNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QALTLKARGDTN-HDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359
           Q++TL+ARG     DVT+FGRV EAMFRSINNLLEKFHQSFFFY +LAPR+FVSI SYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419
           + V +SI FA+AS++S+ NN Y ++   S Y LLS +FW VS++V F + N F Y P P 
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479
           +LL  N++I   P     N  + + L+YRL++ +F+++SL++TSLL+VNFPLAFGMGL +
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 YPMTLVMLNNTDN---LRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAW 536
           +PMT V    +D     R + +NS+LL +SNPFIA WLF  + +++  G++    LV A 
Sbjct: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540

Query: 537 NKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577
            +LG WTW + C+GW+  W+LVAISAL   ++  +    K 
Sbjct: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKK 581

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/567 (54%), Positives = 415/567 (73%), Gaps = 5/567 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXX-XXXYLPMDGQFRRTYISENALM 59
           M+++E LQRR+ID G                           LP++GQ+R TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119
           PSQAYSYFRETEWNILRGYR +I+VL   SS ERN +++SW +EFG KT+ Y++  +G++
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           +YGV +APRGDGTE+MVLA PWYN + E+N+ GAAL  +L+RF SRWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239
           +P  +LRSWV AYHTSLDLTGGSIE+AVVLDYPG +D+F+Y+E++Y G NG LPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299
           +A+ I EHEG+KVSL+G++ +EM   +Y+S++K + +G K +AL+GV+  YGNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           IQA+ L+ARG D   D+TTFGR+ EA FRS+NNLLEKFHQSFFFY LLAPRYFVSI SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PAAV  S+SF VA++D  + +   +    S +NL + I + V++++ F L   F+++   
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
            LL+  N VI+ +P    +   I    +Y+ K+++F+YLS+V+TSLLV+NF LAFG+GL 
Sbjct: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+P+ LV    T   R+K  N+ILL +SNPFI+  LF+   E +L G++  + LV AW K
Sbjct: 480 AFPLILVKAPMTSRQRVK--NTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQK 537

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKV 565
           LG WTW + CIGW PSW+LVA S + +
Sbjct: 538 LGCWTWSVVCIGWLPSWLLVACSGIPM 564

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/578 (53%), Positives = 407/578 (70%), Gaps = 5/578 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXX-XXXYLPMDGQFRRTYISENALM 59
           M++LE L RR++D G                          +LP++GQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119
           PSQAYSYFRE+EWNILRGYR+E+E L      ERN I++SW+EE+G KTS+  N +YG++
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           LYG+ +  RGDGTE+MVLA PW   +  +N  GAAL +SLAR+ +RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239
           +P+ +LR+WV+AYHT LDLTGGSIE+AVVLDYPG +DYF+YIE+ YNG NG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299
            A+ I+EHEG+KVSLHG+   E+    Y  RLK +  G K++ L G++   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           IQ++TLKA G D   DVTTFGRV EA+FRS+NNLLEKFHQSFFFY LL+PR FVSIGSYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PAA+ LS SFA+AS DS +NN+Y  +   S YN+ +   +AV++++ F    +F Y P P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
            LLL  NV +S I     K   I +P +YR K  + +Y S+V+TSLLVVNF LA  +G+ 
Sbjct: 421 SLLLAFNVALSFISFTVIK-YKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+PM+L        ++ K RNS+LL  SNPFIA W+   + E++L G    + L+DAW +
Sbjct: 480 AFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQ 539

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576
           LG WTW++ CIGW+PSWILVA S+  ++ +     SKK
Sbjct: 540 LGCWTWYVLCIGWYPSWILVAYSS--IDSIPIVTTSKK 575

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/578 (54%), Positives = 424/578 (73%), Gaps = 10/578 (1%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           MS+L+ + RRL + G                          LP+DGQ+RRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRETEWNILRGYR +IE L   S  +RN +++ WL+E GLKT++Y+++++G +L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV +A RGDGTE+MVLA+PW N +D+FN+ GAALGVSL++F  RWPVWSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
              ALR+WV+AYHTSLDLT GSIEAAVVLDYP  SD+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           A+SI EHEG+KVSLHGL P+EM N DY++RLK++ +G KN AL+GV+ ++GNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QALTLKARGDTNH-DVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359
           Q++TL+A G+    D+T FGR+ EAMFRS+NNLLEKFHQS+FFY LLAPR FVSI +YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419
           +AV++S++FAV S+DS +NN Y+S+  SS   L+ FI  + SV V F +       P   
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LLLLGNVVISTIPLA-APKNLS-ISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477
            LL G+V ++ +PL  + KN+  I++ +AYRLK+I  +Y SL++TSLL+VNF L F +GL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 FAYPMTLVMLNNTDNLRLKTRNSIL-----LAISNPFIAFWLFITIVESKLDG-IEAIYG 531
            A+P+T + + +T  +  ++R SIL     L I+NPFI+ WLF   +++  +G    IY 
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540

Query: 532 -LVDAWNKLGSWTWFIFCIGWFPSWILVAISALKVEQV 568
            ++ +W+ LG WTWFI C+GW P W++  IS++  + +
Sbjct: 541 RMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPI 578

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/578 (53%), Positives = 421/578 (72%), Gaps = 5/578 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXX-XXXYLPMDGQFRRTYISENALM 59
           M++LE L R+++D G                          +LPM+GQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119
           PSQAYSYFRE+EWNILRGYR EI+ + + ++ ERN I++SW+EE+G K +VY +  +G++
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           LY V +A RGDGTE+MVLA PW   E ++N  G AL V++ R+ SRWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239
           +P  +LRSWV+AYHT LDLTGGSIEAA+VLDYPG +DYF+++E+ Y G NG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299
           +A+ I EHEG+KV+LHG   +E+G   Y+SR++++  G K++AL+G++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           IQ++TLKARG + + D+TTFGRV EAMFRS+NNLLEKFHQSFFFY LLAPRYFVSIGSYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PAAV LSISFAV + DS +NN++ S+   S YN+ + + ++V+++V       F Y P P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
            LLL  NVV+S +P A  K   I +P ++R K  +++Y S V++SLLV+NF LAF +GL 
Sbjct: 421 ALLLAFNVVVSFMPFALVK-YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+PMT V      ++R K +NS+LL +SNPFI+  +F+ + E +L G    Y L+DAWN 
Sbjct: 480 AFPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWND 539

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576
           LG WTW++ C+GW+P+WI+VA S+  ++ V     +KK
Sbjct: 540 LGCWTWYVLCLGWYPAWIMVAYSS--IDSVPIAAPAKK 575

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/581 (53%), Positives = 418/581 (71%), Gaps = 3/581 (0%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M+++E L RR    G                          LP+DGQ+RRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRE+EWNILRGYR  IE L    +  RN ++SSWL +FG+K +VY N   GD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGV+N+ RGDGTE++VLAVPWYN ++E N+ GAALG+SL+R+ SRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P +A++SWV+AYH SLDLTGGS+EAA+VLD+P  S+YFE++E+++NG NG LPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
           AIS+ EHEG+KVSL GL   EM    Y++RLK +  G KN AL+G R++YGNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360
           QALTLKA G   HD+TTFGR+ EA+FRS+NNLLEKFHQSFFFYFL+APR+FVSIGSYLP+
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420
           AV LSISF +++  S++NNQY+++  S   ++L+ I +  S+ + F        + QP L
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 LLLGNVVISTIPLA-APKNLSISEP-LAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
           ++L  ++IS +PL   P+ L   +P L+YRLK+ +F+Y+SLV+TSLLV+NF LAFGMGL 
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 479 AYPMTLVM-LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537
           A+P+T     +     + K  N   LAISNPFIA ++F++I E  +   E    L+ ++ 
Sbjct: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540

Query: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKHL 578
            +G+WTW I CIGWF +W +V I+ L   +   + ++KK+L
Sbjct: 541 YMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKNL 581

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/578 (54%), Positives = 426/578 (73%), Gaps = 6/578 (1%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXX-XXXYLPMDGQFRRTYISENALM 59
           M+++E LQR++ID G                           LP++GQ+R TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119
           PSQAYSYFRETEWNILRGYR +I+ L + SS+ERN I+ SWL+EFG+KT++Y+++  G++
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           LYGV +APRGDGTE+MVL+ PW+N + EFN  G AL V+LAR+ SRWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239
           +P+ +LRSWV+AYHTSLDLTGGSIE+AVVLDYPGV+D+F+Y+E++Y G NG LPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299
           +AI + EHEG+KVSL+G+  DEM N DY++R+K + +G K +AL+GV+  YGNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQALTLKARGDTN-HDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358
           IQA+ L+ARGD    D+TTFGRV EA+FRS+NNLLEKFHQSFFFY LLAPRYFVSI SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418
           PAAV  S+SF VA++D+ +     +       N+ + + + V+++  F +  +F  +  P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478
           ++L+  +V+ +  P+   + + I    A+RLK ++++YLS+V+TSLLVVNF LAFG+GL 
Sbjct: 421 VILISWSVMTALAPILLNR-VRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538
           A+P  L+++ N+   RL  +NS+LL +SNPFI+  LF    E  L G++ +  LV AWN+
Sbjct: 480 AFP--LILVKNSTTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNE 537

Query: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576
            G WTW + CIGW PSW+L+A S++ +  V T  NS +
Sbjct: 538 FGCWTWCVVCIGWLPSWLLIAYSSM-ITDVSTLLNSAE 574

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/583 (54%), Positives = 417/583 (71%), Gaps = 7/583 (1%)

Query: 1   MSILENLQRRLIDAGXXXXXXXXXXXXXXXXXXXXXXXXXYLPMDGQFRRTYISENALMP 60
           M +LE +QR ++  G                          LPMDGQ+R TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120
           SQAYSYFRETEWNI+RGYR E+  + + +S ERN IM SWL EFG+KT +Y+N++  + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180
           YGVF+APRGDGTE++VLAVPW+N + EFN +GAA+GV+LAR+ SRWPVWSKNIIVVFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240
           P  ALRSWVEAY+TSLDLTGGSIEAA+VLD PG +DYF+Y+EV+Y+G NG LPNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300
            I IAEHEG++VSLHG   D++   +YW+RLK++    ++ A +G+ + +GNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QALTLKARGDTNH-DVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359
           Q++TLK +G++   D+T FGRV EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419
           +AV+LS++F +A +DS++NN   ++   S Y L+  I W V+++ CF L   F   P P 
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479
           LLLL N+VIS   +           ++ RL++ +F++LSL++TSLL+VNFPL+F +GL A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 480 YPMTLVM-LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESK----LDGIEAIYGLVD 534
           +PMT V  +      ++K  N ILL ISNPFIA  ++  +  +     L G+  I  L+ 
Sbjct: 480 FPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLIS 539

Query: 535 AWNKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577
           AW  +  WTWF+ C+GW PSWI+VAIS ++ E+  T  + KK+
Sbjct: 540 AWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/507 (57%), Positives = 376/507 (74%), Gaps = 9/507 (1%)

Query: 43  PMDGQFRRTYISENALMPSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLE 102
           P+DGQ+R TYISENALMPSQAYSYFRETEWNILRGYR ++E +      ERN IM +WL 
Sbjct: 43  PIDGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLN 102

Query: 103 EFGLKTSVYKNQEYGDSLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARF 162
           + G KT  + N     ++YG+F++PRGDGTE++VLA+PW+N+E +FN  GAALGVSLARF
Sbjct: 103 DIGAKTDTHNNS----TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARF 158

Query: 163 LSRWPVWSKNIIVVFSENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIE 222
             RWP+WSKNIIVVFSE+   +LRSWVEAYHTSLDLTGGSIEAAV+LDY   SD+F+Y+E
Sbjct: 159 FWRWPIWSKNIIVVFSEDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVE 218

Query: 223 VHYNGYNGVLPNLDLVNIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLA 282
           +HY+G NG LPNLDLVNIA+SI EHEG+KVSLHGL  +E+     WSR KM+    K+ +
Sbjct: 219 IHYDGLNGELPNLDLVNIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSS 278

Query: 283 LTGVREVYGNEAFSGWRIQALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFF 342
           L G+++ +GNEAFSGWRIQALTLKA G+   D+TTFGR+ EAMFRSINNLLEKFHQSFF+
Sbjct: 279 LAGIKKPHGNEAFSGWRIQALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFY 338

Query: 343 YFLLAPRYFVSIGSYLPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSV 402
           Y LLAPR FVSI SYLPAAV LS++FA +S+  FVN+   S+   S Y L + I W +S+
Sbjct: 339 YLLLAPRNFVSISSYLPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSI 398

Query: 403 IVCFFLGNSFTYYPQPLLLLLGNVVISTIPLAAPKNLSISE---PLAYRLKTISFMYLSL 459
              F    ++  Y  P++L+   ++ S IPL + + L ++E    +A+R+K  +F Y SL
Sbjct: 399 TFSFCFAITYLKYTFPVMLMFICILFSFIPLIS-RGLPLAETKITVAHRMKAFAFGYFSL 457

Query: 460 VMTSLLVVNFPLAFGMGLFAYPMTLVMLNNT-DNLRLKTRNSILLAISNPFIAFWLFITI 518
           V+TSLL++NFPLA  +G+ A+PMTLV ++NT        +NS+LL +SNP+I+   F  I
Sbjct: 458 VLTSLLMINFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNI 517

Query: 519 VESKLDGIEAIYGLVDAWNKLGSWTWF 545
            +S+L G+  +  L+ AWN +  WTWF
Sbjct: 518 FDSELTGLATLDRLIPAWNDMNCWTWF 544

>Kwal_23.4381 s23 complement(694167..695480) [1314 bp, 437 aa] {ON}
           YHR174W (ENO2) - enolase [contig 1] FULL
          Length = 437

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 62/139 (44%), Gaps = 28/139 (20%)

Query: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179
           LY    A  G  TE+ VL VP+ N  +  + +G AL  +L  F+         I    +E
Sbjct: 130 LYKHLAALSGSNTENFVLPVPFLNVLNGGSHAGGAL--ALQEFM---------IAPTGAE 178

Query: 180 NPREALRSWVEAYHTSLDLT----GGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNL 235
           +  EA+R   E YHT   LT    G S  A  V D  GV+   +  E            L
Sbjct: 179 SFSEAMRIGSEVYHTLKSLTKKRYGAS--AGNVGDEGGVAPNIQTAE----------EAL 226

Query: 236 DLVNIAISIAEHEGLKVSL 254
           DL+  +I IA +EG KVS+
Sbjct: 227 DLIVDSIKIAGYEG-KVSI 244

>KLLA0D15180g Chr4 (1284273..1291412) [7140 bp, 2379 aa] {ON} weakly
           similar to uniprot|Q06116 Saccharomyces cerevisiae
           YPR117W Hypothetical ORF
          Length = 2379

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 3/119 (2%)

Query: 271 LKMISLGTKNLALTGVREVYGNEAFSGWRIQALTLKARGDTNHDVTTFGRVA---EAMFR 327
           +K I++ TK L +T   +++  E    +++  L  + R +      +  ++A   E + +
Sbjct: 802 MKHINVKTKTLTITVNEDLFEQELGLIYKVGVLEQRERLEKLTLFLSSDKLAGTEEYLNQ 861

Query: 328 SINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPAAVVLSISFAVASIDSFVNNQYVSMVD 386
               L E F  S+   + +A R F    SY     +L   F+  S+D+ VN+  +S+ D
Sbjct: 862 QYTRLYENFSTSWIARYRVAKRKFHGAESYAVNNTILDYEFSTFSVDNDVNSLKISIED 920

>CAGL0L13090g Chr12 (1397800..1400046) [2247 bp, 748 aa] {ON} some
           similarities with uniprot|P38830 Saccharomyces
           cerevisiae YHR124w meiosis-specific protein
          Length = 748

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 189 VEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYN 226
           V+ Y   +DLT  +I+++V++D   +    EY  +HYN
Sbjct: 455 VDRYSNEVDLTSQNIDSSVLIDKSALEAIIEYNALHYN 492

>KNAG0A01410 Chr1 complement(49093..50640) [1548 bp, 515 aa] {ON}
           Anc_3.53 YOL119C
          Length = 515

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 350 YFVSIGSYLPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLG 409
           Y V  GS++    V     ++ +I+S+V+   ++ V SS  + +  ++ A+S I C F G
Sbjct: 111 YLVVFGSFMGLIPVFGTINSLGAIESYVSKHQLATVSSSTISWIFSLYLAISFISCIFAG 170

Query: 410 NSF 412
           + F
Sbjct: 171 SYF 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,389,299
Number of extensions: 2421824
Number of successful extensions: 6369
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6494
Number of HSP's successfully gapped: 45
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)