Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.368.258ON42742722990.0
Smik_12.1448.258ON43843916180.0
TDEL0F038508.258ON41942816160.0
YLR085C (ARP6)8.258ON43844116060.0
NCAS0B049908.258ON42042715920.0
Suva_10.1698.258ON43843915940.0
Skud_12.1538.258ON43844115940.0
ZYRO0C01738g8.258ON41442715630.0
NDAI0B019608.258ON43944115480.0
TBLA0H014608.258ON44244415460.0
KAFR0B027008.258ON42042915300.0
TPHA0A018308.258ON42142915170.0
KNAG0G020108.258ON42442815050.0
KLTH0G13772g8.258ON42042714760.0
CAGL0L12166g8.258ON42142214740.0
SAKL0H17138g8.258ON41942814510.0
Kwal_56.238328.258ON41942714420.0
Ecym_43128.258ON41142314090.0
AGR091W8.258ON41042314030.0
KLLA0F19063g8.258ON41543113800.0
NCAS0C037008.23ON3754392517e-23
TBLA0C004408.23ON3754392507e-23
NDAI0G030408.23ON3754392509e-23
TDEL0C004708.23ON3754392491e-22
TPHA0D002508.23ON3754392491e-22
CAGL0K12694g8.23ON3754392491e-22
Suva_6.188.23ON3754392491e-22
Smik_6.398.23ON3754392491e-22
YFL039C (ACT1)8.23ON3754392491e-22
KNAG0L002508.23ON3754392491e-22
KAFR0D009408.23ON3754392491e-22
Ecym_15208.23ON3764372482e-22
ABR222W8.23ON3764392472e-22
ZYRO0F02772g8.23ON3754392462e-22
Kpol_1058.158.23ON3754392454e-22
SAKL0B00968g8.23ON3754392436e-22
KLTH0G18832g8.23ON3754392383e-21
KLLA0D05357g8.23ON3754392383e-21
Skud_6.318.23ON3603902322e-20
KLTH0F06490g3.161ON3913742243e-19
NDAI0G029003.161ON3913762243e-19
Kwal_14.11098.23ON3603902224e-19
ZYRO0B04928g3.161ON3913782224e-19
ADR316W3.161ON3913762209e-19
TBLA0F008703.161ON3913762209e-19
TDEL0D046103.161ON3913742191e-18
CAGL0K01595g3.161ON3913742172e-18
SAKL0C07370g3.161ON3913742163e-18
Ecym_52373.161ON3913722163e-18
KLLA0C03850g3.161ON3913762163e-18
Suva_4.2203.161ON3913762163e-18
NCAS0C035503.161ON3923762154e-18
YDL029W (ARP2)3.161ON3913762154e-18
Smik_4.2063.161ON3913762145e-18
KNAG0K01130na 1ON3933762136e-18
SAKL0E11814g2.117ON3794222128e-18
Ecym_63852.117ON3774212129e-18
Skud_4.2223.161ON3913762129e-18
NDAI0B044602.117ON3813752083e-17
KLLA0E22925g2.117ON3804212065e-17
AFR051W2.117ON4054232058e-17
Kpol_479.253.161ON3913762022e-16
Kwal_33.141773.161ON3373132002e-16
ZYRO0G05676g2.117ON3813752003e-16
NCAS0B071302.117ON3813772003e-16
TPHA0I013002.117ON3793751951e-15
TDEL0B048102.117ON3734261914e-15
TPHA0A009203.161ON3913761915e-15
KLTH0B05940g2.117ON3834261872e-14
Kpol_1023.188.23ON3193441832e-14
KAFR0C01040na 1ON3373151799e-14
SAKL0E08602g2.248ON7471421766e-13
NDAI0D010602.248ON7531381768e-13
KNAG0I018602.248ON7531381732e-12
TDEL0C041402.248ON7491421722e-12
Smik_14.2672.248ON7551331722e-12
Skud_8.1902.117ON3843931693e-12
Suva_14.2812.248ON7551351704e-12
KAFR0F005902.117ON3863911675e-12
Kwal_33.146422.117ON3834211666e-12
YNL059C (ARP5)2.248ON7551331687e-12
Ecym_32852.248ON7461391661e-11
Smik_8.2102.117ON3843741631e-11
Kwal_23.48482.248ON7451391652e-11
TBLA0B010702.117ON3833741622e-11
YHR129C (ARP1)2.117ON3843741622e-11
Suva_15.3262.117ON3843731613e-11
CAGL0H09042g2.117ON3873741613e-11
Skud_14.2722.248ON7551351614e-11
TBLA0E038602.248ON7591511598e-11
AFR419C1.514ON4553281561e-10
KLTH0G09482g2.248ON7451341571e-10
ZYRO0A01584g2.248ON7481351526e-10
ADL253C2.248ON7511351526e-10
KNAG0H036502.117ON3873771497e-10
TPHA0C031602.248ON7551291518e-10
Kpol_282.41.287ON5015301481e-09
TDEL0F004701.514ON4611931462e-09
SAKL0D12804g1.514ON4563351462e-09
KNAG0B001701.514ON4533261462e-09
ZYRO0G01936g1.514ON4613261453e-09
YJR065C (ARP3)1.514ON4493341453e-09
CAGL0F00517g1.514ON4543341444e-09
KAFR0D037001.514ON4493301435e-09
NDAI0A039701.514ON4623281435e-09
Smik_10.3551.514ON4493281436e-09
KLLA0B13904g1.514ON4563281427e-09
Skud_10.2891.514ON4493281418e-09
NCAS0A122701.514ON4543341419e-09
Suva_12.1541.514ON4493281391e-08
Kpol_1003.162.248ON7491331402e-08
TPHA0O010401.514ON4583281392e-08
KLTH0C02508g1.514ON4513311382e-08
Kwal_27.99581.514ON4453321373e-08
Ecym_31531.514ON4581871364e-08
Kpol_1056.161.514ON4603281365e-08
CAGL0J10054g2.248ON7541331365e-08
NDAI0G055801.287ON5152351357e-08
KLLA0F03421g2.248ON7471401358e-08
TBLA0D036801.514ON4583261331e-07
Smik_10.1611.287ON4892261331e-07
ZYRO0G21428g1.287ON4835161321e-07
KAFR0J011602.248ON7511381251e-06
YJL081C (ARP4)1.287ON4892261231e-06
Suva_6.1541.287ON4892261222e-06
TPHA0I010301.287ON5035301213e-06
KLTH0H09702g1.287ON4813451187e-06
Skud_10.1321.287ON4882281161e-05
Kwal_14.23771.287ON4812281161e-05
Ecym_63301.287ON4803521161e-05
CAGL0M03201g1.287ON4932381142e-05
NCAS0G030502.248ON7431221143e-05
KNAG0B019201.287ON5052451124e-05
KLLA0D02288g1.287ON5201081107e-05
AFR105C1.287ON4792291071e-04
NCAS0B060601.287ON4972331025e-04
KAFR0A015601.287ON485485990.001
ACR184C7.448ON401267930.006
SAKL0F13772g7.448ON422292930.007
TDEL0D015501.287ON48092930.008
SAKL0D05874g1.287ON497108910.013
TBLA0D053601.287ON596107880.030
KLTH0C05324g7.448ON399231840.072
Kwal_27.105527.448ON351229830.11
Kpol_520.117.448ON488278800.26
ZYRO0F11374g7.333ON51096780.42
KAFR0B022908.184ON30382770.47
CAGL0I10901g8.604ON816112770.73
KAFR0D028102.414ON561128741.7
TDEL0C031207.448ON438459713.2
NDAI0B013302.600ON26237679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.36
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   890   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   627   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   627   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   623   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   617   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   618   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   618   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   606   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   600   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   600   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   593   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   588   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   584   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   573   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   572   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   563   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   560   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   547   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   545   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   536   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   101   7e-23
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   100   7e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   100   9e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   100   1e-22
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   100   1e-22
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   100   1e-22
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   100   1e-22
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   100   1e-22
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   100   1e-22
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   100   1e-22
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   100   1e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   100   2e-22
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   100   2e-22
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    99   2e-22
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    99   4e-22
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    98   6e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    96   3e-21
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    96   3e-21
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    94   2e-20
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    91   3e-19
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    91   3e-19
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    90   4e-19
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    90   4e-19
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    89   9e-19
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    89   9e-19
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    89   1e-18
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    88   2e-18
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    88   3e-18
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    88   3e-18
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    88   3e-18
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    88   3e-18
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    87   4e-18
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    87   4e-18
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    87   5e-18
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    87   6e-18
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    86   8e-18
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    86   9e-18
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    86   9e-18
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    85   3e-17
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    84   5e-17
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    84   8e-17
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    82   2e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    82   2e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    82   3e-16
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    82   3e-16
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    80   1e-15
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    78   4e-15
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    78   5e-15
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    77   2e-14
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    75   2e-14
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    74   9e-14
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    72   6e-13
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    72   8e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    71   2e-12
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    71   2e-12
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    71   2e-12
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    70   3e-12
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    70   4e-12
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    69   5e-12
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    69   6e-12
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    69   7e-12
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    69   1e-11
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    67   1e-11
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    68   2e-11
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    67   2e-11
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    67   2e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    67   3e-11
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    67   3e-11
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    67   4e-11
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    66   8e-11
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    65   1e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    65   1e-10
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    63   6e-10
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    63   6e-10
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    62   7e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    63   8e-10
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    62   1e-09
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    61   2e-09
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    61   2e-09
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    61   2e-09
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    60   3e-09
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    60   3e-09
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    60   4e-09
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    60   5e-09
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     60   5e-09
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    60   6e-09
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    59   7e-09
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    59   8e-09
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    59   9e-09
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    58   1e-08
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    59   2e-08
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    58   2e-08
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    58   2e-08
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    57   3e-08
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    57   4e-08
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    57   5e-08
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    57   5e-08
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    57   7e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    57   8e-08
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    56   1e-07
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    56   1e-07
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    55   1e-07
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    53   1e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    52   1e-06
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    52   2e-06
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    51   3e-06
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    50   7e-06
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    49   1e-05
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    49   1e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    49   1e-05
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    49   2e-05
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    49   3e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    48   4e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    47   7e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    46   1e-04
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    44   5e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    43   0.001
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    40   0.006
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    40   0.007
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    40   0.008
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    40   0.013
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    39   0.030
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    37   0.072
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    37   0.11 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    35   0.26 
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    35   0.42 
KAFR0B02290 Chr2 complement(450325..451236) [912 bp, 303 aa] {ON...    34   0.47 
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    34   0.73 
KAFR0D02810 Chr4 complement(559344..561029) [1686 bp, 561 aa] {O...    33   1.7  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    32   3.2  
NDAI0B01330 Chr2 (307444..308232) [789 bp, 262 aa] {ON} Anc_2.60...    30   9.0  

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/427 (100%), Positives = 427/427 (100%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420
           LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR
Sbjct: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420

Query: 421 FGYQNWI 427
           FGYQNWI
Sbjct: 421 FGYQNWI 427

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/439 (67%), Positives = 354/439 (80%), Gaps = 13/439 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME  PIVIDNGSYE+KFG S  + P RALNALAKDK+G  YLSN + NIKDISSVT RRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL  WELE  +WDYCFFNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDV--------MGDLISN--MDSQNI 169
           EEYEF+SLFKSPVA FVPF  + +  MK I GK +D           D+ SN   D+Q  
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTD 229
            + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++ D
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLPEN 288
           ETILVNNIKEKCLF+SP SY DSFK KD+++++YVLPDFQTSF+GYV++ +K NS L E+
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
           +Q ITLTDELF++PET FHPE+A++ KPGIVE ILESLS++PE +RPL+V NIVC GGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408
           N+PNF  RLA ELQRQLPTDW C++ +PE DC L GW+ MSQF+ +T  Y+ AR++REEY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFS-STASYRNARVTREEY 419

Query: 409 YEHGTDWTTKKRFGYQNWI 427
           YEHG+DW TK RFGYQNWI
Sbjct: 420 YEHGSDWCTKHRFGYQNWI 438

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/428 (67%), Positives = 351/428 (82%), Gaps = 10/428 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME  P+V+DNGSYEVKFGYS    P RALNALA+DK+GA YLSNQ+N IKDISSV+ +RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HE GQL SWEL+  VWDYCFFNP+EF  F+LK++KG HL+ SETCMTLPELS NMDQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEF+SL K+P++GF+PF    +N K+I GKGD   G   S          Y  F +VI
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKD------YEPFQMVI 174

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNCTW++PIIKGVP+YKAVKK+++GGRF+NGL KET+S+RHY+V DETILVNNIKEK
Sbjct: 175 DSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEK 234

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLFMSP SY DSF  KD+ +V+YVLPDFQT+F+GYV D+K+     +++Q +TL DELFS
Sbjct: 235 CLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS--KDAQTVTLRDELFS 292

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPE+A+LLKPGI+ETILESLS+VPE +RPL+V+NI+C GGNFN+P+F  RLATE
Sbjct: 293 VPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATE 352

Query: 361 LQRQLPTDWVCNIYIPE-KDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419
           LQRQLPTDW   IY+P+ K CEL GW SMS FA +TD+YK AR+SR+EYYEHG +WTTK 
Sbjct: 353 LQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQEYYEHGVEWTTKN 411

Query: 420 RFGYQNWI 427
           RFGYQNWI
Sbjct: 412 RFGYQNWI 419

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 356/441 (80%), Gaps = 17/441 (3%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME  PIVIDNGSYE+KFG S  K P RALNALAKDK+G  YLSN + NIKDISS+T RRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL  WELE  +WDYC FNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISNM------------DSQ 167
           EEYEF+SLFKSPVA FVPF  + +  M+ I GK +D+  D++               ++Q
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDI--DIVRGNSDSTNSTSSESKNAQ 178

Query: 168 NIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDV 227
           +  + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++
Sbjct: 179 DSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNM 238

Query: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLP 286
            DETILVNNIKE+CLF+SP SY DSFK KD+++++YVLPDFQTSF+GYV++ +K N  LP
Sbjct: 239 MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLP 298

Query: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346
           E++Q+ITLTDELF++PET FHPE++++ KPGIVE ILESLS++PE +RPL+V NIVC GG
Sbjct: 299 EDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358

Query: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406
           NFN+PNF  RLA ELQRQLPTDW C++ +PE DC L GW+ MSQFA+ TD Y+KAR++RE
Sbjct: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAK-TDSYRKARVTRE 417

Query: 407 EYYEHGTDWTTKKRFGYQNWI 427
           EYYEHG DW TK RFGYQNWI
Sbjct: 418 EYYEHGPDWCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/427 (67%), Positives = 351/427 (82%), Gaps = 7/427 (1%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME +PI IDNGSYE+KFG +D   P RA+NA A DKY   YLSNQ+ NIKDI+SVT RRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL SWELE ++WDY  FNPDEFP F+L + KG HL+ SETCMTLPELS NMDQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEF+S +KS +AGF+ F +   N K+I GK ++   D+  +  +Q  +  Y+D+ LVI
Sbjct: 121 EEYEFDSYYKSSIAGFIQFAD-DKNTKIISGKTEE---DISLDSVNQVREKEYNDYQLVI 176

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNCTWIIP+IKGVPYYKAVKK+++GGRFL+GL KET+S+RHYDV DETILVNNIKE 
Sbjct: 177 DSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKEN 236

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLF+SPTSY DSFKNK+  +V+YVLP+FQT+F+G+V+DK     LPEN+Q I L DELFS
Sbjct: 237 CLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDK--TKPLPENTQTIKLYDELFS 294

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPE+A++LKPG+VETILESLS+VPE +RPLLV N+VC GGNFN+P+F +RL +E
Sbjct: 295 VPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSE 354

Query: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420
           LQRQLPTDW+C   +P K+CEL GWK+M+QFA +T+ Y+K R++REEYYEHGTDW TK R
Sbjct: 355 LQRQLPTDWICRTSVPTKECELFGWKAMAQFA-STESYRKTRVTREEYYEHGTDWLTKNR 413

Query: 421 FGYQNWI 427
           FGYQNWI
Sbjct: 414 FGYQNWI 420

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/439 (66%), Positives = 353/439 (80%), Gaps = 13/439 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME  PIVIDNGSYE+KFG S  K+P RALNALAKDK+G  YLSN + NIKDISSVT RRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL  WELE  +WDYC FNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISN----------MDSQNI 169
           EEYEF+SLFKSPVA FVPF  + +  M+ I GK +D    +  +          +D  N 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTD 229
            N Y DF LVIDSGF+CTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++ D
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLPEN 288
           ETILVNNIKEKCLF+SPTSY DSFK+K+++ ++YVLPDFQTSFIGYV+   + +S LP +
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
           +Q ITLTDELF++PET FHPE+++++KPGIVE ILESLS++PE +RPL++ NIVC GGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408
           N+PNF  RLA ELQRQLPTDW CN+ +PE DC L GW+ MSQFA+ T+ Y++AR++REEY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAK-TESYQRARVTREEY 419

Query: 409 YEHGTDWTTKKRFGYQNWI 427
           YEHG DW TK RFGYQNWI
Sbjct: 420 YEHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 358/441 (81%), Gaps = 17/441 (3%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME++PIVIDNGSYE+KF  S  ++P RALNALAKDK+G  YLSN + NIKDISS+T RRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL  WELE  +WDYCFFNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISN------------MDSQ 167
           EEYEF+SLFKSPVA FVPF  + +  +K I GK ++   D++++              +Q
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEE--ADVVTSNSGITTFTSRECGSAQ 178

Query: 168 NIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDV 227
           N  + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++
Sbjct: 179 NSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNM 238

Query: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLP 286
            DETILVNN+KEKCLF+SP SY DSFK KD+++++YVLPDFQTSFIGYV++ ++ NS LP
Sbjct: 239 MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLP 298

Query: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346
           E++Q I LTDELF++PET FHPE++++ KPGIVE ILESLS++PE +RPL+V NIVC GG
Sbjct: 299 EDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358

Query: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406
           NFN+PNF  RLA ELQRQLPTDW C++ +P  DC L GW+ MSQFA+ T+ Y++AR++R+
Sbjct: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAK-TESYRRARVTRD 417

Query: 407 EYYEHGTDWTTKKRFGYQNWI 427
           EYYEHG DW TK+RFGYQNWI
Sbjct: 418 EYYEHGPDWCTKQRFGYQNWI 438

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/427 (65%), Positives = 341/427 (79%), Gaps = 13/427 (3%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME  PIV+DNGSYE+KFG  D + P+RA NALA+DK+G++YLSNQ+  IKDISSV  RRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HE GQL SWELE  +WDYCFFNPDEF  F+LK++KG HLVVSETCMT+PELS NMDQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEF S+FKSP+AGF PF         I GKGDD         + +   + Y  F LVI
Sbjct: 121 EEYEFASMFKSPIAGFAPF---GRPSIAISGKGDD-------QPNRKAEPDAYEPFQLVI 170

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           D GFNCTW++P+IKG+PYYKAVKK+++GGRFLNGL KET+S+RHY+V DETILVNNIKE 
Sbjct: 171 DVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEN 230

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLF+SP SY +SFK+K++ +V+YVLPDFQTSF+GYVKD K    LP++SQ + L DELFS
Sbjct: 231 CLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPK--KPLPQDSQTVELKDELFS 288

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPE+ +LLKPGI+ETILESLSI+PE +RPL++ NIVC GGNFN+PNF +RLATE
Sbjct: 289 VPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATE 348

Query: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420
           LQRQLPTDW C +++P    EL GW SM+ F  N+ +Y  AR++REEY+EHG DW T+ R
Sbjct: 349 LQRQLPTDWTCTVHLPSGPKELYGWSSMASFT-NSPLYSDARVTREEYFEHGVDWCTRHR 407

Query: 421 FGYQNWI 427
           FGYQNW+
Sbjct: 408 FGYQNWM 414

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/441 (64%), Positives = 347/441 (78%), Gaps = 16/441 (3%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           M+  P+V+DNGSYE+KFG S+++ P RALN  A DKYG+ YLSNQM  I+++S VT+RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL SWELE  +WDYC +NPDEF  F L  +   HL+VSE CMTLPELS NMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKM----ICGK--GDDVMGD------LISNM--DS 166
           EEYEF+SLFK+P AG++PF    D+ K+    I GK   DD++G          N+  D 
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
           +   N Y D+ LVIDSGFNCTWIIP+IKGVPYYKA+KK+++GGRFL GL KET+S+RHYD
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 227 VTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLP 286
           + DET+LVNNIKEKCLF+SPTSY DSFK K+  SV+Y+LPD  +S++GY ++ KS   LP
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKP-LP 299

Query: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346
           E SQV+ L DELFSVPET FHPE++++LKPGIVETILESLS++PE +RPLLV NIVC GG
Sbjct: 300 EGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGG 359

Query: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406
           NFN+P+F +RLA ELQRQLPTDW C I +P+K+CEL  WKSM QFA NTD YKK RIS+E
Sbjct: 360 NFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRISKE 418

Query: 407 EYYEHGTDWTTKKRFGYQNWI 427
           EYYEHG DW TK +FGYQNW+
Sbjct: 419 EYYEHGPDWLTKHKFGYQNWL 439

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/444 (63%), Positives = 357/444 (80%), Gaps = 19/444 (4%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           M+  PIVIDNGSYE+KFG S++++P RA+NA+AKDKY   YLSNQ+  IKDISSV  RRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           +ELGQL SWELE  +WDYCF+NP+EF  F L++T   HLV+SETC++LPE S N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDD-------------VMGDL---ISNM 164
           EEY + S++KSPVAGF+PF +L  ++  I GK DD             V  DL   IS+ 
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 165 DSQNIKNP-YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYR 223
           +    K   Y DF L+IDSGFNCTWIIP+IKG+PYYKA+KKM++GGRFL GL KET+S+R
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 224 HYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNS 283
           HY+VTDETILVNNIKEKCLF++P SY +SFK K++ +V+YVLPDF T+F+GY+KD  S +
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKD-NSKT 299

Query: 284 QLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVC 343
           +LP+N+Q+ITL DELFSV ETIFHPE++++LKPGI+ETI+ESLS++PE IRPL+VNNIVC
Sbjct: 300 KLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVC 359

Query: 344 VGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARI 403
           +GGNFN+PNF  RL +ELQRQLPTDW  ++YIP+ D EL GWK+M+QF+ +TD Y+KARI
Sbjct: 360 IGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARI 418

Query: 404 SREEYYEHGTDWTTKKRFGYQNWI 427
           +REEY EHG +W TK RFGYQNWI
Sbjct: 419 TREEYMEHGVEWCTKHRFGYQNWI 442

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/429 (65%), Positives = 345/429 (80%), Gaps = 11/429 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME+ P+VIDNGSY VKFG +  + P  ALNA+A DKY A YLSNQ+ +IKDISSV+I+RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           H LGQL SWE++  +WDYC +NPDEF  FN+ +TK  HL+ SETCMTLPEL  NMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLV 179
           EEYEF SL KSPVAG++PFL N +D  ++I G+ D      +    ++     Y DF LV
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKD--QIIIGERD--TEPFVETPSTEE----YRDFQLV 172

Query: 180 IDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKE 239
           +DSGFNCTWIIP+IKG+PYYKAVKK+++GGRFLNGL KET+S+RHY+V DETILVNNIKE
Sbjct: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKE 232

Query: 240 KCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQ-LPENSQVITLTDEL 298
           KCLF+SP SY DSFKNKD  S +YVLPDFQTSF+GYV+      + LPE+SQ ITL DEL
Sbjct: 233 KCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292

Query: 299 FSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLA 358
           F+VPET FHPE++++LKPG+VETILESLS++PE IRPL+V+NI+C+GGNFN+P+F SR+A
Sbjct: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352

Query: 359 TELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTK 418
            ELQRQLPTDW C I I + + EL GWK+MS FA +TDIYK  R++REEYYEHG DW TK
Sbjct: 353 KELQRQLPTDWKCRITISKGNSELSGWKAMSSFA-STDIYKATRVTREEYYEHGIDWCTK 411

Query: 419 KRFGYQNWI 427
            RFGYQNW+
Sbjct: 412 HRFGYQNWV 420

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/429 (64%), Positives = 346/429 (80%), Gaps = 10/429 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           M + P++IDNGSYE+KFGYS+ + P  ALNALAKDKY  +YLSNQ+NNIKDISSV+I+RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           H+LGQLVSWELE  +WDYCF+N D+F  F + E   +HLV++ET MTLPELS N DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKM-ICGKGDDVMGDLISNMDSQNIKNPYSDFNLV 179
           EEY F+SL+K+P A F+PF+   DN  + + GK    +          + +N Y DFNLV
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYL--------DGSKENNYQDFNLV 172

Query: 180 IDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKE 239
           IDSG+NC+WIIP+IKGVPYYKAVKKM+MGGRFLNGL KETISYRHYDVTDE++LVNNIKE
Sbjct: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKE 232

Query: 240 KCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELF 299
            C+F+SP SY++SFK K    V+YVLPDFQTSF+GYV+D K +S LPE+SQ I L DELF
Sbjct: 233 NCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELF 292

Query: 300 SVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLAT 359
           SVPE  FHPEMA +LKPGI+ETILESL I+PE++R L+VNNIVC GGNFN+PNFGSR+ T
Sbjct: 293 SVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYT 352

Query: 360 ELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNT-DIYKKARISREEYYEHGTDWTTK 418
           ELQ+Q+ T+WVC++ IP+ + ELQ WK+M  F +N  ++YK  R++++EY EHG +WTTK
Sbjct: 353 ELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTK 412

Query: 419 KRFGYQNWI 427
           +RFGYQNW+
Sbjct: 413 QRFGYQNWL 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/428 (63%), Positives = 337/428 (78%), Gaps = 11/428 (2%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64
           P VIDNGSYE+KFG+++   P RA N +AKDKYGA YLSN M  I+DISS TIRRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKE-TKGHHLVVSETCMTLPELSANMDQVMFEEY 123
           QLVSWELEG +WDYC +NPDEF  F+L + T+   L+++ETC TLPELS N DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFESLFKSPVAGFVPFLNL--QDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVID 181
           EF ++FKSP +GF+PF NL    NM+ +CGK   V  D  +    +     Y DF LVID
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKE-----YRDFQLVID 177

Query: 182 SGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKC 241
           SGFNCTW++PIIKGVP+YKA+KKM++GGRFLNGL KET+S+RHY++ DETIL+NNIKEKC
Sbjct: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKC 237

Query: 242 LFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS-QVITLTDELFS 300
           LF+SP SY DSFK K + +V+YVLPDFQTSF+GY+ D+ +   +   S Q ITLTDE F+
Sbjct: 238 LFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFA 297

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPEMA +LKPG+VETILE++S+VPE +RP+LV+NIVCVGGNF +P+  SRL +E
Sbjct: 298 VPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSE 357

Query: 361 LQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419
           LQRQLPTDW C + +P   DCEL  W +M+QF+ +TD+YK  R++REEY EHGTDW +K 
Sbjct: 358 LQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTREEYLEHGTDWCSKH 416

Query: 420 RFGYQNWI 427
           RF YQNWI
Sbjct: 417 RFTYQNWI 424

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/427 (62%), Positives = 334/427 (78%), Gaps = 7/427 (1%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME+ PIVIDNGSYE+KFG + +  P  ALN++AKDKYG ++LSNQ+ +IKDISSVT  RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           H+LGQLVSWELE  +WDYC FNPDEF  ++L  TK  HL+ SE+CMTLPELS NMDQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYE++SLFK+PV  FVPF    D   ++  K D    D++++    + K+ Y D+ LVI
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKED---ADVVASDHPSDNKD-YRDYELVI 176

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNCTW++P+IKGVPYYKAVKK+++GGRFLNG  +E +S+RHY+V DETILVN+IKEK
Sbjct: 177 DSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEK 236

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLFMSP SY DSF+++ + + +YVLPDF TSF GY+  +K    LPE+SQ I L DELF+
Sbjct: 237 CLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYL--RKPGQTLPEDSQTIILQDELFA 294

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPE+A LL PGI+E ILES+S++PE +RPLLV N+V  GGNFN+PNF SRLATE
Sbjct: 295 VPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATE 354

Query: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420
           LQRQ PTDW C + +P  D  L GWK M +F++ T  Y+++R+SREEYYEHG DW T KR
Sbjct: 355 LQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSE-TQAYRESRVSREEYYEHGVDWCTSKR 413

Query: 421 FGYQNWI 427
           FGYQ W+
Sbjct: 414 FGYQAWL 420

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 335/422 (79%), Gaps = 7/422 (1%)

Query: 6   IVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELGQ 65
           IVIDNGSY+VKFG +    P  ALNALAKDKYG  +LSNQ+ NIKDISSV  RRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYEF 125
           L SWELE  +WDYC +NPDEF   + +  +  H+V+SETCMTLPELS N DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 ESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGFN 185
           +SL+K+P A ++PF    +N+K I GK D    D+   +++      Y+DF+LVIDSGFN
Sbjct: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEA---GKEYNDFSLVIDSGFN 182

Query: 186 CTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFMS 245
           CTW+IPI+KGVPYYKAVKK+++GGRFLNGL KETIS+RHY+V DE+ILVNNIKE+CL++ 
Sbjct: 183 CTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVD 242

Query: 246 PTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPETI 305
           P SY ++FK K +  +D+VLPDFQTSF GYV+D K  + LP+N+Q++TLTDE FSVPE  
Sbjct: 243 PVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK--TALPDNAQILTLTDERFSVPEAF 300

Query: 306 FHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQL 365
           FHPE+++ LKPGI+ET+LES+ ++PE +RPL+ +NIVC+GGNFN+P F  RL +ELQRQL
Sbjct: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360

Query: 366 PTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQN 425
           PTDWVC   I   D  L GW +M++FA +TD YKKAR+++E+Y+EHG DWTTK+RFGYQN
Sbjct: 361 PTDWVCRAKISSGDKSLTGWTAMAKFA-HTDAYKKARVTKEDYFEHGLDWTTKERFGYQN 419

Query: 426 WI 427
           W+
Sbjct: 420 WV 421

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/428 (63%), Positives = 328/428 (76%), Gaps = 10/428 (2%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           M+  PI+IDNGSYEVKFG +    P RALNALA+DKYG  +LSNQ++ +KDIS+V  RRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQL SWEL+  +WDYC +NPDEF N+ +  TKG HLV+SE CM++PELS   DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEF S FK PVAGFVPF        MI  K D V        DS   +N Y+DF LVI
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVY-----RKDSTGERNEYNDFQLVI 174

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNCTW++PI+KG+PYYKA+KK+++GGRFLNG  KET+S+RHY+V DETILVNNIKEK
Sbjct: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEK 234

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLFMSP SY +SF+ K+  + +YVLPDFQTSF GYVK +K   ++PE+SQ I L DELFS
Sbjct: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQK--QKIPEDSQTIKLYDELFS 292

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           +PET FHPE+A LLKPGIVETILES+S++PE IRPL+V+N V  GGNFN+ NF  RLATE
Sbjct: 293 IPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATE 352

Query: 361 LQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419
           LQRQ PTDW   + +P   D  L GW SM QF+Q T  Y++ R++REEYYEHG DW TK+
Sbjct: 353 LQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTT-AYQQTRVTREEYYEHGVDWCTKQ 411

Query: 420 RFGYQNWI 427
           RFGYQ W+
Sbjct: 412 RFGYQKWL 419

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 331/427 (77%), Gaps = 8/427 (1%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           ME++P++IDNGSYE+KFG    K P+RALN++AKDKYG ++LSNQ+ +IKDISSV   RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120
           HELGQLVSWELE  +WDYC FNPD+F  +++  TKG HL+ SE+CMT+PELS NMDQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180
           EEYEFE++FK+PV  FVPF   + +  M+  K D  +       +    KN Y+DF LVI
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEV----EESEVAPAKN-YNDFQLVI 175

Query: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240
           DSGFNC+WI+P+IKGVPYYKAVKK+++GGRFLNG  +E +S+RHY+V DETILVN+IKE 
Sbjct: 176 DSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEN 235

Query: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300
           CLFMSP +Y +SF+++ + + +YVLPDF TSF GY+  +K    LP  SQ I L DELF+
Sbjct: 236 CLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYL--RKPGQVLPAESQTIVLQDELFA 293

Query: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360
           VPET FHPE+A LL  GIVETILES+S++PE IRPL+V NIV  GGNFN+PNF SRLATE
Sbjct: 294 VPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATE 353

Query: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420
           LQRQ PTDW C + +P+ D  L GWK M +F++  D Y ++R++R+EYYEHG DW T KR
Sbjct: 354 LQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETED-YHESRVTRQEYYEHGVDWCTAKR 412

Query: 421 FGYQNWI 427
           FGYQ W+
Sbjct: 413 FGYQAWL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/423 (60%), Positives = 328/423 (77%), Gaps = 15/423 (3%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64
           PI+IDNGSYE+KFG S  K P RALN LA+DKYG ++LSNQM  I+++S+  +RRP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYE 124
           QLVSWELE  +WDYC FN DEF +++LK++K   L+VSETCM++PE+S +MDQV+FEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGF 184
           F SL K PVA ++PF N+ D  K+    G  V+            K+ Y+DF LV+DSGF
Sbjct: 123 FGSLMKCPVAQYIPFDNMAD-YKVYGSDGLPVVRK----------KDDYNDFQLVVDSGF 171

Query: 185 NCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFM 244
           NCTW+IP+IKGVPYYKAVKK+++GGRFL GL KET+S+RHY++ DETIL NNIKE+C FM
Sbjct: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFM 231

Query: 245 SPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPET 304
            P SY DSF+ K    +DYVLPDFQTS IGYV+  K    +PE+SQ + L DELF++PET
Sbjct: 232 PPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPK--QAIPEDSQTLNLEDELFTIPET 289

Query: 305 IFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQ 364
            FHPE+A +LKPG++ET+LES+S++PE IRPL+V+NI  +GGNFN+ NF SRLATELQRQ
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 365 LPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQ 424
            PTDW   +++P+ D ELQGWK+M +F+ NTD YK+ R++R EY EHG DW TK RFGY+
Sbjct: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFGYE 408

Query: 425 NWI 427
            WI
Sbjct: 409 QWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 325/423 (76%), Gaps = 16/423 (3%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64
           P++++NGSYE+KFG ++ + P RA N L +D+YG ++LSNQM+ I+DIS   IRRP ELG
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYE 124
           QL+SWELE  +WDYC FNPDEF  + LK++K   L+ SETCMT+PE+S NMDQV+FEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGF 184
           F S+ K PVA FVPF   +D   ++ G G+ V             K+ Y++F LV+DSGF
Sbjct: 123 FGSMMKCPVAQFVPFDRARD-YDIVGGAGEVV-----------EAKSGYNNFQLVVDSGF 170

Query: 185 NCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFM 244
           NCTW++P+IKGVPYYKA KK+++GGRFLNGL KETIS+RHY+V DETIL+NNIKE+C FM
Sbjct: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFM 230

Query: 245 SPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPET 304
            P SY DSF+ K+   V+Y+LPDFQTS IGYV+  K    +P+ SQ++ L DELF+VPET
Sbjct: 231 PPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPK--QAIPKTSQILRLEDELFTVPET 288

Query: 305 IFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQ 364
            FHPE++ +LKPG+VETILE +S+VPE +RPLLV+NIV VGGNFN+ NF +RLATELQRQ
Sbjct: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348

Query: 365 LPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQ 424
            PTDW   ++ P+ D  LQGWKSM QF+Q TD YK +R++R EY EHG DW TK RFGY+
Sbjct: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQ-TDSYKNSRVTRSEYLEHGADWCTKHRFGYE 407

Query: 425 NWI 427
            WI
Sbjct: 408 QWI 410

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/431 (61%), Positives = 319/431 (74%), Gaps = 20/431 (4%)

Query: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60
           M +  +VIDNGSYE+KFG S    P RALN L KDKY  ++LSNQ   ++DIS   IRRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNL---KETKGHHLVVSETCMTLPELSANMDQ 117
           HELGQLVSWELE  VWDYCF+N D+F ++NL    +TK HHLVVSET MT+PELS NMDQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDF-HWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFN 177
           V+FEEY+F+S+FK PVA ++PF   Q          DD M        S      Y DF 
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQ--------YQDDAMTAAEDKKTSS-----YKDFQ 166

Query: 178 LVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNI 237
           LVIDSGFNCTW +PIIKGVPYYKA+KK+++GGRFL GL +ETIS+RHY+V +ETILVNNI
Sbjct: 167 LVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNI 226

Query: 238 KEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDE 297
           KE+C F+ P SY  SF NK    V+YVLPDFQTSF+GYVK K    +L +++Q + LTDE
Sbjct: 227 KEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVK-KPGKEKLTDDAQTLLLTDE 285

Query: 298 LFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRL 357
           +FSVPET FHPE+A++LKPGIVETILE +++ PE +RPLLV NIVC GGNFN+PNF  RL
Sbjct: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345

Query: 358 ATELQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWT 416
            TELQRQ P DW C ++ P EKD  L GW+SM  FA N+D ++ AR++REEY EHG DW 
Sbjct: 346 QTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEYLEHGLDWC 404

Query: 417 TKKRFGYQNWI 427
           TK RFGYQ W+
Sbjct: 405 TKNRFGYQQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (250), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMEVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 171/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG+   P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGSTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 178/437 (40%), Gaps = 82/437 (18%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGA---------WYLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 111

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 150

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR +     + +S R Y 
Sbjct: 151 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYS 200

Query: 227 --VTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQ 284
              T E  +V +IKEK  +++               +DY   + QT+      +K  + +
Sbjct: 201 FSTTAEREIVRDIKEKLCYVA---------------LDYD-QEMQTAAQSSAIEK--SYE 242

Query: 285 LPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCV 344
           LP+  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV  
Sbjct: 243 LPDG-QVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMS 301

Query: 345 GGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
           GG    P    R+  E+    P+     I  P +  +   W   S  A  T  +++  IS
Sbjct: 302 GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLT-TFQQMWIS 359

Query: 405 REEYYEHGTDWTTKKRF 421
           ++EY E G      K F
Sbjct: 360 KQEYDESGPSIVHHKCF 376

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 111

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 150

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR +     + +S R Y 
Sbjct: 151 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYS 200

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 201 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD--------------- 245

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 246 ------GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIV 299

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 300 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 357

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 358 ISKQEYDESGPSIVHHKCF 376

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   G+ +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 169/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G      + ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 98.2 bits (243), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 101/439 (23%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q++FE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR +     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHHKCF 375

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/439 (22%), Positives = 169/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q++FE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G      + ++++ GR +     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHLKCF 375

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/439 (22%), Positives = 170/439 (38%), Gaps = 86/439 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q++FE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKNNREKMTQILFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G     A+ ++++ GR +     + ++ R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIV 342
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+      +R  L  NIV
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIV 298

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GG    P    R+  E+    P+     I  P  + +   W   S  A  T  +++  
Sbjct: 299 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLT-TFQQMW 356

Query: 403 ISREEYYEHGTDWTTKKRF 421
           IS++EY E G      K F
Sbjct: 357 ISKQEYDESGPSIVHLKCF 375

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 93/390 (23%), Positives = 152/390 (38%), Gaps = 76/390 (19%)

Query: 41  YLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETK 95
           Y+ ++  + + I  +T+R P E G + +W+    +W + F+N     P+E P        
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-------- 87

Query: 96  GHHLVVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDD 155
              ++++E  M        M Q+MFE +   + + S  A     L+L  + +        
Sbjct: 88  ---VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT------ 134

Query: 156 VMGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGL 215
                                 +V+DSG   T ++PI  G     A+ ++++ GR L   
Sbjct: 135 ---------------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 173

Query: 216 FKETISYRHYD--VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTS 271
             + +S R Y    T E  +V +IKEK  +++      M +          Y LPD    
Sbjct: 174 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD---- 229

Query: 272 FIGYVKDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPE 331
                             QVIT+ +E F  PE +FHP +  L   GI +T   S+     
Sbjct: 230 -----------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDV 272

Query: 332 TIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQF 391
            +R  L  NIV  GG    P    R+  E+    P+     I  P  + +   W   S  
Sbjct: 273 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 331

Query: 392 AQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           A  T  +++  IS++EY E G      K F
Sbjct: 332 ASLT-TFQQMWISKQEYDESGPSIVHHKCF 360

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/374 (23%), Positives = 155/374 (41%), Gaps = 68/374 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
           + PIV+D G+  VK G +    P+    ++  +    A   +N +  +KDI         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY F++  + P+     T G  ++++E  M     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPS-----TSGGKVMLTEPPMNPLRN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + + 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 208 DFETVRQIKEKLSYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           +VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   IV  GG+  
Sbjct: 249 RVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSM 308

Query: 350 MPNFGSRLATELQR 363
            P   SRL  EL++
Sbjct: 309 YPGLPSRLEKELKQ 322

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 155/376 (41%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            +PIV+D G+  VK G +    P+    ++  +    A   +N    ++DI         
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FFN        L  T G  ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFN-----QMKLNNTSGGKILLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E +  ++      +R  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 90/390 (23%), Positives = 151/390 (38%), Gaps = 76/390 (19%)

Query: 41  YLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETK 95
           Y+ ++  + + I  +T+R P E G + +W+    +W + F+N     P+E P        
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-------- 87

Query: 96  GHHLVVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDD 155
              ++++E  M        M Q++FE +   + + S  A     L+L  + +        
Sbjct: 88  ---VLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQA----VLSLYSSGRTT------ 134

Query: 156 VMGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGL 215
                                 +V+DSG   T ++PI  G      + ++++ GR +   
Sbjct: 135 ---------------------GIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDY 173

Query: 216 FKETISYRHYD--VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTS 271
             + +S R Y    T E  +V +IKEK  +++      M +          Y LPD    
Sbjct: 174 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD---- 229

Query: 272 FIGYVKDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPE 331
                             QVIT+ +E F  PE +FHP +  L   GI +T   S+     
Sbjct: 230 -----------------GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDV 272

Query: 332 TIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQF 391
            +R  L  NIV  GG    P    R+  E+    P+     I  P +  +   W   S  
Sbjct: 273 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSIL 331

Query: 392 AQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           A  T  +++  IS++EY E G      K F
Sbjct: 332 ASLT-TFQQMWISKQEYDESGPSIVHLKCF 360

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 89/378 (23%), Positives = 163/378 (43%), Gaps = 76/378 (20%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNA------LAKDKYGAWYLSNQMNNI------K 50
            +PIV+D G+  VK G +    P+    +      L  ++ G+  +S  + +I       
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGS--ISTPLKDIMIGEEAS 61

Query: 51  DISS-VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLP 109
           D+ S + I  P E G + +W+    +WDY F+N  +FP+     T G  ++++E  M   
Sbjct: 62  DVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPS-----TSGGKILLTEPPMNPL 116

Query: 110 ELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNI 169
           +    M +VMFE+Y+F  ++ +  A                          +  + +Q +
Sbjct: 117 KNRELMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGL 150

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DV 227
            +      +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + 
Sbjct: 151 SS-----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR 205

Query: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQL 285
           + +   V  IKEK  ++S    +D+   ++   +  +Y LPD                  
Sbjct: 206 SADFETVRQIKEKLSYVSYDLNLDTKLARETTVLVENYELPD------------------ 247

Query: 286 PENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVG 345
               +VI +  E F  PE +F P++  + +PGI E +  ++      IR  L   IV  G
Sbjct: 248 ---GRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSG 304

Query: 346 GNFNMPNFGSRLATELQR 363
           G+   P   SRL  EL++
Sbjct: 305 GSSMYPGLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 152/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
           Q PIV+D G+  VK G +    P+    ++  +    A   +N    +KDI         
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G +  W     +WDY F+   + P+     T G  ++++E  M     
Sbjct: 64  RSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPMNPLRN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++     G    L L                       +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVY----VGIQAVLALY----------------------AQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD                    
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD-------------------- 247

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             +VI +  E F  PE +F P +  + +PGI E +  ++      I   L   IV  GG+
Sbjct: 248 -GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 86/376 (22%), Positives = 154/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            +PIV+D G+  VK G +    P+    ++  +    A         +KDI         
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FFN  + P      T G  ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPT-----TSGGKVLLTEPPMNPVKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 RERMCEVMFERYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++  +Y LPD                    
Sbjct: 208 DFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD-------------------- 247

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             ++I +  E F  PE +F P++  +  PG+ E +  ++      +R  L   IV  GG+
Sbjct: 248 -GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLERELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 152/374 (40%), Gaps = 68/374 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            NPIV+D G+  VK G +    P+    ++  +    A   +N    +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF+  + P      T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPT-----TSNGKILLTEPPMNPVKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + + 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 208 DFETVRQIKEKVCYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           +VI +  E F  PE +F P +  + + G+ E +  ++      IR  L   IV  GG+  
Sbjct: 249 RVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSM 308

Query: 350 MPNFGSRLATELQR 363
            P   SRL  EL++
Sbjct: 309 YPGLPSRLEKELKQ 322

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 151/374 (40%), Gaps = 68/374 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNN-IKDI--------- 52
            NPIV+D G+  VK G +    P+    ++             +N  +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FFN  + P      T G  ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPT-----TSGGKILLTEPPMNPVKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + + 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 208 DFETVRQIKEKLCYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           ++I +  E F  PE +F P +  + + GI E +  ++      +R  L   IV  GG+  
Sbjct: 249 RIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSM 308

Query: 350 MPNFGSRLATELQR 363
            P   SRL  EL++
Sbjct: 309 YPGLPSRLEKELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/374 (22%), Positives = 152/374 (40%), Gaps = 68/374 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
             PIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY F+   + P+     T G  ++++E  M     
Sbjct: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPMNPLRN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      K++++ GR +     + +S R Y  + + 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 208 DFETVRQIKEKLCYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           +VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   +V  GG+  
Sbjct: 249 RVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSM 308

Query: 350 MPNFGSRLATELQR 363
            P   SRL  EL++
Sbjct: 309 YPGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 152/372 (40%), Gaps = 68/372 (18%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI----------S 53
           PIV+D G+  VK G +    P+    ++  +    A   SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + I  P E G + +W     +WDY F++  + P+     T GH ++++E  M   +   
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPS-----TAGHKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +VMFE+Y+F  ++ +  A                          +  + +Q + +  
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS-- 152

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTDET 231
               +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T + 
Sbjct: 153 ---GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADF 209

Query: 232 ILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQV 291
             V  IKEK  ++S                 Y L D  T             +LP+  +V
Sbjct: 210 ETVRQIKEKLCYVS-----------------YDL-DLDTKLAHETTTLVETYELPDG-RV 250

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMP 351
           I +  E F  PE +F P +  + + GI E +  ++      I   L   IV  GG+   P
Sbjct: 251 IKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYP 310

Query: 352 NFGSRLATELQR 363
              SRL  EL++
Sbjct: 311 GLPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 152/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
             PIV+D G+  VK G +    P+    ++  +    A    +    +KDI         
Sbjct: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF   + P      T G  ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPT-----TSGGKVLLTEPPMNPIKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F   + +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGTYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD                    
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------- 247

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             +VI +  E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 248 -GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 154/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            NPIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF         L+ T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFE-----QMKLQSTSNGKILLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/376 (22%), Positives = 155/376 (41%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            +PIV+D G+  VK G +    P+    ++  +    A   +N    +KDI         
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF   + P      T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPT-----TSNGKILLTEPPMNPTKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E + +++      +R  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 155/376 (41%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            NPIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF   + P+     T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS-----TSNGKILLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 155/376 (41%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            NPIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF   + P+     T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS-----TSNGKILLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 88/376 (23%), Positives = 152/376 (40%), Gaps = 70/376 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNALAKD---KYGAWYLSNQMNNIKDI------- 52
            +PIV+D G+  VK G +    P+    ++      +       +    IKDI       
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEAS 63

Query: 53  ---SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLP 109
              S + I  P E G +  W     +WD+ FF   + P+     T G  ++++E  M   
Sbjct: 64  DVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPS-----TSGGKILLTEPPMNPL 118

Query: 110 ELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNI 169
           +    M QVMFE+Y+F  ++ +  A                          +  + +Q +
Sbjct: 119 KNREMMCQVMFEKYDFGGVYVAIQA--------------------------VLALYAQGL 152

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DV 227
            +      +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + 
Sbjct: 153 SS-----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR 207

Query: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPE 287
           + +   V  IKEK  ++S                 Y L DF T           N +LP 
Sbjct: 208 SADFETVRQIKEKLSYVS-----------------YDL-DFDTKLARETTTLVENYELP- 248

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
           + ++I +  E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 249 DGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGS 308

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 309 SMYPGLPSRLEKELKQ 324

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 95/422 (22%), Positives = 172/422 (40%), Gaps = 75/422 (17%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPN----------RALNALAKDKYGAWYLSNQMNNIKDIS 53
            PIV+DNGS  +K G+S  + P           +    +A    G  ++ NQ   ++ + 
Sbjct: 10  QPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL- 68

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P E G + +W     +W++ F       +  L   + H ++ +E  +   +   
Sbjct: 69  -LKLRYPLEHGIVKNWSDMELIWNHVFHK-----SLQLNNIEEHPVLATEAPLNPLKNRE 122

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +++FE +   +++ S  A     L+L  + +                          
Sbjct: 123 AMCEMLFETFNVPAVYVSIQA----VLSLYASGRTT------------------------ 154

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTD 229
                V+D G  C   +P+  G     +++++++ GR    FL  L ++T        ++
Sbjct: 155 ---GCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSE 211

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
             I V  IKEK  +++     D    +  Y   ++ P   TS I  + D K         
Sbjct: 212 REI-VRIIKEKACYVA----RDPLTEEQTY---HLTP---TSTIFKLPDGK--------- 251

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
            V+ L +E F  PE +F P++       I E   +S+S V   +RP L++NIV  GG   
Sbjct: 252 -VLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTM 310

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
            P FG RL TEL+          I+ P +  +   W   S  +     +KK  +++ E+ 
Sbjct: 311 FPGFGDRLLTELRNLSEPQTKIKIFAPPER-KYSTWIGGSILS-GLSTFKKIWVTKSEWQ 368

Query: 410 EH 411
           E+
Sbjct: 369 EN 370

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 86.3 bits (212), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 90/421 (21%), Positives = 175/421 (41%), Gaps = 75/421 (17%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPN----------RALNALAKDKYGAWYLSNQMNNIKDIS 53
            PIV+DNGS  +K G+S  + P           +    +A    G  ++ NQ   ++ + 
Sbjct: 8   QPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL- 66

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P E G + +W     +W Y F       +  L+  + H ++++E  +       
Sbjct: 67  -LKLRHPVEHGIVKNWSDMEHIWSYVFNK-----SLQLQNVEDHPILITEAPLNPRNNRE 120

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +++FE +   +L+ S  A     L+L  + +                          
Sbjct: 121 RMCELLFESFNVPALYVSIQA----VLSLYASGRTT------------------------ 152

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTD 229
                V+D G  C   +P+  G     +++++++ GR    FL  L ++T        ++
Sbjct: 153 ---GCVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSE 209

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
             + V  IKEK  +++   +++    +  +S++   P++ T F           +LP+  
Sbjct: 210 REV-VRIIKEKACYVAKDPHIE----EQNFSIN---PNY-TKF-----------KLPDG- 248

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           + I L  E F  PE +F PE+       + +   +S+  V   +R LL +N++  GG   
Sbjct: 249 KTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSI 308

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
           +P FG RL +EL+    +     I+ P +  +   W   S  +     +KK  ++R E+ 
Sbjct: 309 LPGFGDRLLSELKSLSDSQTKIKIFAPPER-KYSTWIGGSILS-GLSTFKKLWVTRAEWE 366

Query: 410 E 410
           E
Sbjct: 367 E 367

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 86.3 bits (212), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 154/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            NPIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY FF   + P+     T    ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS-----TSNGKILLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++   +   Y LPD +T  +G             
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPDGRTIKVG------------- 254

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                    E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 153/375 (40%), Gaps = 75/375 (20%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNR-ALNALAKDKYGAWYLSNQMNNI-KDISS-------- 54
           PIVIDNGS  +K G+S    P     N     KY    ++ Q+ N+ K I +        
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + ++ P   G + +W+    +W + F +       N++  + H L+++E  +T+ +    
Sbjct: 71  LRLQHPMNRGVVDNWDDMELLWWHIFND-----TLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           M + +FE +   SL+                               ++N    ++    +
Sbjct: 126 MCERLFETFNIPSLY-------------------------------VANPSVLSLYASGN 154

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
               V+D G       PI +G     +++KME+GGR     L    +++     Y  ++E
Sbjct: 155 TTGCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYS-SNE 213

Query: 231 TILVNNIKEKCLFMSP---TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPE 287
             +V  IKEK  ++S     S    +  +D  S  + LPD                    
Sbjct: 214 KEIVRTIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLPD-------------------- 253

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             + +TL  E F  PE +F+P++  L    +     ES+S V   +RP L +NI+  GG+
Sbjct: 254 -GKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGS 312

Query: 348 FNMPNFGSRLATELQ 362
                FGSRL  +LQ
Sbjct: 313 TLFKGFGSRLLGDLQ 327

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 92/421 (21%), Positives = 173/421 (41%), Gaps = 73/421 (17%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRALNALAK-DKY---------GAWYLSNQMNNIKDIS 53
            PIV+DNGS  +K G+     P    ++L    KY         G  ++ NQ   I+ + 
Sbjct: 11  QPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL- 69

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P E G +  W     +W + F          L   + H ++V+E  +   +   
Sbjct: 70  -LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNRE 123

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +++FE +   +++ S  A     L+L  + +                          
Sbjct: 124 QMCELLFETFSVPAVYVSIQA----VLSLYASGRTT------------------------ 155

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYR---HYDVTDE 230
                V+DSG  C+  +P+  G     A++++++ GR ++ L +  I          + E
Sbjct: 156 ---GCVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKSTGVSLLSSSE 212

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQ 290
             +V  IKEK  +++    +D  + +  Y++                 K++  +LP+  Q
Sbjct: 213 REIVRIIKEKACYIA----LDPKEEEKNYTM---------------HGKQTMFRLPDGKQ 253

Query: 291 VITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNM 350
            I L +E F  PE +F+P++       + E + ES+  V   +R  L +NIV  GG   +
Sbjct: 254 -IELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMI 312

Query: 351 PNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYE 410
           P FG R+  EL+          I+ P +  +   W   S  +     +KK  ++++E+ E
Sbjct: 313 PGFGDRVLKELKLSCEPQTKIKIFAPPER-KYSTWIGGSILS-GLSTFKKIWVTKKEWEE 370

Query: 411 H 411
           +
Sbjct: 371 N 371

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 92/423 (21%), Positives = 167/423 (39%), Gaps = 79/423 (18%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVP----------NRALNALAKDKYGAWYLSNQMNNIKDIS 53
            P+V+DNGS  +K G+S  + P           +    +A    G  ++ NQ   ++ + 
Sbjct: 36  QPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL- 94

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P + G + +W     VW Y F       +  L+  + H  +V+E  +   +   
Sbjct: 95  -LKLRYPLQHGIVTNWADMEQVWGYVFNK-----SLQLQNVEDHPNLVTEAPLNPHKNRE 148

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +++FE +   +L+ S  A     L+L  + +                          
Sbjct: 149 KMCELLFESFNVPALYVSVQA----VLSLYASGRTT------------------------ 180

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTD 229
                V+D G  C   +P+  G     +++++++ GR    FL  L ++T        ++
Sbjct: 181 ---GCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSE 237

Query: 230 ETILVNNIKEKCLFMS--PTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPE 287
             I V  IKEK  F++  P     +F     +S  + LPD +T                 
Sbjct: 238 REI-VRTIKEKACFVTKDPKLEEQNFPMNPSFS-KFKLPDGKT----------------- 278

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
               I L  E +  PE +F PE+       + +   +S+  V   +R LL +NI+  GG 
Sbjct: 279 ----IELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGT 334

Query: 348 FNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREE 407
             +P FG RL  EL+    +     I+ P +  +   W   S  +     +KK  +++ E
Sbjct: 335 SMLPGFGDRLLKELKSLSGSRTKIKIFAPPER-KYSTWIGGSILS-GLSTFKKLWVTKSE 392

Query: 408 YYE 410
           + E
Sbjct: 393 WEE 395

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/376 (22%), Positives = 154/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            +PIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY F+   + P+     T G  ++++E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPMNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD                    
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD-------------------- 247

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             ++I +  E F  PE +F P +  +   G+ E +  ++      +R  L   IV  GG+
Sbjct: 248 -GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SRL  EL++
Sbjct: 307 SMYPGLPSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 130/313 (41%), Gaps = 57/313 (18%)

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
           S + I  P E G + +W     +WDY F++  + P+     T G  ++++E  M   +  
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPS-----TSGGKVMLTEPPMNPVKNR 65

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
             M +VMFE+Y+F  ++ +  A    +                          +Q + + 
Sbjct: 66  EQMCEVMFEKYDFGGVYVAIQAVLALY--------------------------AQGLSS- 98

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTDE 230
                +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + + +
Sbjct: 99  ----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 154

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQ 290
              V  IKEK  ++S                 Y L D  T           N +LP+  +
Sbjct: 155 FETVRQIKEKLSYVS-----------------YDL-DLDTKLARETTTLVENYELPDG-R 195

Query: 291 VITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNM 350
           VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   IV  GG+   
Sbjct: 196 VIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMY 255

Query: 351 PNFGSRLATELQR 363
           P   SRL  EL++
Sbjct: 256 PGLPSRLEKELKQ 268

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 157/375 (41%), Gaps = 74/375 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVP------------NRALNALAKDKYGAWYLSNQMNNIKD 51
            P+V+DNGS  +K GYS    P            +  +N  +KD      L+ +  +I  
Sbjct: 11  QPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI-- 68

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
              + +R P + G + +W     +WDY F +        LK+   H ++++E  +     
Sbjct: 69  ---LQLRHPVDHGVVKNWNDMELIWDYMFKD-----KLKLKDVDEHPVLITEAPLNPVSN 120

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M  ++FE +  ++L+ +  A     L+L  + K+                       
Sbjct: 121 RDEMCDLLFESFGVQALYVANPA----VLSLYASGKI----------------------- 153

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYR---HYDVT 228
             S   L    G++C+  +P+ +G     A+K++++GGR L    +  +          +
Sbjct: 154 --SGCVLDCGDGYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTS 209

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPEN 288
            E  LV  IKEK  +++    +D  + K  Y  D V   F+               LP+ 
Sbjct: 210 GEMELVRMIKEKSCYVAVD--LDIEEEKCNYEGDQVGLKFK---------------LPDG 252

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
            + ITL+ + F VPE +F P +       I E I +S+S +   +RP + ++I+  GG  
Sbjct: 253 -KFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTT 311

Query: 349 NMPNFGSRLATELQR 363
            +  FG+RL  EL +
Sbjct: 312 MLKGFGNRLVQELDK 326

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 152/377 (40%), Gaps = 78/377 (20%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNR-ALNALAKDKYGAWYLSNQMNN----------IKDIS 53
           P+V+DNGS  +K G+S    P     N +   KY    L+N ++N           K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P   G + +W+   T+W + F +  +  +F+      H L+++E  +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRD 124

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +V FE+++F +++                               I+N  + ++    
Sbjct: 125 KMCEVFFEKFDFAAVY-------------------------------IANPSTLSLYASG 153

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD-----VT 228
                V+D G      +PI +G     +++++++GGR +    +  I  R Y       +
Sbjct: 154 RTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQI--RKYTGISLYSS 211

Query: 229 DETILVNNIKEKCLFMSPTSYMD---SFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQL 285
            E  +V N+KEK  ++S     D   S  N ++    + LPD                  
Sbjct: 212 SEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD------------------ 253

Query: 286 PENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVG 345
               + + L    F  PE +F P++  L    + +   ES+S V   +RP L ++I+  G
Sbjct: 254 ---GKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNG 310

Query: 346 GNFNMPNFGSRLATELQ 362
           G+     FG RL  ELQ
Sbjct: 311 GSTMFRGFGDRLLKELQ 327

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/375 (20%), Positives = 157/375 (41%), Gaps = 77/375 (20%)

Query: 5   PIVIDNGSYEVKFGY-SDAKVPNRALNALAKDKYGA---------WYLSNQMNNIKDISS 54
           P+VIDNG+  +K G+  D K      N +   K+            Y+ N+    + +  
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL-- 67

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + +R P E G++  W+    VW +   +     + N++  + H ++++E  +   +   +
Sbjct: 68  LRLRHPMEHGEVKHWDEMEAVWKHTLLH-----DLNIQHIEEHPILITEAPLNSSKNREH 122

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           M +++FE +             +P +++++   +    G    G                
Sbjct: 123 MCEILFESFN------------IPAIHVENPAVLALYSGGRTTG---------------- 154

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
               VID G      +PI +G     +++++++GGR     L    ++++    +  ++E
Sbjct: 155 ---CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFS-SNE 210

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNS---QLPE 287
             +V  IKE+                      YV  D       Y+ D +SNS   +LP+
Sbjct: 211 KEIVRTIKERAC--------------------YVADDISKEEHKYILDSESNSSKFKLPD 250

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             + +++ +  F   E +F+P +       + E + ++LS V   +RP+L  ++V  GG 
Sbjct: 251 -GKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGT 309

Query: 348 FNMPNFGSRLATELQ 362
             +P FG+R+  ELQ
Sbjct: 310 TVLPGFGNRILKELQ 324

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 93/426 (21%), Positives = 172/426 (40%), Gaps = 81/426 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRALNALAKDK------YGAW----YLSNQMNNIKDIS 53
            P+VIDNGS  VK G+   + P     +L  D        G      ++ N+   ++ + 
Sbjct: 10  QPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL- 68

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + ++ P E G +  W+    +W +  F+     +  L     H L+++E  +       
Sbjct: 69  -LKLKHPMERGVVSDWDDMELLWSHILFD-----SLQLTSGMEHPLLITEAPLNPESNKE 122

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M +V FE +                     N+  IC     V+    S   +       
Sbjct: 123 KMLEVFFETF---------------------NIPAICVSIPGVLSLYASGRTT------- 154

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGG-----RFLNGLFKETISYRHYDVT 228
                V+D G      +P+ +G     ++K++ +GG     +    L KE+  +     +
Sbjct: 155 ---GCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFS--S 209

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPEN 288
            E  LV  +KEK  ++S    ++  K++++++ +                  +N +LP+ 
Sbjct: 210 GERELVRTMKEKSCYVS----LNQLKDEEKFTFE-------------PGKMNTNFKLPDG 252

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
           + ++TL+   F  PE +F P++    +P + E  L+S+  V   +RP L++ I   GG  
Sbjct: 253 N-MLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTT 311

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYI---PEKDCELQGWKSMSQFAQNTDIYKKARISR 405
               FG R   EL  Q+ T    NI I   PE+  +   W   S  A  T  ++K   ++
Sbjct: 312 MFRGFGDRFLQEL--QISTCKKSNIRILAPPER--KYTAWIGGSMLAGLT-TFRKMLTTK 366

Query: 406 EEYYEH 411
            ++ EH
Sbjct: 367 SDWREH 372

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 153/376 (40%), Gaps = 72/376 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52
            +PIV+D G+  VK G +    P+    ++  +    A    N    +KD+         
Sbjct: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63

Query: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
            S + I  P E G + +W     +WDY F+   + P+     T G  ++++E  +   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPLNPLKN 118

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229
                 +VIDSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 153 -----GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287
           +   V  IKEK  ++S    +D+   ++  ++  +Y LPD                    
Sbjct: 208 DFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD-------------------- 247

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
             +VI +  E F   E +F P +  +   G+ E +  ++      +R  L   IV  GG+
Sbjct: 248 -GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGS 306

Query: 348 FNMPNFGSRLATELQR 363
              P   SR+  EL++
Sbjct: 307 SMYPGLPSRIEKELKQ 322

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 91/426 (21%), Positives = 174/426 (40%), Gaps = 79/426 (18%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVP-------------NRAL-NALAKDKYGAWYLSNQMNNI 49
            P+V+DNGS  +K G+S  + P             N+ +   LA D   +  + N+   +
Sbjct: 10  QPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKM 66

Query: 50  KDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLP 109
           + +  + +  P E G +  W     +W + F+N     +  L   + H ++++E  +   
Sbjct: 67  RGL--LKLHYPLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPM 119

Query: 110 ELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNI 169
           +    M +++FE       F SP      ++++Q  + +  G                  
Sbjct: 120 KNRNKMCEMLFET------FGSPAV----YVSIQAVLALYAGG----------------- 152

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHY 225
                    VID G  C   +P+  G     A++++++ GR    FL  L +++      
Sbjct: 153 ----RTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLS 208

Query: 226 DVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQL 285
             ++  I V  IKEK  F++         N+++        + +T F           +L
Sbjct: 209 SSSEREI-VRMIKEKACFVA-----TDVGNEEQNYEGANSAELETRF-----------KL 251

Query: 286 PENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVG 345
           P+  +++TL  E F  PE +F P +       I E   +S+S V   +R  L ++IV  G
Sbjct: 252 PDG-KILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSG 310

Query: 346 GNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISR 405
           G+     FG RL +E+++    +    I+ P +  +   W   S  A     ++K  ++R
Sbjct: 311 GSTMFSGFGDRLLSEIRKTSEPNTKIKIFAPPER-KYSTWIGGSILA-GLSTFEKLWVTR 368

Query: 406 EEYYEH 411
            E+ E+
Sbjct: 369 AEWQEN 374

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/344 (22%), Positives = 133/344 (38%), Gaps = 84/344 (24%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAW---------YLSNQMNNIKD 51
           E   +VIDNGS   K G++    P     ++  + ++            Y+ ++  + + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTIRRPHELGQLVSWELEGTVWDYCFFN-----PDEFPNFNLKETKGHHLVVSETCM 106
           I  +T+R P E G + +W+    +W + F+N     P+E P           ++++E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
                   M Q+MFE +   + + S  A     L+L  + +                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQA----VLSLYSSGRTT----------------- 149

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226
                      +V+DSG   T ++PI  G      + ++++ GR L     + +S R Y 
Sbjct: 150 ----------GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYS 199

Query: 227 --VTDETILVNNIKEKCLFMSP--TSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
              T E  +V +IKEK  +++      M +          Y LPD               
Sbjct: 200 FSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD--------------- 244

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESL 326
                  QVIT+ +E F  PE +FHP +  L   GI +T   S+
Sbjct: 245 ------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 129/315 (40%), Gaps = 61/315 (19%)

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
           S + I  P E G + +W     +WDY F+   + P+     T    ++++E  M   +  
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPD-----TSNGKILLTEPPMNPIKNR 65

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
             M +VMFE+Y F  ++ +  A                          +  + +Q + + 
Sbjct: 66  EKMCEVMFEKYNFGGVYVAIQA--------------------------VLALYAQGLSS- 98

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTDE 230
                +V+DSG   T I+P+ + V      +++++ GR +     + +S R Y  + T +
Sbjct: 99  ----GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTAD 154

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPEN 288
              V  IKEK  ++S    +D+   ++  ++   Y LPD                     
Sbjct: 155 FETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD--------------------- 193

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
            +VI +  E F  PE +F P +  + + G+ E +  ++      IR  L   IV  GG+ 
Sbjct: 194 GRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSS 253

Query: 349 NMPNFGSRLATELQR 363
             P   SRL  EL++
Sbjct: 254 MYPGLPSRLEKELKQ 268

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 69/142 (48%), Gaps = 16/142 (11%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVE---TIL--------ESLSIVPETIRPLLVNN 340
           + L  E   VPE IF P M  L + GI+E   TI+          LS V +     + NN
Sbjct: 605 MHLNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQE----MANN 660

Query: 341 IVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKK 400
           +   GGN  +P    R+  E    LP     NI +   D  +  WK M++FAQ++  YK 
Sbjct: 661 VFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA-SDPAIDAWKGMAKFAQSSTDYKG 719

Query: 401 ARISREEYYEHGTDWTTKKRFG 422
           + ++++EY E+G D+  + + G
Sbjct: 720 SYVTKKEYEEYGPDYIKEHKLG 741

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 78/216 (36%), Gaps = 48/216 (22%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPN-----RALNALAKDKYGAWYLSNQMNNIKDISSVTIRR 59
           PI ID GS EV+ GY++  +P+     R      +     +       N++       R 
Sbjct: 38  PIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQSRS 97

Query: 60  PHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHH-----LVVSETCMTLPELSAN 114
           P +   + +W+    + +Y          FN     GH      ++++E   TL    +N
Sbjct: 98  PFDGPMITNWDYVEDMMEYT---------FNHLGVVGHDGISNPILLTEKMATLQSQRSN 148

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             Q+MFE       F  P   F                G D +    +N  S +      
Sbjct: 149 WYQLMFE------CFGVPKLTF----------------GIDSLFSYFANNQSDST----- 181

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR 210
              LVI SG   T +IP++ G       K++  GGR
Sbjct: 182 --GLVISSGNEDTNVIPVVCGKGILSEAKRINWGGR 215

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 65/138 (47%), Gaps = 8/138 (5%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCV 344
           I L  E   VPE +F P M  L + GI E     +L      P+ +  L   + NNI   
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 345 GGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
           GGN  +P    R+  E +  LP +   N+ +   D     W  M++ AQN   YKK  IS
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMT-SDPTFDAWNGMAKLAQNETDYKKTIIS 729

Query: 405 REEYYEHGTDWTTKKRFG 422
           ++EY E+G ++  + + G
Sbjct: 730 KKEYEEYGPEYIKEHKLG 747

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 8/138 (5%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCV 344
           + L  E   VPE +F P +A   + GI E     +L+     P  +      +VNN+   
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 345 GGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
           GGN  +P   +R+  E    LP     ++++ E D  L  WK M++ A N   YK   ++
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAVT 726

Query: 405 REEYYEHGTDWTTKKRFG 422
           R+EY E+G D+  + + G
Sbjct: 727 RKEYEEYGPDYIKEHKLG 744

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 8/142 (5%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPE---TIRPLLVNNIVCV 344
           + L  E   VPE  F P M    + G+ E     +L      P    +I   +  N+   
Sbjct: 607 MHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVT 666

Query: 345 GGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
           GGN  +P    R+  E    LP +   N+ I   D  L  W+ M+++AQN   YKK+ IS
Sbjct: 667 GGNAKIPGLRERIVKEFTGFLPVNTSFNVNIS-SDPSLDAWRGMAKYAQNETDYKKSFIS 725

Query: 405 REEYYEHGTDWTTKKRFGYQNW 426
           ++EY E+G D+  + + G  N+
Sbjct: 726 KKEYEEYGPDYIKEHKLGNMNY 747

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCVGGNFN 349
           E   VPE +F P M    + GI E     +L+     P  +      + NN+   GGN  
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
           +P    R+  E    LP     NI +   D  L  WK M+  AQN + YK+  ISR+EY 
Sbjct: 677 VPGLKERIVKEFTGFLPVGTNININM-SSDPSLDAWKGMAALAQNEEEYKRTIISRKEYE 735

Query: 410 EHGTDWTTKKRFG 422
           E+G D+  + + G
Sbjct: 736 EYGPDYIKEHKLG 748

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 88/247 (35%), Gaps = 60/247 (24%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLSNQMN-NIKDISSVTI--- 57
           Q PI ID GS +++ G+ +   P     N L K      +   ++N N   + + T+   
Sbjct: 37  QLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTK------FRDRKLNKNFTFVGNDTLLDQ 90

Query: 58  ------RRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
                 + P +   + +W     + DY F +    P   +     + ++++E   T+   
Sbjct: 91  AVRSQSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGI----SNPILLTERMATVQSQ 146

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
            AN  Q++FE Y    +    +     F N   + K                        
Sbjct: 147 RANWYQILFETYNVPGVTFG-IDSLYGFYNYYPSGKQT---------------------- 183

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGL-------FKETI 220
                 LVID G   T +IPI+ G       K++  GG     +LN L       F   +
Sbjct: 184 -----GLVIDCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKYPYFPTKM 238

Query: 221 SYRHYDV 227
           SY  Y+ 
Sbjct: 239 SYLQYET 245

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 161/393 (40%), Gaps = 78/393 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRAL--NALAKDKY---------GAWYLSNQMNNIKDI 52
            PIVIDNGS  +K G+S  + P +AL  + +   KY         G  ++ N+   ++ +
Sbjct: 13  QPIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
             + +R P   G +  W+    +W Y     +E     L+  + H L+++E  M   +  
Sbjct: 72  --LRLRYPMTHGVVEDWDSMELIWSYML---NEV--LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
             M QV+FE +   +L+                               ISN    ++   
Sbjct: 125 EVMAQVLFETFNLPALY-------------------------------ISNPAVLSLYAS 153

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVT 228
                 V+D G      +PI  G     ++ +M++GGR     L    +++     +  +
Sbjct: 154 GRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFS-S 212

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPEN 288
            E  +V  IKEK  +++     +  K +DRY   +              D  S  +LP+ 
Sbjct: 213 SELEVVRMIKEKVCYLAK----NIKKEEDRYLQGH-------------HDLGSVFKLPDG 255

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
            + I + ++ +  PE +F P++      G+ +  ++S+  V   +R  L+++I+  GG  
Sbjct: 256 -KCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTT 314

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYI---PEK 378
            +  FG R+  +L+    +   C I I   PE+
Sbjct: 315 TLRGFGERMLHDLEAL--SKGTCKIKIIAPPER 345

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 64/135 (47%), Gaps = 12/135 (8%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCVGGNFN 349
           E   VPE +F P +    + GI E     +L+     P  +      +VNN+   GGN  
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 350 MPNFGSRLATELQRQLP--TDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREE 407
           +P    R+  E    LP  T++  N+     D  L  WK M+  AQN + YKK  IS++E
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNM---SSDPSLDAWKGMAALAQNKEEYKKTVISKKE 733

Query: 408 YYEHGTDWTTKKRFG 422
           Y E+G D+  + + G
Sbjct: 734 YEEYGPDYIKEHKLG 748

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 84/217 (38%), Gaps = 49/217 (22%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLSNQMN-NIKDISSVTI----- 57
           PI ID GS +++ G+ +   P     N L K      +   ++N N   + + T+     
Sbjct: 39  PIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK------FRDRKLNKNFTFVGNDTLLDQAV 92

Query: 58  ----RRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
               R P +   + +W     + DY F +    PN  ++    + ++++E   T+    A
Sbjct: 93  RSQSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVR----NPILLTERMATVQSQRA 148

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
           N  Q+MFE Y                     N+  +    D + G    N ++   K   
Sbjct: 149 NWYQIMFETY---------------------NVPGVTFGIDSLYG--FYNQNTSGNKT-- 183

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR 210
               LVID G   T +IP++ G       K++  GGR
Sbjct: 184 ---GLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGR 217

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 86/391 (21%), Positives = 153/391 (39%), Gaps = 78/391 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRAL--NALAKDKYGAWYLSNQMNNIKDISS------- 54
            PIVIDNG+  +K G++    P R L  + +   KY     SN + +   I +       
Sbjct: 13  QPIVIDNGTNVIKGGFTGETKP-RCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRG 71

Query: 55  -VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +R P   G + +W+   T+W Y F +     N N      H ++++E  +       
Sbjct: 72  ILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLN-----EHPILITEPPLNNMANRQ 126

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M + +FE + F +++ S      P L+L  + +                          
Sbjct: 127 KMCEALFEIFGFPAVYIS----VSPVLSLYASGQTT------------------------ 158

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGG-----RFLNGLFKETISYRHYDVT 228
                 +D G      IP+  G     +VKK+++GG     +    + K T  + +   +
Sbjct: 159 ---GCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMY--SS 213

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFK---NKDRYSVDYVLPDFQTSFIGYVKDKKSNSQL 285
            E  +V  IKEK  +++    +++ K   N+++ +  + LPD                  
Sbjct: 214 SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD------------------ 255

Query: 286 PENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVG 345
               +++ ++   ++  E +F PE+       + E   +S+  V   +R  L +NIV  G
Sbjct: 256 ---GKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSG 312

Query: 346 GNFNMPNFGSRLATELQRQLPTDWVCNIYIP 376
           G    P FGSRL  ELQ     D    I  P
Sbjct: 313 GTTMCPGFGSRLLKELQTLTGYDTKIRIIAP 343

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 88/421 (20%), Positives = 171/421 (40%), Gaps = 69/421 (16%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPN----RALNALAKDKYGAWYLSNQMNNI-----KDISS 54
            P+V+DNGS  +K G+S  + P       +     DK  A  LS++   +     K    
Sbjct: 10  QPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGL 69

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + ++ P E G +  W     +W + F++     +  L     H ++V+E  +   E    
Sbjct: 70  LRLQYPVEHGIVQDWSGLEQLWTHVFYS-----SLKLNNIGDHPMLVTEAPLNPLENRDK 124

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           M ++++E +   +++          +++Q  + +  G                       
Sbjct: 125 MCEMLYETFNVPAVY----------VSIQAVLALYAGG---------------------R 153

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
               VID G  C   +P+  G     A++++++ GR    FL  L +++I       ++ 
Sbjct: 154 TTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSER 213

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQ 290
            I V  IKEK  +++P    +  K       + +     T F           +LP+  +
Sbjct: 214 EI-VRMIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKF-----------KLPDG-K 255

Query: 291 VITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNM 350
           +++L  E F  PE +F P++       I +   +S+S V   +R  L +++V  GG+   
Sbjct: 256 ILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLF 315

Query: 351 PNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYE 410
             FG RL  EL+ +   +    I+ P +  +   W   S  A     ++K  ++R E+ E
Sbjct: 316 AGFGDRLLNELRSRCEPNVKIKIFAPPER-KYSVWIGGSILA-GLSTFEKIWVTRSEWQE 373

Query: 411 H 411
           +
Sbjct: 374 N 374

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCVGGNFN 349
           E   VPE IF P M    + GI E     +L+     P  +      +VNN++  GGN  
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
           +P    R+  E    LPT     + +   D  L  WK M+  A+N + Y+K  IS++EY 
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVNM-SSDPSLDAWKGMAALARNEEQYRKTVISKKEYE 735

Query: 410 EHGTDWTTKKRFG 422
           E+G ++  + + G
Sbjct: 736 EYGPEYIKEHKLG 748

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 10/139 (7%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVETILESLSIVP--------ETIRPLLVNNIVCVGGNF 348
           E   VPE IF P +  L + GIVE + E+L +            I  ++  NI   GGN 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSEISKMMAKNIFITGGNA 667

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408
            +P    R+  E    LP     N+ + E D  +  W+ M++FA NT +Y+ + ++++EY
Sbjct: 668 KLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAWRGMAKFANNTSLYETSIMTKKEY 726

Query: 409 YEHGTDWTTKKRFGYQNWI 427
            E G ++  +   G   ++
Sbjct: 727 EELGPEYIKEHNLGNAKFV 745

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 104/242 (42%), Gaps = 50/242 (20%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALA--KDKYGAW---YLSNQMNNIKDISSVTIR 58
           PI ID GSYEV+ GY +   P     N LA  +D+  +    ++ N  N  + I + + +
Sbjct: 38  PIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQS-K 96

Query: 59  RPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQV 118
            P +   + +W+    +  Y F + D   N  +     + ++++E    L    +N  ++
Sbjct: 97  SPFDGSMITNWDYVDDILAYTFHHLDVRGNGGVP----NPVLITERMAALQSQRSNWYEL 152

Query: 119 MFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNL 178
           +FE Y                 NLQ   K+  G         I ++ S   ++P     +
Sbjct: 153 LFECY-----------------NLQ---KVTFG---------IDSLFSFYGEHPPGTTGI 183

Query: 179 VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDETILV 234
            I+SG   T +IP++ G       K++  GG+    +LNGL   ++ Y ++     T LV
Sbjct: 184 AINSGNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLL--SLKYPYF----PTKLV 237

Query: 235 NN 236
           NN
Sbjct: 238 NN 239

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/374 (20%), Positives = 155/374 (41%), Gaps = 73/374 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRAL--NALAKDKY---------GAWYLSNQMNNIKDI 52
            PIVIDNGS  +K G+S  + P +AL  + +   KY         G  ++ N+   ++ +
Sbjct: 13  QPIVIDNGSGIIKAGFSGEERP-KALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
             + +R P + G +  W+    +W Y            L+  + H L+++E  M   +  
Sbjct: 72  --LRLRYPMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
             + QVMFE +   +++ S  A     L+L  + +                         
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPA----VLSLYASGRTT----------------------- 157

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGG----RFLNGLFKETISYRHYDVT 228
                 V+D G      +PI  G     ++ +M++GG      L    +++     +  +
Sbjct: 158 ----GCVVDCGEGYCSSVPIYDGFALPASIMRMDIGGGDITEQLQFQIRKSAGVSLFSSS 213

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPEN 288
           +  I V  IKEK  +++     D+ K +D+Y             +   +D  S  +LP+ 
Sbjct: 214 EREI-VRTIKEKVCYLAK----DAKKEEDKY-------------LQGTQDLISAFKLPDG 255

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
            + I + ++ +  PE +F P++      G+    ++S+  V   +R  L+++++  GG  
Sbjct: 256 -KSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTT 314

Query: 349 NMPNFGSRLATELQ 362
            +  FG R+  +L+
Sbjct: 315 TLKGFGDRMLHDLE 328

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVETILES--------LSIVPETIRPLLVNNIVC 343
           + L  E   VPE IF P M  L + GI+E I E+              +I   L +N+  
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFL 662

Query: 344 VGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARI 403
            GGN  +P    R+  E +  LP     N+ +   DC L  W+ M++ ++   +++   +
Sbjct: 663 TGGNMRLPGMRERVVREFRGLLPIGTELNVRMA-NDCALDAWRGMAKLSRTDSLFRDTYV 721

Query: 404 SREEYYEHGTDWTTKKRFG 422
           +R+EY+E+G D+  +   G
Sbjct: 722 TRQEYHEYGPDYIKEHNLG 740

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 108/264 (40%), Gaps = 51/264 (19%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRAL-NALAK--DK---YGAWYLSNQMNNIKDISSVT 56
           +  I ID GS EV+ GY + + P+    N +A+  D+       ++ N  N    + S +
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS 95

Query: 57  IRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKG--HHLVVSETCMTLPELSAN 114
            R P++   + +W+    + +Y F +        +K T G  + ++++E    L     N
Sbjct: 96  -RSPYDGALVTNWDYTEDIMEYTFHH------LGVKGTDGIPNPIIMTEKLGALHSQRDN 148

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             Q++FE       F +P   F                G D +    +N D+       S
Sbjct: 149 WYQLLFE------CFGAPQVTF----------------GLDSLFSFYANNDA-------S 179

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
              LVI SG   T IIP++ G       K++  GGR    +L+ L    + Y ++ +   
Sbjct: 180 ASGLVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPS 237

Query: 231 TILVNNIKEKCLFMSPTSYMDSFK 254
           T     + ++  ++SP  Y D  +
Sbjct: 238 THQFKALYDEFCYVSP-DYQDEIQ 260

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 148/374 (39%), Gaps = 77/374 (20%)

Query: 5   PIVIDNGSYEVKFGYS-DAKVPNRALNALAKDKYG---------AWYLSNQMNNIKDISS 54
           PIV+DNGS  +K G+  D K      + +   KY            ++ N     + +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + +R P + G + +WE   TVWD+ F   D     NL E   H LVV+E  +        
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDHIF--KDCLKVSNLGE---HPLVVTEAPLNPKPNREK 125

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           M + +FE +   +L+                               I+N    ++     
Sbjct: 126 MCETLFESFNIPALY-------------------------------IANPAVLSLYASGR 154

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
               V+++G      +PI +G     +++++++GGR     L    +++     Y  +++
Sbjct: 155 TTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQ 214

Query: 231 TILVNNIKEKCLFMSPTSYMDSFK---NKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPE 287
            I V  IKE   ++      +  K   ++++ S+ + LPD +   IG  +          
Sbjct: 215 EI-VRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGPGR---------- 263

Query: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347
                      F  PE +F+P +       + + I++S+S V   +R  L+NNI   GG+
Sbjct: 264 -----------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGS 312

Query: 348 FNMPNFGSRLATEL 361
                F  RL TEL
Sbjct: 313 TMFQGFCDRLITEL 326

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/374 (20%), Positives = 151/374 (40%), Gaps = 73/374 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRALN--ALAKDKY---------GAWYLSNQMNNIKDI 52
            P+VIDNGS  +K G+S  + P +AL    +   KY         G  ++ N    ++ +
Sbjct: 13  QPVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL 71

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
             + +R P + G +  W+    +W Y      +  N        H L+++E  M   +  
Sbjct: 72  --LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIG-----EHPLLITEAPMNPLKNR 124

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
             M QV+FE ++  +L+                               +SN    ++   
Sbjct: 125 EQMAQVLFETFDVSALY-------------------------------VSNPAVLSLYAS 153

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGG----RFLNGLFKETISYRHYDVT 228
                 V+D G      +PI  G     ++ +M++GG      L    +++     +  +
Sbjct: 154 GRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSS 213

Query: 229 DETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPEN 288
           +  I V  +KEK  +++        KN         +   +  ++   +D  S  +LP+ 
Sbjct: 214 EREI-VRTMKEKVCYLA--------KN---------IKKEEEKYLQGTQDLISTFKLPDG 255

Query: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348
            + I + ++ +  PE +F P++  L   G+ +  ++S+  V   +R  L+++I+  GG  
Sbjct: 256 -RCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTT 314

Query: 349 NMPNFGSRLATELQ 362
            +  FG R+  +L+
Sbjct: 315 TLKGFGDRMLWDLE 328

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/373 (21%), Positives = 155/373 (41%), Gaps = 71/373 (19%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNR---ALNALAK-DKY------GAWYLSNQMNNIKDIS 53
            PIVIDNGS  +K G+S  + P     +L   AK DK       G  ++ N+   ++ + 
Sbjct: 13  QPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL- 71

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + ++ P E G +  W+    +W +     +E     L+  + H L+++E  M   +   
Sbjct: 72  -LRLQYPIEHGVVEDWDSMELIWAHIL---NEV--LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M QV+FE +   +L+                               +SN    ++    
Sbjct: 126 VMAQVLFETFNLPALY-------------------------------VSNPAVLSLYASG 154

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTD 229
                VID G      +PI  G     ++ +M++GGR     L    +++     +  ++
Sbjct: 155 RTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSE 214

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
             I V  IKEK  +++     D  K ++ Y         Q S     +D  S  +LP+  
Sbjct: 215 REI-VRTIKEKVCYLA----TDIKKEENTY--------MQES-----QDLTSVFKLPDG- 255

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           + I + ++ +  PE +F P++      G+ +  ++S+  V   +R  L+++I+  GG   
Sbjct: 256 KCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTT 315

Query: 350 MPNFGSRLATELQ 362
           +  FG R+  +L+
Sbjct: 316 LRGFGDRMLHDLE 328

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/374 (20%), Positives = 154/374 (41%), Gaps = 68/374 (18%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPN----------RALNALAKDKYGAWYLSNQMNNIKDISS 54
           P+++DNGS  +K G++ ++ P+           A  ++        Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + +  P+    ++SW+    +WDY   N  E     +++ + H +V++ +  T  +    
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLE-----IEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           M +V+FE++   +++ S           +D +  + G G                     
Sbjct: 125 MCEVLFEKFSIPAIYCS-----------RDPIMSLYGLGRTT------------------ 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDV---TDET 231
                +  G     I  +I G+    + +    GG  +     + + + H  +    +  
Sbjct: 156 --GCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGI 213

Query: 232 ILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQV 291
            L+ +IKE+C  +S       F N+ R    Y L   +TS   Y        +LP+ + +
Sbjct: 214 ELIRSIKERCCVLS-----KDFYNEIRA---YELITSKTSNNKY--------RLPDGN-I 256

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMP 351
           I +  E F  PE IF+P+     +  + + I+ S+S      R  L+ +IV  GG+  + 
Sbjct: 257 IEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIK 316

Query: 352 NFGSRLATELQRQL 365
            FG RL  E+++++
Sbjct: 317 GFGERLTKEIRKEI 330

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (46%), Gaps = 12/135 (8%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE---TIL----ESLSIVPETIRPLLVNNIVCVGGNFN 349
           E   VPE +F P M    + GI E   TIL     S      +    +VNNI+  GGN  
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLDMVNNILITGGNAK 676

Query: 350 MPNFGSRLATELQRQLP--TDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREE 407
           +P    R+  E    LP  T+   NI     +  L  W+ M+  A+N   YKK  IS+EE
Sbjct: 677 VPGLRERIVKEFTEFLPVGTNVAVNI---SSNPSLDAWRGMAALARNKAEYKKTVISKEE 733

Query: 408 YYEHGTDWTTKKRFG 422
           Y E+G D+  + + G
Sbjct: 734 YEEYGPDYIKEHKLG 748

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 90/245 (36%), Gaps = 60/245 (24%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLSNQMN-NIKDISSVTI----- 57
           PI ID GS  ++ G+ +   P     N L K      +   ++N N   + + T+     
Sbjct: 39  PIAIDFGSSRLRAGFVNQATPTHIFPNVLTK------FRDRKLNKNFTFVGNDTLLDQAV 92

Query: 58  ----RRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
               R P +   + +W     + DY F +    PN  +     + ++++E   T+    A
Sbjct: 93  RSQSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGI----SNPILLTERMATVQSQRA 148

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
           N  Q++FE Y             VP +            G D +    +N  S N     
Sbjct: 149 NWYQILFETYN------------VPGVTF----------GIDSLYSFYNNNPSGN----- 181

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGL-------FKETISY 222
               LVID     T ++PI+ G       K++  GG     +LN L       F   +SY
Sbjct: 182 -KTGLVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKYPYFPTKMSY 240

Query: 223 RHYDV 227
             Y+ 
Sbjct: 241 LQYET 245

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 8/151 (5%)

Query: 279 KKSNSQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVET----ILESLSIVPE--- 331
           +  +S+ P     I +  E   VPE +F P +    + GI E      L   +  P    
Sbjct: 604 RPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLS 663

Query: 332 TIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQF 391
           +I   ++NN+   GG+  +P    R+  E    LP     +I I   D  L  WK M++ 
Sbjct: 664 SISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-SNDPSLDTWKGMAKL 722

Query: 392 AQNTDIYKKARISREEYYEHGTDWTTKKRFG 422
           A NTD  KK ++++++Y E+G ++  +   G
Sbjct: 723 ASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 108/265 (40%), Gaps = 52/265 (19%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLSNQM------NNIKDISSVTI 57
           PI ID GSY VK GY++  +P     N L   +Y    L+  M       N+     +  
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLT--RYRDRKLAKTMTFIGNDTNLDQPLRIQA 95

Query: 58  RRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKG---HHLVVSETCMTLPELSAN 114
           +RP++   + +WE    ++DY         +  ++ T G   + ++++E    L    AN
Sbjct: 96  KRPYDGLFIANWEYAEEIFDYTLH------HLGVQTTNGSISNPIILTEKMACLQSQRAN 149

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             Q++FE       F  P A F                G D +    +     N  NP+ 
Sbjct: 150 WYQLLFE------TFDVPSATF----------------GLDSLYAFYN-----NCANPFE 182

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDE 230
              LVI+ G   T I+PI++G       K++  GGR    +L+ L   T+ Y ++     
Sbjct: 183 SDGLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLS 240

Query: 231 TILVNNIKEKCLFMSPTSYMDSFKN 255
                 + E   ++SP +Y +  KN
Sbjct: 241 EFQYQTMYEDFCYVSP-NYNEDIKN 264

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/328 (21%), Positives = 132/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+  W      W+   F       +   E + H  
Sbjct: 101 FYIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK------YLRTEPEDHFF 154

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 155 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 188

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 189 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDIT-LF 247

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +V         IK++  ++ P    D  K  +++  D       T F  ++
Sbjct: 248 IQSLLRERGEVDTSLRTAERIKQEYCYVCP----DIVKEFNKFDRD------ATKFAQFI 297

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
            + K  +Q     +V+ +  E F  PE  F+PE+A    L P +   + +++   P  +R
Sbjct: 298 VENKEKTQ----KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 352

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 353 KGLYNNIVLSGGSTMFKDFGRRLQRDLR 380

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVETILES--LSIVPETIRPL------LVNNIVCVGGNF 348
           E   VPE IF P MA L + G+ E I E+  L     T   L      L  N+   GGN 
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTE-ICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNM 667

Query: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408
            +P    R+  E    LP     N+ +   D  +  W+ M++ +Q    YK + I+R+EY
Sbjct: 668 RLPGVRERIVREFTGMLPMGSNLNVRMA-SDSAVDAWRGMAKLSQAGSQYKGSYITRKEY 726

Query: 409 YEHGTDWTTKKRFG 422
            E G D+  +   G
Sbjct: 727 QELGADYIKEHNLG 740

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 54/263 (20%), Positives = 101/263 (38%), Gaps = 53/263 (20%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVT-------- 56
           PI ID GS EV+ G+ +   P+        ++   W    +  N+  I + T        
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFT----NRISRWRDRRKNRNLTFIGNDTNLDLSVRS 93

Query: 57  -IRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANM 115
             + P++   + +W+    + +Y F +       N  +   + ++++E   TL     N 
Sbjct: 94  QAKSPYDGAIVSNWDYTEEIMEYTFHH----LGVNGNDGVSNPILMTEKLATLQSQRENW 149

Query: 116 DQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSD 175
            Q++FE       F  P   F                G D +    +N D+       + 
Sbjct: 150 YQLLFE------CFGVPQVTF----------------GIDSLFSFYANNDA-------TA 180

Query: 176 FNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTDET 231
             LVI+SG   T +IP++ G       K++  GGR    +L+ L    + Y ++ +   T
Sbjct: 181 SGLVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPST 238

Query: 232 ILVNNIKEKCLFMSPTSYMDSFK 254
               ++ E   ++S   Y D  +
Sbjct: 239 HQFQSLYEDFCYVS-VDYQDEIR 260

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 63/135 (46%), Gaps = 12/135 (8%)

Query: 297 ELFSVPETIFHPEMAKLLKPGI---VETILESLSIVPETIRPL------LVNNIVCVGGN 347
           E   VPE +F P M    + GI    ET+L  L     T R L      +  N+   GGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 348 FNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREE 407
             +P    R+  E    LP+    +I    +D  L  W+ M++ AQNT+ +K   I+++E
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIR-KSQDPSLDAWRGMAKLAQNTEDFKHGYITKQE 727

Query: 408 YYEHGTDWTTKKRFG 422
           Y E+G ++  +   G
Sbjct: 728 YLEYGPEYIKEHNLG 742

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 62/135 (45%), Gaps = 12/135 (8%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE---TILESLSIVPETIRPL------LVNNIVCVGGN 347
           E   VPE IF P +  L + G+VE   T+L  L     + R L      +  N+   GGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 348 FNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREE 407
             +P    R+  E    LP      + +  KD  L  WK M++FA +   YK + +++ E
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTLA-KDPSLSAWKGMAKFASDPTSYKSSILTKRE 730

Query: 408 YYEHGTDWTTKKRFG 422
           Y E+G ++  +   G
Sbjct: 731 YEEYGPEYIKEHNLG 745

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/377 (19%), Positives = 156/377 (41%), Gaps = 67/377 (17%)

Query: 4   NPIVIDNGSYEVKFGYSDAKVPNRALNALA-KDKYGA---------WYLSNQMNNIKDIS 53
            P+V+DNGS  +K G+S  + P      +A K +Y            ++ N+   ++   
Sbjct: 12  QPVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--G 69

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSA 113
            + +RRP   G++ +W+    +W + F++  +    N  +   H L+++E  +   +   
Sbjct: 70  LLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGN-SQIGDHPLLITEAPLNSTKNRE 128

Query: 114 NMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPY 173
            M ++++E + F++L+ +  A    +   Q                              
Sbjct: 129 TMCEILYETFNFDALYVAHPAVLSLYATGQTT---------------------------- 160

Query: 174 SDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYRHYDVTD 229
                V++ G   +   P+ +G     +++++++GGR     L    +++     +  ++
Sbjct: 161 ---GCVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSE 217

Query: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289
           + I V  IKEK  +++               +DY     +  F  + ++  S  +LP+  
Sbjct: 218 QEI-VRTIKEKANYVA---------------LDYKFE--EEKFFIHERENTSTVKLPDG- 258

Query: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349
           Q +T     +   E +F P++       + E +LES++ V   +R  L+ NIV  GG   
Sbjct: 259 QELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTM 318

Query: 350 MPNFGSRLATELQRQLP 366
           +  F  R  +E ++ LP
Sbjct: 319 LKGFDQRTMSETKKMLP 335

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 301 VPETIFHPEMAKLLKPGIVE----TILESLSIVPETIR---PLLVNNIVCVGGNFNMPNF 353
           VPE +F P M    + GI+E     +L+     P  +      +  N+   GG+  +P  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 354 GSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGT 413
            +R+  E    LP D   ++ I  K   L  WK M++F+ +   +K + IS++EY E+G 
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNIS-KHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGP 740

Query: 414 DWTTKKRFG 422
           ++  + R G
Sbjct: 741 EYIKEHRLG 749

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 105/530 (19%), Positives = 180/530 (33%), Gaps = 152/530 (28%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSN---------QMNNIKDI 52
           E + +VID GS+    GYS    P     A+    YG   L           + N+  + 
Sbjct: 13  EISAVVIDPGSFTTNIGYSGTDCPQ----AILPSYYGEISLKEVASEGNEEIEENSASNN 68

Query: 53  SSVTI---------RRPHEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGH 97
            S  I         R  +E+      G+++ W+     WD+   N        L+   G 
Sbjct: 69  KSKKIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNA-----LYLESNSGI 123

Query: 98  HLVVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVM 157
              ++E      E      +V+ E  +FE+ + SP    + F + + N            
Sbjct: 124 PAFLTEPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNC----------- 172

Query: 158 GDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFK 217
                               LV+D G +   + P+I G+   K+  +  + GRF+N   K
Sbjct: 173 --------------------LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIK 212

Query: 218 ETISYRH---------------------------YDVTDETILVNNIKEKCLFMSPTSYM 250
           E +  R                            YD  ++  +    KE    ++PT+ +
Sbjct: 213 EFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYANDHGIFQECKETLCQIAPTAAL 272

Query: 251 DS----------------------FKNKDRYSV--------------------DYVLPDF 268
           D                       F N  RYS                     D ++  +
Sbjct: 273 DKMAPELESLAKRSYETLWKEDIVFDNVTRYSFAEHLFVPKEESMPEGWPVSKDGIVETW 332

Query: 269 QTSFIGYVKDK--------KSNSQLP--------ENSQVITLTDELFSVPETIFHPEMAK 312
              ++   ++K        K N++ P        E S     T++    P    +P  + 
Sbjct: 333 HNDYVPLKRNKPAVSSKTDKENTEEPTPVPSKEGEESTPSDKTNDSGKRPMESENPTESS 392

Query: 313 LLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-DWVC 371
           ++ PGIV+ I  S+      +R  L +NIV  GG   +P F  RL  EL ++LP   +  
Sbjct: 393 VI-PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRV 451

Query: 372 NIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
                 ++ + Q W   S  + +   + +  + ++EY E G D   K RF
Sbjct: 452 LTTGQTRERQYQAWLGGSILS-SLGTFHQLWVGKQEYEESGADRLLKDRF 500

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 83/193 (43%), Gaps = 32/193 (16%)

Query: 179 VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIK 238
           VIDSG   T +IP+ +G     A+K + + GR +    ++ +  R  + T         +
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEEDTSLRTAERIKQ 276

Query: 239 EKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQ------VI 292
           E C                     YV PD    F  + +D +  +Q    SQ      V+
Sbjct: 277 EYC---------------------YVCPDIVKEFNKFDRDSEKFAQFVVESQEKTRRKVV 315

Query: 293 TLTDELFSVPETIFHPEMAK--LLKPGIVETILE-SLSIVPETIRPLLVNNIVCVGGNFN 349
            +  E F  PE  F+PE+A    L P  + TI++ ++   P  +R  L NNIV  GG+  
Sbjct: 316 DVGCERFMAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTM 373

Query: 350 MPNFGSRLATELQ 362
             +FG RL  +L+
Sbjct: 374 FKDFGRRLQRDLK 386

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/335 (21%), Positives = 131/335 (39%), Gaps = 67/335 (20%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 102 FYIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 155

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 156 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 189

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 190 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 248

Query: 217 KETISYRHYDVTDETILVNNIK-EKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGY 275
            +++     +V         IK E C                     YV PD    F  +
Sbjct: 249 IQSLLRERGEVDTSLRTAERIKQEYC---------------------YVCPDIVKEFNKF 287

Query: 276 VKDKKSNSQ-LPENSQ-----VITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLS 327
            +D    +Q + ENS+     ++ +  E F  PE  F+PE+A    L P +   + +++ 
Sbjct: 288 DRDAGKFAQFIVENSESTKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQ 346

Query: 328 IVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             P  +R  L NNIV  GG+    +FG RL  +L+
Sbjct: 347 ACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 381

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/326 (21%), Positives = 131/326 (40%), Gaps = 49/326 (15%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+       +S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 99  FYIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 152

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          V+  
Sbjct: 153 LLTEPPLNPPENREQIAEIFFESFNCAGLY---------IAVQAVLALAASWTSSKVVDR 203

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
            ++                VIDSG   T +IP+ +G     A+K + + GR +   F +T
Sbjct: 204 SLTGT--------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-QFIQT 248

Query: 220 ISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDK 279
           +     +          IK++  ++ P    D  K  +++  D   P+    F  YV + 
Sbjct: 249 LLRERGEADTSLRTAERIKQEYCYVCP----DIVKEFNKFDRD---PE---KFAQYVVEN 298

Query: 280 KSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETIL-ESLSIVPETIRPL 336
           +  +Q     +V+ +  E F  PE  F+PE+A    L P  + TI+ +++   P  +R  
Sbjct: 299 QEKTQ----KKVVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKG 352

Query: 337 LVNNIVCVGGNFNMPNFGSRLATELQ 362
           L NNIV  GG+    +FG RL  +L+
Sbjct: 353 LYNNIVLSGGSTMFKDFGRRLQRDLK 378

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/326 (20%), Positives = 129/326 (39%), Gaps = 49/326 (15%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+       ++ ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 107 FYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 160

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          V+  
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLY---------IAVQAVLALAASWTSSKVVDR 211

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
            ++                VIDSG   T +IP+ +G     A+K + + GR +    +  
Sbjct: 212 SLTGT--------------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSL 257

Query: 220 ISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDK 279
           +  R  +V         IK++  ++ P    D  K  +++  D         F  YV + 
Sbjct: 258 LRERG-EVDTSLRTAERIKQEYCYVCP----DIVKEFNKFDRD------AEKFAQYVVEN 306

Query: 280 KSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETIL-ESLSIVPETIRPL 336
           +  ++     +V+ +  E F  PE  F+PE+A    L P  + T+L +++   P  +R  
Sbjct: 307 QDKTR----QKVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKG 360

Query: 337 LVNNIVCVGGNFNMPNFGSRLATELQ 362
           L NNIV  GG+    +FG RL  +L+
Sbjct: 361 LYNNIVLSGGSTMFKDFGRRLQRDLK 386

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 133/334 (39%), Gaps = 65/334 (19%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 182

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 241

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++                ++E+    + TS   + K K  Y   YV PD    F  + 
Sbjct: 242 IQSL----------------LRERG--EADTSLRTAEKIKQEYC--YVCPDIVKEFNKFD 281

Query: 277 KDKKSNSQLPENSQ------VITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSI 328
           KD    +Q    +Q      V+ +  E F  PE  F+PE+A    L P +   + +++  
Sbjct: 282 KDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQA 340

Query: 329 VPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
            P  +R  L NNIV  GG+    +FG RL  +L+
Sbjct: 341 CPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/334 (20%), Positives = 124/334 (37%), Gaps = 65/334 (19%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 153

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 154 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 187

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +       +D +L   VIDSG   T +IP+ +G     A+K + + GR +    
Sbjct: 188 AVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 247

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
           ++ +  R    T         +E C                     YV PD    F  + 
Sbjct: 248 QQLLRERGEQDTSLKTAERIKQEYC---------------------YVCPDIVKEFNKFD 286

Query: 277 KDKKSNSQLPENSQ------VITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSI 328
           +D    +Q    SQ      ++ +  E F  PE  F+PE+A    L P +   + E++  
Sbjct: 287 RDASKFAQFVVESQEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQA 345

Query: 329 VPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
            P  +R  L NNIV  GG+    +FG RL  +++
Sbjct: 346 CPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDMK 379

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 138/330 (41%), Gaps = 57/330 (17%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 95  FYIGNEALAAAQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 182

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 241

Query: 217 KETISYRHYDVTDETI-LVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGY 275
            +++  R    TD ++     IK++  ++ P   +  F   DR       PD    F  +
Sbjct: 242 IQSL-LRERGETDTSLRTAERIKQEYCYVCP-DIVKEFNKFDRN------PD---KFAQF 290

Query: 276 VKDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILE-SLSIVPET 332
           + + +  +Q     +++ +  E F  PE  F+PE+A    L P  + TI++ ++   P  
Sbjct: 291 IVENQEKTQ----KKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPID 344

Query: 333 IRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
           +R  L NNIV  GG+    +FG RL  +++
Sbjct: 345 VRKGLYNNIVLSGGSTMFKDFGRRLQRDIK 374

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 133/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 108 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 161

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 162 LLTEPPLNPPENREQIAEIFFESFNCAGLY--------------------------IAVQ 195

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 196 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 254

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +V         IK++  ++ P    D  K  +++  D       + F  ++
Sbjct: 255 IQSLLRERGEVDTSLKTAERIKQEYCYVCP----DIVKEFNKFDRD------GSKFAQFI 304

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
            + +  ++     +V+ +  E F  PE  F+PE+A    L P +   +  ++   P  +R
Sbjct: 305 VENQEQTR----KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVR 359

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 360 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 387

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 133/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 182

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 241

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P    D  K  +++  D       + F  +V
Sbjct: 242 IQSLLRERGEADTSLRTAEKIKQEYCYVCP----DIVKEFNKFDRD------PSKFAQFV 291

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
            + +  ++     +V+ +  E F  PE  F+PE+A    L P +   + +++   P  +R
Sbjct: 292 VENQEKTR----RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 346

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 134/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 102 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 155

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 156 LLTEPPLNPPENRQQVAEIFFESFNCAGLY--------------------------IAVQ 189

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 190 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 248

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P   +  F   DR S  +        FI  V
Sbjct: 249 IQSLLRERGEQDASLRTAERIKQEYCYVCP-DIVKEFNKFDRDSEKFA------QFI--V 299

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
           ++K+  ++     +V+ +  E F  PE  F+PE+A    L P  V  + E++   P  +R
Sbjct: 300 ENKERTTK-----KVVDVGYERFLAPEIFFNPEIASSDFLTPLPV-VVDETIQACPIDVR 353

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 354 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 381

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 133/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 182

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 241

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P    D  K  +++  D       + F  +V
Sbjct: 242 IQSLLRERGEADTSLRTAEKIKQEYCYVCP----DIVKEFNKFDRD------PSKFAQFV 291

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
            + +  ++     +V+ +  E F  PE  F+PE+A    L P +   + +++   P  +R
Sbjct: 292 VENQEKTR----RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVR 346

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 134/334 (40%), Gaps = 65/334 (19%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 100 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 153

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 154 LLTEPPLNPPENREQIAEIFFESFNCAGLY--------------------------IAVQ 187

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 188 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 246

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++                ++E+    + TS   + + K  Y   YV PD    F  + 
Sbjct: 247 IQSL----------------LRERG--EADTSLRTAERIKQEYC--YVCPDIVKEFNKFD 286

Query: 277 KDKKSNSQLPENSQ------VITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSI 328
           +D +  +Q    +Q      ++ +  E F  PE  F+PE+A    L P +   + +++  
Sbjct: 287 RDGEKFAQFVVENQESTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQA 345

Query: 329 VPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
            P  +R  L NNIV  GG+    +FG RL  +L+
Sbjct: 346 CPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 379

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/328 (20%), Positives = 132/328 (40%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          +   
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY--------------------------IAVQ 182

Query: 160 LISNMDSQNIKNPYSDFNL---VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
            +  + +    +  +D +L   VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 241

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P    D  K  +++  D       + F  +V
Sbjct: 242 IQSLLRERGEADTSLRTAEKIKQEYCYVCP----DIVKEFNKFDRD------PSKFAQFV 291

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
            + +  ++     + + +  E F  PE  F+PE+A    L P +   + +++   P  +R
Sbjct: 292 VENQEKTR----RKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 346

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +FG RL  +L+
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE----TILESLSIVPETIRPL---LVNNIVCVGGNFN 349
           E   VPE +F P M    + G+ E     +L+     P  +      + NNI   GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
           +P   +R+  E    LP     ++ +   D  L  WK M+++A++ D Y K+ I+++EY 
Sbjct: 673 VPGLKNRIVKEFTSFLPVGTKLSVNMS-SDPLLDSWKGMAKWAKSED-YNKSFITKKEYE 730

Query: 410 EHGTDWTTKKRFG 422
           E+G ++  + + G
Sbjct: 731 EYGPEYIKEHKMG 743

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 131/328 (39%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        + ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 104 FYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFK------YLRAEPEDHFF 157

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLF---KSPVAGFVPFLNLQDNMKMICGKGDDV 156
           +++E  +  PE    + ++ FE +    L+   ++ +A    + + Q   + + G     
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSAQVTDRSLTGT---- 213

Query: 157 MGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
                                 VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 214 ----------------------VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDIT-LF 250

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P   +  F   DR       P+    FI   
Sbjct: 251 IQSLLRERGEADSSLKTAERIKQEYCYVCP-DIVKEFNKFDRQ------PEKFAQFIIEN 303

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
           +DK +        +VI +  E F  PE  F+PE+A    L P +   + +++   P  +R
Sbjct: 304 QDKTTK-------KVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 355

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +F  RL  +++
Sbjct: 356 KGLYNNIVLSGGSTMFKDFSRRLQRDVK 383

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/331 (21%), Positives = 123/331 (37%), Gaps = 59/331 (17%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 97  FYIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 150

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+                          V+  
Sbjct: 151 LLTEPPLNPPENREQVAEIFFESFNCAGLY---------IAVQAVLALAASWTSSKVVDR 201

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
            ++                VIDSG   T +IP+ +G     A+K + + GR +    +  
Sbjct: 202 SLTGT--------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSL 247

Query: 220 ISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDK 279
           +  R  + T         +E C                     YV  D    F  + +D 
Sbjct: 248 LRERGEEDTTLRTAERIKQEYC---------------------YVCSDIVKEFNKFDRDP 286

Query: 280 KSNSQ-LPENSQ-----VITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPE 331
           +  +Q + ENS+     VI +  E F  PE  F+PE+A    L P +   + +++   P 
Sbjct: 287 QKFAQFIVENSEKTKRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPI 345

Query: 332 TIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
            +R  L NNIV  GG+    +FG RL  +L+
Sbjct: 346 DVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 376

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/332 (22%), Positives = 131/332 (39%), Gaps = 61/332 (18%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ ++        S ++  P   GQ+ +W+     W+   F       +   E + H+ 
Sbjct: 91  FYIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYF 144

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+ +  A                     V+  
Sbjct: 145 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQA---------------------VLAL 183

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
             S   S+ +    +    VIDSG   T +IP+ +G     A+K + + GR +    +  
Sbjct: 184 AASWTSSKVVDRSLT--GTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSL 241

Query: 220 ISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDK 279
           +  R  + T         +E C                     YV  D    F  + +D 
Sbjct: 242 LRERGEEDTTLRTAERIKQEYC---------------------YVCSDIVKEFNKFDRDS 280

Query: 280 KSNSQ-LPENSQ-----VITLTDELFSVPETIFHPEMAK--LLKPGIVETIL-ESLSIVP 330
           +  +Q + ENS+     VI +  E F  PE  F+PE+A    L P  + TI+ +++   P
Sbjct: 281 EKFAQFIVENSEKTRRKVIDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACP 338

Query: 331 ETIRPLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             +R  L NNIV  GG+    +FG RL  +L+
Sbjct: 339 IDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 370

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 89/187 (47%), Gaps = 20/187 (10%)

Query: 179 VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIK 238
           VIDSG   T +IP+ +G     A+K + + GR +  LF +++     +V         IK
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LFIQSLLRERGEVDTSLKTAERIK 272

Query: 239 EKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDEL 298
           ++  ++ P    D  K  +++  D         F  ++ + +  +Q     +++ +  E 
Sbjct: 273 QEYCYVCP----DIVKEFNKFDRDV------GKFSQFIIENQGKTQ----KKIVDVGYER 318

Query: 299 FSVPETIFHPEMAK--LLKPGIVETILE-SLSIVPETIRPLLVNNIVCVGGNFNMPNFGS 355
           F  PE  F+PE+A    L P  + TI++ ++   P  +R  L +NIV  GG+    +FG 
Sbjct: 319 FLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFGR 376

Query: 356 RLATELQ 362
           RL  +L+
Sbjct: 377 RLQRDLR 383

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 129/328 (39%), Gaps = 53/328 (16%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H  
Sbjct: 106 FYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRAEPEDHFF 159

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLF---KSPVAGFVPFLNLQDNMKMICGKGDDV 156
           +++E  +  PE    + ++ FE +    L+   ++ +A    + + Q   + + G     
Sbjct: 160 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGT---- 215

Query: 157 MGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLF 216
                                 VIDSG   T +IP+ +G     A+K + + GR +  LF
Sbjct: 216 ----------------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT-LF 252

Query: 217 KETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
            +++     +          IK++  ++ P   +  F   DR       P+    FI   
Sbjct: 253 IQSLLRERGEADTSLRTAERIKQEYCYVCP-DIVKEFNKFDRQ------PEKFAQFIIEN 305

Query: 277 KDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIR 334
           +DK          +V+ +  E F  PE  F+PE+A    L P +   +  ++   P  +R
Sbjct: 306 QDKTKQ-------KVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVR 357

Query: 335 PLLVNNIVCVGGNFNMPNFGSRLATELQ 362
             L NNIV  GG+    +F  RL  +++
Sbjct: 358 KGLYNNIVLSGGSTMFKDFSRRLQRDIK 385

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 8/133 (6%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVET----ILESLSIVPETIRPL---LVNNIVCVGGNFN 349
           E   VPE +F P +    + GI E     I +     P  +      +  N+  VGGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 350 MPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYY 409
           +P   SR+  E    LP+D   N+ I E    L  W  M + A   + Y++  ++ EEY 
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LDVWNGMYRLANTEEDYQRTIVTSEEYD 735

Query: 410 EHGTDWTTKKRFG 422
           E G D+  + +  
Sbjct: 736 ECGVDYLKEHKLS 748

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 83/210 (39%), Gaps = 38/210 (18%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALAK--DKYGAWYLSNQMNN--IKDISSVTIRR 59
           PI ID GSYE++ GY++   P+    N  +K  D+    YL     +  +   +    R 
Sbjct: 42  PIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARS 101

Query: 60  PHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVM 119
           P +   +V+W++   +  Y F +    P+  +     + ++++E    L    +N  Q +
Sbjct: 102 PFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVT----NPIIINEKLACLQSQRSNWYQTL 157

Query: 120 FEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLV 179
           FE +    +  + V G + F                               N  S   +V
Sbjct: 158 FESFGVPKVSMA-VEGMLAFYG----------------------------HNGGSSTGIV 188

Query: 180 IDSGFNCTWIIPIIKGVPYYKAVKKMEMGG 209
           ID G+  T +IPI++G       K++  GG
Sbjct: 189 IDCGYEDTNVIPIVEGQGMMLDAKRINWGG 218

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 89/235 (37%), Gaps = 52/235 (22%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDI-----SSVT 56
           E   IVID GSY    GYS +  P     ++    YG +  + +  N K        S+ 
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIG 66

Query: 57  IRRPH-------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLP 109
           + RP        E G++  W+     WD+   N        LK   G  ++++E      
Sbjct: 67  LARPDYEIKRIVENGEIADWDTAQEQWDWVLKN-----ELFLKSNSGIPVLLTEPIWNSV 121

Query: 110 ELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNI 169
           E      +V+ E  +FE+ + SPV+  V F   + N                        
Sbjct: 122 ENRKKSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNC----------------------- 158

Query: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH 224
                   LV+D G + T + P+I G+   K+  +  + GR++N L +  +  R 
Sbjct: 159 --------LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 6/108 (5%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNI 373
           GI + +  S+      +R  L +N+V  GG   +P    RL  EL ++LP      +   
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 374 YIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           ++ EK  + Q W   S    +   + +  + +EEY E G D     RF
Sbjct: 470 HLREK--QYQAWLGGS-ILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGIVET---ILE------SLSIVPETIRPLLVNNIV 342
           + L  E    PE IF P M  L + GI E    IL       S  +  + +   + +NI 
Sbjct: 606 LHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD--MASNIF 663

Query: 343 CVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKAR 402
             GGN  +PN   R+  E    LP +   N+   + +  L  WK M++FA+ +D Y    
Sbjct: 664 ITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFAR-SDTYSSTC 721

Query: 403 ISREEYYEHGTDWTTKKRFG 422
           +++ EY E G ++  + + G
Sbjct: 722 VTKVEYEEFGPNYIKEHKLG 741

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 83/211 (39%), Gaps = 40/211 (18%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRALNAL------AKDKYGAWYLSNQMNNIKDISSVTIR 58
           PI +D GSYEV+ G++    P+             K +    ++ N  +    + S + R
Sbjct: 41  PIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS-R 99

Query: 59  RPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQV 118
            P++   + +WE    +  Y F +    PN  +     + ++++E   T+    +N  Q+
Sbjct: 100 SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGI----SNPMILTEKMATVQAQRSNWYQL 155

Query: 119 MFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNL 178
           +FE Y        P   F                G D +    +N       N      L
Sbjct: 156 LFECYGI------PQVTF----------------GIDGLFSFYAN-------NSPDSTGL 186

Query: 179 VIDSGFNCTWIIPIIKGVPYYKAVKKMEMGG 209
           +I+SG   T IIP+IKG       K+++ GG
Sbjct: 187 IINSGHEDTNIIPVIKGKGILSEAKRIDWGG 217

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 129/326 (39%), Gaps = 49/326 (15%)

Query: 40  WYLSNQMNNIKDISSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +Y+ N+        S ++  P   GQ+ +W+     W+   F       +   E + H+ 
Sbjct: 104 FYIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYF 157

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E  +  PE    + ++ FE +    L+ +  A                     V+  
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQA---------------------VLAL 196

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
             S   S+ I    +    VIDSG   T +IP+ +G     A+K + + GR +    +  
Sbjct: 197 AASWTSSKVIDRSLT--GTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSL 254

Query: 220 ISYR-HYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD 278
           +  R   D +  T     IK++  ++ P   +  F   DR       P+    FI     
Sbjct: 255 LRERGEADTSLRT--AERIKQEYCYVCP-DIVKEFNKFDRQ------PEKFAQFI----- 300

Query: 279 KKSNSQLPENSQVITLTDELFSVPETIFHPEMAK--LLKPGIVETILESLSIVPETIRPL 336
               SQ     +V+ +  E F  PE  F+PE+A    L P +   + +++   P  +R  
Sbjct: 301 --VESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKG 357

Query: 337 LVNNIVCVGGNFNMPNFGSRLATELQ 362
           L NNIV  GG+    +F  RL  +++
Sbjct: 358 LYNNIVLSGGSTMFKDFSRRLQRDMK 383

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 87/226 (38%), Gaps = 47/226 (20%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E + +VID GSY    GYS +  P   L ++    YG +       NI    S+ I R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +EL      G ++ W+     W +   N        L    G   +++E      E    
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKN-----ELYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +V+ E  +FE+ + +P +  V F   + N                             
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC---------------------------- 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI 220
              LV+D G +   + PI+ G+   K+ ++  + G+F+N L K+ +
Sbjct: 156 ---LVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 99/516 (19%), Positives = 178/516 (34%), Gaps = 142/516 (27%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDIS-------- 53
           E   +VID GS+    GYS    P   L +     YG    +   +   + S        
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSC----YGHHKTNENADGDDEKSKPKVFAEQ 68

Query: 54  SVTIRRPH-------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCM 106
           S+T  RP        E G +V W+     WD+   N       +L+  KG   +++E+  
Sbjct: 69  SLTFPRPDYEIKPIVENGLVVDWDAAQEQWDWALRN-----VLHLESNKGVPALMTESIW 123

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
              E      +V+ E  +FE+ + S     V F   + N                     
Sbjct: 124 NTMENKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC-------------------- 163

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH-- 224
                      LV+D G +     P++ G+   ++ ++  + G+F++ L  + +  R   
Sbjct: 164 -----------LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPREII 212

Query: 225 -------------------------YDVTDETILVNNIKEKCLFMSPTSYMDSFK----- 254
                                    Y+  +E       KE    ++PT+ +D FK     
Sbjct: 213 PLFEIAQRRPEFKKKNFEFNIDPSLYNFANERGFFQECKETLCQIAPTT-LDKFKPELES 271

Query: 255 -----------------NKDRY--------------------SVDYVLPDFQTSFIGYVK 277
                            N  RY                    S D ++  +   ++   +
Sbjct: 272 TAKRSIEAPWTEEIVFDNPSRYGFAEQLFYPQSEDIPEGWPVSKDGIVETWHNDYVPLKR 331

Query: 278 DKKSNS--QLPENSQVITLTDELFSVPETIFH-------PEMAKLLKPGIVETILESLSI 328
           +K S S  + P   +  +  D+  +   T  H        E ++L   GI + +  S++ 
Sbjct: 332 NKPSGSKPEKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELA--GISDLVHSSITS 389

Query: 329 VPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNIYIPEKDCELQGW 385
               +R  L +NIV  GG+ ++P F  RL  EL ++LP      +   ++ E+  + Q W
Sbjct: 390 ADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRER--QYQSW 447

Query: 386 KSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
              S    +   + +  + + EY E G +     RF
Sbjct: 448 LGGS-ILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 8/138 (5%)

Query: 292 ITLTDELFSVPETIFHPEMAKLLKPGI---VETILES-LSIVPETIRPL---LVNNIVCV 344
           + L  E   VPE +F P +    + GI    ETIL +     P  +      +  NI   
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 345 GGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
           GG+  +P    R+  E    LP      + +  K+  L  W  M + AQN   YK + IS
Sbjct: 669 GGHSKLPGLRERIVKEFTGFLPVGTKLGVKMS-KNPSLDAWYGMRKLAQNEADYKDSIIS 727

Query: 405 REEYYEHGTDWTTKKRFG 422
           +++Y E+G ++  + + G
Sbjct: 728 KKDYEEYGAEYIKEHKLG 745

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 86/214 (40%), Gaps = 40/214 (18%)

Query: 3   QNPIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAW-----YLSNQMNNIKDISSVT 56
           + PI ID GSYEV+ GY+ + +P+    N L + +         ++ N +   + + S +
Sbjct: 36  ETPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS 95

Query: 57  IRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMD 116
            + P +   + +W+    +  Y F +     + +++    + L+++E   +L     N  
Sbjct: 96  -KSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVR----NPLIINEPLGSLQSQRKNWY 150

Query: 117 QVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDF 176
           +++FE       F  P   F                G D M    +N       N  +  
Sbjct: 151 ELLFE------CFHLPNVSF----------------GIDGMFGFYAN-------NEGNQD 181

Query: 177 NLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR 210
            +VI+     T +IP++ G       K++  GGR
Sbjct: 182 GIVINCSNEETDVIPVVDGRGVLTDAKRINWGGR 215

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 86/226 (38%), Gaps = 47/226 (20%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E + +VID GSY    GYS +  P   L ++    YG +        I    S+ I R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +EL      G ++ W+     W +   N        L    G   +++E      E    
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQN-----ELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +V+ E  +FE+ + +P +  V F   + N                             
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC---------------------------- 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI 220
              LV+D G +   + PI+ G+   K+ ++  + G+F+N L K+ +
Sbjct: 156 ---LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT 367
           G+ + +  S+      +R  L +N+V  GG  ++P    RL TEL + LP+
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS 434

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 85/226 (37%), Gaps = 47/226 (20%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E + +VID GSY    GYS +  P   L ++    YG          I    S+ I R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +EL      G ++ W+     W +   N        L    G   +++E      E    
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKN-----ELYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +V+ E  +FE+ + +P +  V F   + N                             
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC---------------------------- 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI 220
              LV+D G +   + PI+ G+   K+ ++  + G+F+N L K+ I
Sbjct: 156 ---LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 2/106 (1%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-DWVCNIYI 375
           G+ + +  S+      +R  L +N+V  GG  ++P    RL TEL + LP+  +      
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 376 PEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
             ++ + Q W   S    +   + +  + ++EY E G D     RF
Sbjct: 444 HTRERQYQSWLGGS-ILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 104/530 (19%), Positives = 187/530 (35%), Gaps = 158/530 (29%)

Query: 6   IVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWY-LSNQM-----------NNIKDIS 53
           +VID GS+    G+S +  P   L +     YGA   + +Q            NN ++ S
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSC----YGAITEIEDQQADHNKPDESAANNTENAS 72

Query: 54  SVTIRR---------PH---------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETK 95
            + IR+         P          + G++V W+     W +   N        LK  +
Sbjct: 73  KIKIRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALEN-----ELFLKSNE 127

Query: 96  GHHLVVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDD 155
           G   +++E      E      +V+ E   FE+ + S     V F   + N          
Sbjct: 128 GVPALLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNC--------- 178

Query: 156 VMGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLN-- 213
                                 LV+D G +   + P++ G+ + K+ ++  + G++LN  
Sbjct: 179 ----------------------LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVL 216

Query: 214 ---------------------GLFKETISYRHYDV----TDETILVNNIKEKCLFMSPTS 248
                                 L K+T  +  +D      ++  +   IKE    +SP S
Sbjct: 217 INDFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDSLKTYANDRGIYQEIKEALCRVSPNS 276

Query: 249 YMDSFK------NKDRY------------------------------------SVDYVLP 266
            ++ +K      +K +Y                                    S D ++ 
Sbjct: 277 SLEKYKPELEKMSKRKYETLWNEDIVFDNETIYGFGEQLFIPKENDIPVDWNTSKDGIVE 336

Query: 267 DFQTSFI--------GYVK-DKKSNSQLP---ENSQVITLTDELFSVPETIFHPEMAKLL 314
            +   +I        G VK DK++  +L    +N+     T++    P      E  K++
Sbjct: 337 TWHNDYIPLKRNKPAGTVKTDKEATEELTPAVDNATPSEDTNDNGKRPIGNEGEEKEKII 396

Query: 315 KPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVC 371
            PGIV+ I  S++     +R  L +N+V  GG   +P    R+  EL ++LP      + 
Sbjct: 397 -PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLA 455

Query: 372 NIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           N    E+  + Q W   S  + +   + +  + ++EY E G D     RF
Sbjct: 456 NGQTRER--QYQSWLGGSILS-SLGTFHQLWVGKQEYEEIGADRLLTDRF 502

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 75/345 (21%), Positives = 122/345 (35%), Gaps = 68/345 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNAL-----AKDKYGAWYLSNQMNNIKDISSVT 56
           E + +VID GSY    GYS    P   + +      A  K G    ++Q   I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFE 71

Query: 57  IRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMD 116
           I+R  E G +V WE     W +   +  +F +F     KG    ++E      E      
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDF 176
           +V+ E  EFE+ + +P A    F                 MG                  
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSF----------------AMGRPTC-------------- 156

Query: 177 NLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH----YDVTD--- 229
            LV+D G +   + P++ G+   K+  +  + G+ LN L +  +  R     Y V     
Sbjct: 157 -LVLDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRELVPLYKVERKRP 215

Query: 230 -------ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSN 282
                  E  +  ++ E   F +   ++   K    +     LP FQ+         K +
Sbjct: 216 EFVPKKFEFTVSKSVDE---FANSRGFLQECKETMLHVAAVELPKFQSEL---ETTSKRS 269

Query: 283 SQLPENSQVITLTDELFSVPETIFHPEMAKL------LKPGIVET 321
            + P    +I  ++  +S  E +F P    L       K G+VET
Sbjct: 270 IEAPWGENIIFDSNARYSFAEQLFKPTKEMLPSDWPVTKDGVVET 314

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 6/108 (5%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNI 373
           G+ + +  +++     +R  L +N+V  GG+ ++P    RL TEL ++LP      + + 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 374 YIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           ++ E+    + W   S  + +   + +  + R+EY E G +   K RF
Sbjct: 436 HLRERQS--RAWLGGSILS-SLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 89/228 (39%), Gaps = 51/228 (22%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI---R 58
           E + +VID GSY    GYS +  P   L ++    YG   L+   N+ K  S  +I   R
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGK--LTADENSKKMFSEQSIGIPR 66

Query: 59  RPHEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
           + +EL      G ++ W+     W +   N        L    G   +++E      E  
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALRN-----ELYLDSNSGIPALLTEPVWNSMENR 121

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
               +V+ E  +FE+ + +P +  V F   + N                           
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC-------------------------- 155

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI 220
                LV+D G +   + PI+ G+   K+ ++  + G+F+N L ++ +
Sbjct: 156 -----LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 333 IRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNIYIPEKDCELQGWKSMS 389
           +R  L +N+V  GG  ++P    RL TEL + LP+     +   +I E+  + Q W   S
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRER--QYQSWLGGS 456

Query: 390 QFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
               +   + +  + ++EY E G +     RF
Sbjct: 457 -ILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 85/228 (37%), Gaps = 42/228 (18%)

Query: 2   EQNPIVIDNGSYEVKFGYSDA-----KVPNRALNALAKDKYGAWYLSNQMNNIKDISSVT 56
           E + +VID GSY    GYS        +P+        +K G    ++Q   +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  IRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMD 116
           I+R  E G +V WE     W +   +  +F +F     KG    ++E      E      
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDF 176
           +V+ E  EFE+ + +P A  V F                 MG                  
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSF----------------AMGRPTC-------------- 156

Query: 177 NLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH 224
            LV+D G +   + P++ G+   K+  +  + G+ LN L ++ +  R 
Sbjct: 157 -LVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 310 MAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-- 367
           +A L+   I+ET ++        +R  L +N+V  GG+ ++     RL TEL ++LP   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 368 -DWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
              + + ++ E+    + W   S  + +   + +  + R+EY E G +   K RF
Sbjct: 429 FRILTSGHLRERQS--RAWLGGSILS-SLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/352 (21%), Positives = 134/352 (38%), Gaps = 83/352 (23%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E   I+ID GS+    GYS    P     A+    YG +    +  ++ +  S+ + R+ 
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCP----QAILPSCYGQYINDEEKPSLFNEQSIGLPRKD 68

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +E+      G++V W+     W++   +   F     +  KG   +++E      +    
Sbjct: 69  YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLF-----ESNKGLPALLTEPIWNSEDNRKK 123

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +V+ E  +FE+ + +P A  V F                 MG             P  
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSF----------------AMG------------RPTC 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETIS------------- 221
              LV+D G + T + P+I G+   K+  +  + G  LN L + ++              
Sbjct: 156 ---LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKK 212

Query: 222 -----YRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYV 276
                 R +D      L+N + E+  F         FK     ++  V P   T F   +
Sbjct: 213 RPEFVKRSFDYEIHPSLLNFVNERQFFQ-------EFKE----TMLQVAPTSLTKFKSEL 261

Query: 277 KD-KKSNSQLPENSQVITLTDELFSVPETIFHPEMAK------LLKPGIVET 321
           +   K + + P    ++  ++  F++ E +F PE AK      + K G+VET
Sbjct: 262 EQLSKRSIEAPWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-DWVCNIYI 375
           G+ + I  S+      +R  L +N+V  GG+ ++P    R+  EL + LP   +      
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 376 PEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
             ++ + Q W   S  A +   + +  + ++EY E G D   K RF
Sbjct: 435 QAREKQYQSWLGGSILA-SLGTFHQLWVGKQEYAEVGADRLLKDRF 479

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/238 (19%), Positives = 87/238 (36%), Gaps = 51/238 (21%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIK--------DIS 53
           E   ++ID GSY    GY+    P   L +   + + A   +++ N  K           
Sbjct: 13  EITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQ 72

Query: 54  SVTIRRPH-------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCM 106
           S+ I RP        E GQ+  W+     W +   N       +++  +G   +++E   
Sbjct: 73  SIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRN-----ELHIESNRGIPAMLTEPLW 127

Query: 107 TLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDS 166
              E  +   +++ E  EFE+ + +  +  V F   + N                     
Sbjct: 128 NSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPN--------------------- 166

Query: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH 224
                     +L++D G +   + P+I G+   K+ +     GRFLN L  + +  R 
Sbjct: 167 ----------SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 278 DKKSNSQLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLL 337
           D  + + LPE+S   T  +      E I   E+     PGIV+ I  S+S     IR  L
Sbjct: 356 DSNTATPLPESSS--TTNENGKRTAEDIKREEL-----PGIVDLISSSISSCDVDIRASL 408

Query: 338 VNNIVCVGGNFNMPNFGSRLATELQRQLPT 367
            +N+V  GG+  +P    R+  EL  + P 
Sbjct: 409 AHNLVITGGSSTIPGLSDRILNELNMKFPA 438

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 18/122 (14%)

Query: 297 ELFSVPETIFHPEMAKLLKPGIVE---TIL------ESLSIVPETIRPLLVNNIVCVGGN 347
           E   VPE +F P M    + GI+E   TIL      E   + P  +   + NN+   GGN
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLWITGGN 671

Query: 348 FNMPNFGSRLATELQRQLPTDWVCNI---YIPEKDCELQGWKSMSQFAQNTDIYKKARIS 404
             +P    R+  E    LP     N+   Y P     L  W  M++   N++ YK   IS
Sbjct: 672 SKLPGMKERIVKEFTGFLPVGTAFNVKQSYNP----SLDAWNGMAKLTLNSEDYKNTIIS 727

Query: 405 RE 406
           ++
Sbjct: 728 KK 729

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 93/242 (38%), Gaps = 68/242 (28%)

Query: 5   PIVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLSNQMNNI-----KDIS----- 53
           PI ID GS +++ GY++   P+    N L +      Y   ++N        D+S     
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSHIFPNRLTR------YRDRKINKTFTFIGNDVSLDQAI 91

Query: 54  SVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHH-----LVVSETCMTL 108
               + P +   + +W+    +  Y F         N     GH+     ++++E   TL
Sbjct: 92  RTQSKSPFDGSIITNWDYVEDIMQYIF---------NHLGVVGHNGVSNPILLTEKLATL 142

Query: 109 PELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQ-DNMKMICGKGDDVMGDLISNMDSQ 167
               +N  Q++FE ++            +P + L  D+M    G                
Sbjct: 143 QSQRSNWYQLLFECFD------------IPEVTLGIDSMFAFYGL--------------- 175

Query: 168 NIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGR----FLNGLFKETISYR 223
              N  S   LVID G   T +IP+++G       K++  GGR    +LN L   T+ Y 
Sbjct: 176 ---NERSSTGLVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLL--TLKYP 230

Query: 224 HY 225
           ++
Sbjct: 231 YF 232

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/245 (19%), Positives = 90/245 (36%), Gaps = 62/245 (25%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISS--VTIRR 59
           E + +VID GSY    GYS    P+  L +    +YG++  +N+ +  +D  S     +R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPHSILPS----RYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PH--------------------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
            H                    E G +  W+     W++   N        L+ TKG   
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN-----ELFLESTKGIPA 123

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
           +++E      +      + + E   FE+ + +P +  V F   + N    C         
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRAN----C--------- 170

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
                             LV+D G +   + P++ G+   K+ ++    G+++N L +  
Sbjct: 171 ------------------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENF 212

Query: 220 ISYRH 224
           +  R 
Sbjct: 213 LKPRE 217

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-DWVCNIYI 375
           G+ + +  S+      +R  L +N+   GG   +P    RL  EL  +LP   +      
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 376 PEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
            +K+ E Q W   S    +   + +  + R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLT-SLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 6/108 (5%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNI 373
           GIV+ I +S+      +R  L +N+V  GG   +P    R+  EL + LP      + + 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 374 YIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           ++ E+  + QGW   S  A +   + +  + REEY E G +   K RF
Sbjct: 475 HLRER--QYQGWLGGSILA-SLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/327 (19%), Positives = 122/327 (37%), Gaps = 65/327 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYG-------AWYLSNQMNNIKDISS 54
           E N IVID GS+    GYS    P     ++    YG          + N+   +   + 
Sbjct: 13  EINAIVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAG 68

Query: 55  VTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           + I+   E   +V W+     W+Y   N D       +  KG  ++++E           
Sbjct: 69  MEIKPIVENSTIVDWDRAQEQWEYA-LNTD----LKFESNKGTPVLLTEPIWNSEASRKK 123

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +++ E  EFE+ + +  +  V F                 MG                
Sbjct: 124 SLEILLESMEFEACYLAANSSAVSF----------------AMGRPTC------------ 155

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILV 234
              LV+D G + + + P+I G+   K+  +  + G++LN L  + +  R         + 
Sbjct: 156 ---LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREI-----VPIF 207

Query: 235 NNIKEKCLFMSPTSYMD------SFKNKDRY------SVDYVLPDFQTSFIGYVKDKKSN 282
             +K+K  F+  T   D      +F N+ ++      ++ ++ P   +SF   +  +   
Sbjct: 208 QVLKKKPDFVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKR 267

Query: 283 S-QLPENSQVITLTDELFSVPETIFHP 308
           S + P   ++I   D  +S  E +F P
Sbjct: 268 SLEAPWGEELIFDADTRYSFAEQLFRP 294

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 84/229 (36%), Gaps = 48/229 (20%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E   +VID GS+    GYS    P     A+    YG  Y   + + +    S+ + R+ 
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCP----QAILPSCYGK-YTEGEKDELFSEQSIGLPRKD 67

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +E+      G++V WE     WD+   +         +   G   +++E      E    
Sbjct: 68  YEIHNIVQNGEVVDWEKAEKQWDWAIRS-----ELRFETNSGMPALLTEPIWNSEENRKK 122

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
             +V+ E  +F + +  P A  V F                 MG                
Sbjct: 123 SLEVLLESMDFSACYLVPTATAVSF----------------AMGRPTC------------ 154

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYR 223
              LV+D G + T + P++ G+   K+  +  + G  LN L +  ++ R
Sbjct: 155 ---LVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIP 376
           G+ + I  S+      +R  L +N+V  GG  ++P    R++ EL R LP      +   
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 377 E-KDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           + ++ + QGW   S  A +   + +  + ++EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILA-SLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 86/233 (36%), Gaps = 46/233 (19%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNA---LAKDKYGAWYLSNQMNNIKDISSVTIR 58
           E   ++ID GS+    GYS    P   L +     K+       + +   I   SS+ I 
Sbjct: 13  EITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIP 72

Query: 59  RPH-------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
           RP        E G ++ W+     W +   +       +L+ T G   +++E      E 
Sbjct: 73  RPDYEIKRIVENGSIMDWDAAQEQWSWALKS-----QLHLQSTSGIPALLTEPIWNSVEN 127

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
                +++ E   FE+ + S V   V F   + N    C                     
Sbjct: 128 RKKSLEILLEGMNFEACYLSSVPTCVSFAAGRPN----C--------------------- 162

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH 224
                 LV+D G + T + P++ G+   K+  +  + G+++N L ++ +  R 
Sbjct: 163 ------LVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 101/485 (20%), Positives = 177/485 (36%), Gaps = 78/485 (16%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTI-RRP 60
           E + +VID GSY    GYS    P   L +   D         +   +    S+ I R+ 
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKD 72

Query: 61  HEL------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSAN 114
           +E+      G ++ W+     W +   N        L+   G   +++E      E    
Sbjct: 73  YEIKPIVENGVVIDWDAAQEQWSWALEN-----QLYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 115 MDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMI------CGKGDDVMGDLISNMDSQN 168
             +++ E  +FE+ + +     V F   + +  ++      C     V G  +S    +N
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKSTKRN 187

Query: 169 I-KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKK-------MEMGGRFLN--GLFKE 218
                Y   N +I +  +   IIP+         +KK        E   ++ N  G+F+E
Sbjct: 188 FFAGGY--LNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYANDRGIFQE 245

Query: 219 ----------------------TISYRHYDV--TDETILVNNIK----EKCLFMSPTSYM 250
                                 T++ R  +   T+E I  N  +    E+          
Sbjct: 246 CKETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFLPRKEDVP 305

Query: 251 DSFKNKDRYSV-----DYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLT----DELFSV 301
           D++   +  +V     DYV P  +T   G VK  K ++  P+NS   ++T    DE    
Sbjct: 306 DNWNISENGTVETWHNDYV-PVKRTKPSGSVKSNKDST--PQNSVEPSITAEPLDETNEN 362

Query: 302 PETIFHP--EMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLAT 359
            + I     E+ K    G+ + +  S+      +R  L +N+V  GG   +P    RL  
Sbjct: 363 GKRIIESSSEITKGSLLGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMA 422

Query: 360 ELQRQLPT---DWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWT 416
           EL  +LP      +   +  E+  + Q W   S    +   + +  + +EEY + G D  
Sbjct: 423 ELNSRLPALKFRMITTGHTRER--QYQSWLGGSVLT-SLGTFHQLWVGKEEYQDVGVDRL 479

Query: 417 TKKRF 421
              RF
Sbjct: 480 LADRF 484

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 96/267 (35%), Gaps = 45/267 (16%)

Query: 178 LVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNI 237
           LV+D G +   + PI+ G      + +    G FL+    + +     D  D T L +  
Sbjct: 142 LVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALD----DRPDGTSLYH-- 195

Query: 238 KEKCLFMSPTSYMDSFKNKD------RYS-VDYVLPDFQTSFIGYVKDKKSNSQLPENSQ 290
                +    ++M  FKN        R S V+  L     SFI    + + +        
Sbjct: 196 -----WQQSRTWMRDFKNTMLQVSLMRLSEVEKQLQKQSISFIPIPLEGRKHFLFKRQKT 250

Query: 291 VITLTDELFSVPETIFHPE-----------MAKLLKPGI---VETILES----------- 325
           V     + + +PE++F P            ++ L+   I     +I  S           
Sbjct: 251 VTWDLKQCYRIPESLFDPSSVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQPAAAG 310

Query: 326 -LSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEK-DCELQ 383
             S  PE I   L+ N+V +GG   +     RL  +L  Q P   +     P   D +LQ
Sbjct: 311 LPSATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQ 370

Query: 384 GWKSMSQFAQNTDIYKKARISREEYYE 410
            W+         D    + ++++EY E
Sbjct: 371 SWQGGVNMCHLPDWKLGSWVTKQEYLE 397

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 109/292 (37%), Gaps = 67/292 (22%)

Query: 177 NLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI---------------- 220
           +LV+D G +   + PII G     AV + +  G FL+    E +                
Sbjct: 140 SLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVP 199

Query: 221 -SYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDK 279
            S+++++       +++ K   L +SP+   +    +D  +  +   D +  F+ Y K  
Sbjct: 200 ESFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFL-YKKGN 256

Query: 280 KSNSQLPENSQVITLTD-ELFSVPETIFHPEMAK---LLKPGIVETILESL--------- 326
           K+          +TL   E + + E +F P++A      K G+ E +++++         
Sbjct: 257 KT----------LTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTT 306

Query: 327 -----------------------SIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQR 363
                                  +  PE I   L+ NIV  G    +P    R+  EL  
Sbjct: 307 SNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSY 366

Query: 364 QLPTDWVCNIYIPEK-DCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTD 414
           Q P   + +   P   D +LQ W+     +          I+R+EY  +G +
Sbjct: 367 QFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 333 IRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNIYIPEKDCELQGWKSMS 389
           +R  L +NIV  GG  ++P F  RL +EL ++LP      +   ++ E+  + Q W   S
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRER--QYQAWLGGS 448

Query: 390 QFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
               +   + +  + ++EY E G D     RF
Sbjct: 449 -ILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/229 (19%), Positives = 79/229 (34%), Gaps = 50/229 (21%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDI---SSVTIR 58
           E   +VID GS+    G+S    P     A+    YG      + N  K I    S+ I 
Sbjct: 13  EITAVVIDPGSFSTNIGFSGTDCP----QAILPSCYGEQKAETEDNAPKKIFAEQSIGIP 68

Query: 59  RPH-------ELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111
           RP        +   +V W+     W +   +        L    G   +++E      E 
Sbjct: 69  RPDYEIKPIVQNSMVVDWDAAEEQWSWALKD-----ILYLNSNSGIPALLTEPIWNTLEN 123

Query: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171
                +++ E  +FE+ + S     V F + + N                          
Sbjct: 124 KTKSLEILLESLQFEACYLSSTPTCVSFASGRPNC------------------------- 158

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETI 220
                 LV+D G + T + P++ G+   K+  +  + G  +N L K+ +
Sbjct: 159 ------LVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 49/108 (45%), Gaps = 6/108 (5%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT---DWVCNI 373
           G+ + I  S+      +R  L +N+V  GG  ++P    R+  EL + LP      + + 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 374 YIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
           ++ E+  + Q W   S  + +   + +  + ++EY E G     K RF
Sbjct: 452 HLKER--QYQSWLGGSILS-SLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 48/241 (19%), Positives = 79/241 (32%), Gaps = 63/241 (26%)

Query: 2   EQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPH 61
           E + +VID GSY    GYS    P   L +    +YG  Y+S +    +       R+  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQ-YISEEEEKDEQEQQEDDRKLK 67

Query: 62  EL----------------------GQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHL 99
           +                       G ++ W+     W +   +       + + TKG   
Sbjct: 68  QKVFSEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQH-----ELHFESTKGMPA 122

Query: 100 VVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGD 159
            ++E      E      +V+ E  EFE+ F SP    V F                 MG 
Sbjct: 123 FLTEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSF----------------AMGR 166

Query: 160 LISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKET 219
                             LV+D G +   + P++ G+   K+     + G  LN L  + 
Sbjct: 167 PTC---------------LVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQ 211

Query: 220 I 220
           +
Sbjct: 212 L 212

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 2/107 (1%)

Query: 316 PGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPT-DWVCNIY 374
           PGI + +  +++     +R  L +N++  GG   +P    RL  EL ++LP   +     
Sbjct: 490 PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNKKLPALKFRILSS 549

Query: 375 IPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRF 421
              ++ + Q W   S    +   + +  + + EY E G D   K RF
Sbjct: 550 GHRRERKYQAWLGGS-ILTSLGTFHQLWVGKREYEEVGPDRLLKDRF 595

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 64/172 (37%), Gaps = 36/172 (20%)

Query: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112
           S   ++R  E G +  W++    W +         +F     KG   +++E      +  
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-----KGIPALLTEPVWNTVQNR 211

Query: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172
               +V+ E+ EFE+ + + +   V F   + N    C                      
Sbjct: 212 KKSLEVLLEKMEFEACYLTTIPTNVSFAAGKPN----C---------------------- 245

Query: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRH 224
                LV+D G +   + P+I G+   K+V++    GR+LN L +  I  R 
Sbjct: 246 -----LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 89/231 (38%), Gaps = 22/231 (9%)

Query: 178 LVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNI 237
           LV+D G   + + PII G     AV + +  G FL+    E ++       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 238 KEKCLFM--SPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLT 295
           K+  L +  +  +++  FK          L D  ++ +  +      + L +  + I+LT
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLT 257

Query: 296 D-ELFSVPETIFHPEMAK---LLKPGIVETILESLS---------------IVPETIRPL 336
             +   + E +F P       +   G+ E + +S+                  PE     
Sbjct: 258 QKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAA 317

Query: 337 LVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIP-EKDCELQGWK 386
           L+ NI+  G +  +     R+  +L  Q P   + +   P   D +LQ W+
Sbjct: 318 LLTNILITGSSSLISGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQ 368

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 86/229 (37%), Gaps = 22/229 (9%)

Query: 178 LVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNI 237
           L++D G     + P+I G     A+ +    G FL+    + +S +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 238 KEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTD- 296
            E  L+ +  +++  FK+         L D  ++ +  +      + L    + I+L   
Sbjct: 154 LE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNFLYRRQKTISLMQK 211

Query: 297 ELFSVPETIFHPE---------------MAKLLKPGIVETILESLSI---VPETIRPLLV 338
           E  ++ E +F P                +AK +K     T   S +     PE I   L+
Sbjct: 212 ECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHAALL 271

Query: 339 NNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIP-EKDCELQGWK 386
            NIV  G +  +P    R+  +L  Q P   + +   P   D +LQ W+
Sbjct: 272 TNIVITGSSSLIPGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQ 320

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 111/278 (39%), Gaps = 58/278 (20%)

Query: 6   IVIDNGSYEVKFGYSDAKVPNRAL-NALAKDKYGAWYLS--NQMNNIKDI---SSVTIRR 59
           +VI NG+     G+S++++P   + ++  K K G++     + M++++D    S +    
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPSSYLKKKDGSFVFGTFDMMDSLEDEGAESDIFTIV 68

Query: 60  PHELGQLVSWELEGTVWDYCF-----FNPDEFPNFNLKETKGHHLVVSETCMTLPE-LSA 113
             +LG   +WE     W+Y F      +P E P                  +T+P  +S 
Sbjct: 69  DSQLGVPYNWEALEKQWEYIFEKQLKCDPTELP----------------VLITIPSSISK 112

Query: 114 NMDQVMFEEYEFESLFKSPVAGF-VPFLNL-QDNMKMICGKGDDVMGDLISNMDSQNIKN 171
           N D    E    E   K     F +P+L +  +++ +  G G                  
Sbjct: 113 NED---IENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKT--------------- 154

Query: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDET 231
                +LVID   + + + PI+ GV     + K + GG FL+    +  S    D+ +E 
Sbjct: 155 -----SLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEM 209

Query: 232 ILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQ 269
              +NI     ++S  S++ +FK       D  L D +
Sbjct: 210 TNSSNI-----WVSSNSWIKNFKKTMLQVTDKKLQDVE 242

>ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {ON}
           similar to uniprot|Q12510 Saccharomyces cerevisiae
           YDL156W Hypothetical ORF
          Length = 510

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 17/96 (17%)

Query: 317 GIVETILESLSIVPETIRPLLVNNIVCVGGN-----FNMPNFGSRLATELQRQLPTDWVC 371
           G+V T    LS+   +  P   + +VC G +     F+M N GS+LA+ELQ +L      
Sbjct: 373 GLVSTYDSRLSVSAVSFSPT-DDTLVCNGYDDTIRLFDMNNNGSQLASELQPRLTI---- 427

Query: 372 NIYIPEKDCELQGWKSM--SQFAQNTDIYKKARISR 405
                + +C+   W S+  ++F  N D++  A + R
Sbjct: 428 -----KHNCQSGRWTSILKAKFKPNRDVFAIANMKR 458

>KAFR0B02290 Chr2 complement(450325..451236) [912 bp, 303 aa] {ON}
           Anc_8.184 YER142C
          Length = 303

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 95  KGHHLVVSETCMTLPELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGD 154
           K H  +  E C  + ++   + + +  EY    LFK P  G    L LQD    + G   
Sbjct: 39  KRHSDLFGEACAFITKVDPTLIETI--EYSDFPLFKRPQDGEKSTLALQDYFVKLGGA-- 94

Query: 155 DVMGDLISNMDSQNIKNPYSDF 176
            ++G  ISN+ ++NI+  + D+
Sbjct: 95  -IIGQQISNIAAKNIRGRFCDY 115

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
           involved in control of spindle dynamics
          Length = 816

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 59/112 (52%), Gaps = 9/112 (8%)

Query: 212 LNGLFKETISYRHYDVTDETILVNNIKEKC--LFMSPTSYMDSFKNKDRYSVDYV----L 265
           L GL  E++S+   ++  +TI VN++K++   L      Y+ S   ++  S++      L
Sbjct: 661 LEGLH-ESLSHLEEELKSKTICVNDMKDEISKLEDEKKEYLSSVSKQNTTSINTEGIMNL 719

Query: 266 PDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPETIFHPEMAKLLKPG 317
            + Q   I  ++DK +NS+  +N Q+  L+D+L+ V  +  H +  K+LK  
Sbjct: 720 QNLQRE-IDQLRDKLNNSEQEKNKQLQQLSDDLY-VQYSSKHEQKVKMLKKN 769

>KAFR0D02810 Chr4 complement(559344..561029) [1686 bp, 561 aa] {ON}
           Anc_2.414 YLR031W
          Length = 561

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 30/128 (23%)

Query: 236 NIKEKCLFMSPTSYMDSFKNKD------------------RYSVDYVLPDFQT----SFI 273
           ++K+K + +SPT+ + S  N+                    YSV+YVL D QT     F 
Sbjct: 134 SLKKKTIKLSPTNLVPSGNNQPYSLKSKCTHLPKYNNNPYSYSVNYVLNDEQTPQNAKFP 193

Query: 274 GYVKDKKSNSQLPENSQVITLTDELFSVPETIFHPEMA---KLLKPGIVETILESLSIVP 330
              +     + +P+N+QV ++  + F  P T+  P MA   +L  P + ET L      P
Sbjct: 194 TQNQVLSDATTIPQNAQVPSIDAKHFFKPTTV--PIMAPKVELSSPNVTETTLPQ---EP 248

Query: 331 ETIRPLLV 338
             IRP +V
Sbjct: 249 AKIRPSIV 256

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 89/459 (19%), Positives = 162/459 (35%), Gaps = 117/459 (25%)

Query: 6   IVIDNGSYEVKFGYSDAKVPNRALNALAKDK-----YGAWYLSNQMNNIKDISSVTIRRP 60
           +VI NGS     G+S+ ++P   +++    K     +G + + ++  + ++    TI   
Sbjct: 7   VVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFGTFAMLDECESKEECEVYTIMDK 66

Query: 61  HELGQLVSWELEGTVWDYCF-----FNPDEFPNFNLKETKGHHLVVSETCMTLPELSANM 115
           +  G   +WE     W Y +      +P E P           LV+S     +P   + +
Sbjct: 67  N--GMPYNWEALEAQWRYLYEYELKVDPQELP-----------LVIS-----VPATHSEI 108

Query: 116 DQVMFEEYEFESLFKSPVAGFVPFLNLQ-DNMKMICGKGDDVMGDLISNMDSQNIKNPYS 174
           D  + E Y   +L K  V    P L +  + + +    G                     
Sbjct: 109 DPQVVENYFDLALNKLQV----PALQIVVEPLAVALAMGKSSA----------------- 147

Query: 175 DFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLN----GLFKETI-SYRHYDVTD 229
              LVID G   T + PI+ G      V K   GG FL+     L +E + S  H    +
Sbjct: 148 ---LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYN 204

Query: 230 ETILVNNIKEKCLFMSPT--SYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD---KKSNSQ 284
               +   K   L +     S ++ +                 ++  Y+ +   +K N  
Sbjct: 205 SATWIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFL 264

Query: 285 LPENSQVITLT-DELFSVPETIFHPEMAK---LLKPGIVETILESL-------------- 326
           L +N++ +TL   + + V E +F P++A      + G+ E +  S+              
Sbjct: 265 LKKNNKTVTLELRDCYRVCEYLFQPQLASPDYASRDGLGELLSRSIKKAAASVSAQGTPG 324

Query: 327 -----SIV------------------------PETIRPLLVNNIVCVGGNFNMPNFGSRL 357
                S+V                         E +   L+ N+V  G    +  F  R+
Sbjct: 325 GGQGASLVYNRHQPQLQPEQPSTTTTTASSATTEQVYAQLLTNVVITGSTSLVAGFEPRI 384

Query: 358 ATELQRQLPTD----WVCNIYIPEKDCELQGWKSMSQFA 392
            +EL  + P +    +   I++   D  +QGW +M   A
Sbjct: 385 VSELAVRFPQNKLATYANQIHL---DRAVQGWIAMGAMA 420

>NDAI0B01330 Chr2 (307444..308232) [789 bp, 262 aa] {ON} Anc_2.600
           YMR038C
          Length = 262

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 109 PELSANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDN 145
           P ++A     +F++Y+ ++L KSPV G V  + + DN
Sbjct: 94  PNMAAVSIMEIFKKYKDDTLLKSPVRGLVRIVQVSDN 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,410,368
Number of extensions: 2355141
Number of successful extensions: 6609
Number of sequences better than 10.0: 159
Number of HSP's gapped: 6527
Number of HSP's successfully gapped: 264
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)