Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.358.254ON65865832520.0
NCAS0B049708.254ON66666924020.0
NDAI0B023708.254ON72267023750.0
TPHA0A018408.254ON68568623710.0
Smik_12.1428.254ON66365123460.0
YLR083C (EMP70)8.254ON66766323430.0
YDR107C (TMN2)8.254ON67267223300.0
Suva_10.1678.254ON68467923290.0
Smik_4.3538.254ON69067323130.0
Suva_2.2678.254ON67267223100.0
Skud_12.1518.254ON66465722880.0
KAFR0B026808.254ON66465222730.0
KNAG0G019908.254ON66765322560.0
CAGL0B01683g8.254ON69168522410.0
ZYRO0C01848g8.254ON64765422210.0
TBLA0E043708.254ON67666922090.0
Skud_4.3688.254ON67267322000.0
SAKL0H17248g8.254ON66065221480.0
KLLA0F18931g8.254ON66564821350.0
KLTH0G13882g8.254ON68768821190.0
Kwal_56.235778.254ON68366820850.0
TBLA0H014508.254ON67366920810.0
NCAS0B038908.254ON66366620720.0
TDEL0F038108.254ON65666020050.0
NDAI0J014208.254ON61961918840.0
AGR097W8.254ON65365318790.0
Ecym_43178.254ON60564714760.0
NCAS0A145207.411ON6707154057e-41
TDEL0C027107.411ON6786903924e-39
NDAI0A015107.411ON6796933881e-38
YER113C (TMN3)7.411ON7067333844e-38
KNAG0C034307.411ON6806993827e-38
Smik_5.2587.411ON7067243605e-35
ZYRO0B03784g7.411ON6586733481e-33
KLLA0E20835g7.411ON6766603462e-33
Suva_5.2347.411ON7067213454e-33
Skud_5.2667.411ON7076873436e-33
CAGL0G03487g7.411ON7047233349e-32
SAKL0F12914g7.411ON7076983116e-29
KAFR0K019507.411ON6646873082e-28
KLTH0C06226g7.411ON6945712432e-20
Kwal_27.107467.411ON6902732234e-18
Kpol_1045.287.411ON6816801932e-14
TBLA0I003307.411ON7135071878e-14
Ecym_71437.411ON6767071823e-13
TPHA0K007307.411ON7334921725e-12
AGL295C7.411ON6572701573e-10
ZYRO0C13200g8.164ON10287682.6
NCAS0B089601.29ON749109743.0
Smik_10.501.157ON59671733.4
KNAG0M00710singletonON539100716.3
TPHA0I002708.844ON103962709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.35
         (658 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...  1257   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   929   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   919   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   917   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   908   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   907   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   902   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   901   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   895   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   894   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   885   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   880   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   873   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   867   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   860   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   855   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   852   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   832   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   827   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   820   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   807   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   806   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    802   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   776   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   730   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   728   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   573   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   160   7e-41
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   155   4e-39
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   154   1e-38
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   152   4e-38
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   151   7e-38
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   143   5e-35
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   138   1e-33
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   137   2e-33
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   137   4e-33
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   136   6e-33
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   133   9e-32
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   124   6e-29
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   123   2e-28
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    98   2e-20
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    91   4e-18
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    79   2e-14
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    77   8e-14
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    75   3e-13
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    71   5e-12
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    65   3e-10
ZYRO0C13200g Chr3 (1047580..1047888) [309 bp, 102 aa] {ON} simil...    31   2.6  
NCAS0B08960 Chr2 (1722216..1724465) [2250 bp, 749 aa] {ON} Anc_1...    33   3.0  
Smik_10.50 Chr10 (83672..85462) [1791 bp, 596 aa] {ON} YJL181W (...    33   3.4  
KNAG0M00710 Chr13 complement(118300..119919) [1620 bp, 539 aa] {...    32   6.3  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...    32   9.5  

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/658 (94%), Positives = 619/658 (94%)

Query: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60
           MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK
Sbjct: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60

Query: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120
           GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC
Sbjct: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120

Query: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV 180
           KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV
Sbjct: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV 180

Query: 181 GGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPK 240
           GGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPK
Sbjct: 181 GGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPK 240

Query: 241 SSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLI 300
           SSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLI
Sbjct: 241 SSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLI 300

Query: 301 NFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLL 360
           NF               MRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLL
Sbjct: 301 NFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLL 360

Query: 361 SILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFF 420
           SILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFF
Sbjct: 361 SILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFF 420

Query: 421 NGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLS 480
           NGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLS
Sbjct: 421 NGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLS 480

Query: 481 LAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYS 540
           LAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYS
Sbjct: 481 LAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYS 540

Query: 541 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYI 600
           SLWFNKIFYMFGF                        NLENWRWQWRSFIVGGVGCAFYI
Sbjct: 541 SLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYI 600

Query: 601 FVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           FVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD
Sbjct: 601 FVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/669 (67%), Positives = 518/669 (77%), Gaps = 14/669 (2%)

Query: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60
           M+   +    + +L+LT AFYLPGVAPTTY +GDEIPLLVNHLTPS+ FQ  D  G    
Sbjct: 1   MLSPRLVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-- 58

Query: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120
            NKEHFLYSFDYYF +LHFCKPEH+EKQPESLGSI+FGDRIYNSPF +KMLE + C SLC
Sbjct: 59  KNKEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLC 118

Query: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV 180
           K TIP  DAKFINKLIKNGFFQNWLIDGLPAA +++D KTKS+FYGTGF LG V   QA+
Sbjct: 119 KSTIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI 178

Query: 181 GGLA--------SSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRV 232
            G A        ++   LE   REAKNV  MV N+EI +  NHYDI VEYHDRGEG YRV
Sbjct: 179 DGQAPATTKPKQTTNEGLELETREAKNVQ-MVKNIEIAYFVNHYDIQVEYHDRGEGTYRV 237

Query: 233 VGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHV 289
           VGV V+P   K ST   C      L+L E  DN+V F+YSV+F+PSETVWATRWDKYLH 
Sbjct: 238 VGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHT 297

Query: 290 YDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGD 349
           YDPTIQWFSL+NF               M+ALKSDFARY EFNL+D FQ+D+GWKLGHGD
Sbjct: 298 YDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGD 357

Query: 350 VFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCG 409
           VFRIP KSMLLS+LVGSG QLFLM++ SIFFAA+G LSPSSRGSL + MFILYALFGF G
Sbjct: 358 VFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 417

Query: 410 SYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVI 469
           SY SM VYKFF GPYWK NM+LTP ++PG +F++IVGLNFFL+F+ SSG +P   L F+I
Sbjct: 418 SYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMI 477

Query: 470 VLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFG 529
           +LWFI SIPL+ AGSLIA+KKC W EHPTKTN+IARQIPFQPWYLKT PAT+IAG+FPFG
Sbjct: 478 LLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFG 537

Query: 530 SIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSF 589
           SIAVELYFIY+SLWFNKIFYMFGF                         LENW+WQWR F
Sbjct: 538 SIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGF 597

Query: 590 IVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVK 649
           IVGGVGCA Y+FVHSI+FTKFKLGGF TIVLYVGYS +IS L  VVTGAIGF+SS++FV+
Sbjct: 598 IVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVR 657

Query: 650 KIYSSVKVD 658
           KIYS++KVD
Sbjct: 658 KIYSAIKVD 666

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/670 (66%), Positives = 517/670 (77%), Gaps = 13/670 (1%)

Query: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60
           M+  ++  L +  L+LT AFYLPGVAPTTY   DEIPLLVNHLTPS+ FQHK++ G  +K
Sbjct: 54  MIAPSLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMK 113

Query: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120
            +KE FLYS+DYY+ + HFC+PEH+EKQPESLGSI+FGDRIYNSPF I ML+++ C SLC
Sbjct: 114 SDKERFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLC 173

Query: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQA- 179
           K TIP  DAKFINKLIKNGFFQNWLIDGLPAAR+++D +TK++FYGTGF LG V V Q  
Sbjct: 174 KTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGT 233

Query: 180 --------VGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYR 231
                   V    ++   LE   R+AKNV  M+ N E+P+  NH+DI VEYHDRGE NYR
Sbjct: 234 TTGDNANTVAKKPTTNEGLELDTRDAKNVQ-MLKNFELPYFANHFDIQVEYHDRGENNYR 292

Query: 232 VVGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLH 288
           VVGV V+P   K ST   C      L+L E +DN+V F+YSV+FIPSET+WATRWDKYLH
Sbjct: 293 VVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLH 352

Query: 289 VYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHG 348
           +YDP IQWFSLINF               ++ALKSDFARY E NLDD FQ+++GWKLGHG
Sbjct: 353 IYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHG 412

Query: 349 DVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFC 408
           DVFRIP +S+LLS+LVGSG QLFLM+  SIFFAA+G LSPSSRGSL + MFILYALFGF 
Sbjct: 413 DVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFV 472

Query: 409 GSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFV 468
           GSY SMGVYKFF GPYWK NM+LTPILVPGL+F  IV LN FLLF  SSG IP   L F+
Sbjct: 473 GSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFM 532

Query: 469 IVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPF 528
           I+LWF+ SIPL+LAGSLIA+KKCNW EHPTKTN+IARQIPFQPWYLKT PATLIAG+FPF
Sbjct: 533 ILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPF 592

Query: 529 GSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRS 588
           GSIAVELYFIYSSLWFNKIFYMFGF                         LENW WQWR 
Sbjct: 593 GSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRG 652

Query: 589 FIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFV 648
           FI+GGVGCA Y+F+HSI+FTKFKLGGFTTIVLYVGYS IIS L  +VTGAIGF+SSM F+
Sbjct: 653 FIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFI 712

Query: 649 KKIYSSVKVD 658
           +KIYSS+KV+
Sbjct: 713 RKIYSSIKVE 722

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/686 (64%), Positives = 524/686 (76%), Gaps = 31/686 (4%)

Query: 3   MKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGN 62
           M+  + L++  ++  +AFYLPGVAP+TY +GDE+PLLVNHLTPSLN+Q KDD G  ++ +
Sbjct: 1   MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-S 59

Query: 63  KEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKV 122
           +E  LYSFDYYFPKLHFCKPE + KQP+SLGSILFGDRIYNSPFSIKML+ +    LC +
Sbjct: 60  REKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSI 119

Query: 123 TIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGG 182
           TIP  DAKFINKLIKNGFFQNWLIDGLPAARK++D  T ++FY  GFPLG V +++ VGG
Sbjct: 120 TIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGG 179

Query: 183 LA------------------------------SSKLNLENPAREAKNVNNMVHNVEIPFL 212
           L                                 + + +   RE K ++ +VHNVE P+L
Sbjct: 180 LGIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYL 239

Query: 213 FNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLETEDNEVQFSYSVRF 272
            NHY INVE HDRGEGNYRVVGVTVDP S+T     +K   L L E +DNEV FSYSV F
Sbjct: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNEVTFSYSVNF 299

Query: 273 IPSETVWATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFN 332
           I SETVWATRWDKYLH Y+PTIQWFSL+NF               ++ALKSDFARYEEFN
Sbjct: 300 IESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFN 359

Query: 333 LDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRG 392
           LD++F +DSGWKLGHGDVFRIP +SMLLSILVGSG QLFLM+  SIF AAIGI+SPSSRG
Sbjct: 360 LDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRG 419

Query: 393 SLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLL 452
           SLPSAMF  YALFGF GSY+SM VYKFF GPYWKANMILTP+LVPG + +SI+GLNFFLL
Sbjct: 420 SLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLL 479

Query: 453 FSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPW 512
           F  SSGTIP TAL+ ++V+WF+IS+PLS  GSL+ANK+ NWGEHPTKTN+IARQIPFQ W
Sbjct: 480 FVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSW 539

Query: 513 YLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXX 572
           YLKT+PA LIAG+FPFG+IAVELYFIY+SLWFNKIFYMFGF                   
Sbjct: 540 YLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLI 599

Query: 573 XXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALC 632
                 +ENW WQWRSF +GGVGC+ YIF+HSI+FTKFKLGGFTT++LY+GY+L++S L 
Sbjct: 600 TYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILS 659

Query: 633 AVVTGAIGFISSMLFVKKIYSSVKVD 658
            +VTGA+GFISSM+FV+KIYS+V+VD
Sbjct: 660 CIVTGAVGFISSMIFVRKIYSNVRVD 685

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/651 (66%), Positives = 504/651 (77%), Gaps = 6/651 (0%)

Query: 14  LALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYY 73
           ++   AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QHKD++GN++ G+KE+FLYS+DYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 74  FPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFIN 133
             + HFCKPE VEKQPESLGSI+FGDRIYNSPF +KMLE +EC SLCK TIP +DAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 134 KLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLAS---SKLNL 190
           KLIKNGFFQNWLIDGLPAAR + D +TK+ FYG GF LG V V Q     A+   ++   
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192

Query: 191 ENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDIC 247
           +    + ++ +NMV   E P+  NHYDI +EYHDRGEGNYRVVGV V+P   K S  + C
Sbjct: 193 QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252

Query: 248 TKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXXX 307
                 L+L E  DNEV F+YSV+F+ SET WATRWDKYLHVYDP+IQWFSLINF     
Sbjct: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVV 312

Query: 308 XXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSG 367
                     +RALKSDFARY E NLDD FQ+DSGWKL HGDVFR P +S+ LSILVGSG
Sbjct: 313 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372

Query: 368 TQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKA 427
            QLF MV  SIFFAA+G LSPSSRGSL + MF+LYALFGF GSY SMG+YKFF+GPYWKA
Sbjct: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432

Query: 428 NMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIA 487
           N+ILTP+LVPG + I I+ LNFFL+F  SSG IP + L F++ LWF+ SIPLS AGSL+A
Sbjct: 433 NLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492

Query: 488 NKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKI 547
            KKC+W EHPTKTN+IARQIPFQPWYLKTVPATLIAG+FPFGSIAVELYFIY+SLWFNKI
Sbjct: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552

Query: 548 FYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIF 607
           FYMFGF                         LENW+WQWR FIVGG GCA Y+F+HSI+F
Sbjct: 553 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612

Query: 608 TKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           TKFKLGGFTTIVLYVGYS +IS LC +VTG+IGFISSM F++KIYSS+KVD
Sbjct: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/663 (65%), Positives = 508/663 (76%), Gaps = 6/663 (0%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           M      LL  +++   AFYLPGVAPTTY + D IPLLVNHLTPS+N+QHKD+ GN++ G
Sbjct: 5   MAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSG 64

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KE+FLYS+DYY+ + HFC+PE VEKQPESLGS++FGDRIYNSPF + ML+ +EC SLCK
Sbjct: 65  DKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCK 124

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181
             IP DDAKFINKLIKNGFFQNWLIDGLPAAR+++D +TK+ FYG GF LG V V Q   
Sbjct: 125 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTD 184

Query: 182 GLASSK---LNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVD 238
             A+ K      ++   E +N  NMV   E+P+  NH+DI +EYHDRGEGNYRVVGV V+
Sbjct: 185 IEATPKGAETTDKDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVE 244

Query: 239 P---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQ 295
           P   K S+   C      L+L E  DNEV F+YSV+F  S T WATRWDKYLHVYDP+IQ
Sbjct: 245 PVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQ 304

Query: 296 WFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPD 355
           WFSLINF               +RALKSDFARY E NLDD FQ+DSGWKL HGDVFR P 
Sbjct: 305 WFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPS 364

Query: 356 KSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMG 415
           +S+ LSILVGSG QLFLMV  SIFFAA+G LSPSSRGSL + MFILYALFGF GSY SMG
Sbjct: 365 QSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMG 424

Query: 416 VYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFII 475
           +YKFFNGPYWKAN+ILTP+LVPG + + I+ LNFFL+F  SSG IP + L F++ LWF+ 
Sbjct: 425 IYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLF 484

Query: 476 SIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVEL 535
           SIPLS AGSLIA K+C+W EHPTKTN+IARQIPFQPWYLKT+PATLIAG+FPFGSIAVEL
Sbjct: 485 SIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVEL 544

Query: 536 YFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVG 595
           YFIY+SLWFNKIFYMFGF                         LENW+WQWR FI+GG G
Sbjct: 545 YFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAG 604

Query: 596 CAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSV 655
           CA Y+F+HSI+FTKFKLGGFTTIVLYVGYS +IS LC +VTG+IGFISSMLFV+KIYSS+
Sbjct: 605 CALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSI 664

Query: 656 KVD 658
           KVD
Sbjct: 665 KVD 667

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/672 (64%), Positives = 518/672 (77%), Gaps = 15/672 (2%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           M + ++ L+  Y  LT  F LPG++PTTY  GDEIPLLVN LTPS+ FQH+D++GND+ G
Sbjct: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KEHFLYS+DYY  + HFC+PEHVEKQPESLGS++FGDRIYNSPF + MLE +EC +LCK
Sbjct: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181
            TIP  DAKFIN LIK+GFFQNWL+DGLPAARK +D +TK+++YGTGF LG   V+Q V 
Sbjct: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180

Query: 182 GLA--------SSKLNLEN---PAREAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229
           G A        +S+ + E+    AR  KNV  N+V  VE+P+  NH+DI VE+HDRG  N
Sbjct: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240

Query: 230 YRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKY 286
           YRVVGV V+P S   S+   C+     LIL E +DNEV F+YSV+F+ S+TVWATRWDKY
Sbjct: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300

Query: 287 LHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLG 346
           LH+YDP IQWFSLINF               +RALKSD ARY E NLD+ F +DSGWKLG
Sbjct: 301 LHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLG 360

Query: 347 HGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFG 406
           HGDVFR P KSMLLSILVGSG QLFLMV  SIFFAA+G++SP SRGSLP+ MF+LYALFG
Sbjct: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420

Query: 407 FCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALI 466
           F GSY SMGVYKFF GPYWKANMILTPIL+PG +F+ IV +NFFLLF+ SSG IP  +L 
Sbjct: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480

Query: 467 FVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLF 526
           F+I+LWF++S+PLS AGS++A+K+CNW EHPTKTN+IARQIP+QPWYL+T  ATLIAG+F
Sbjct: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540

Query: 527 PFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQW 586
            FGSIAVELYFIYSSLWFNKIFYMFGF                         LENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQW 600

Query: 587 RSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSML 646
           RSFI+GG+GC+ Y F+HSI+FTKFKLGG  T+VLY+GYSLIISALC VVTGAIGF SSM 
Sbjct: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660

Query: 647 FVKKIYSSVKVD 658
           F++KIYS++KV+
Sbjct: 661 FIRKIYSAIKVE 672

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/679 (64%), Positives = 507/679 (74%), Gaps = 31/679 (4%)

Query: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68
           LL   ++   AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QH+D+ GN++ G+KEHFLY
Sbjct: 8   LLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLY 67

Query: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128
           S+DYY+ K HFCKPEHVEKQPESLGSI+FGDRIYNSPF + ML+ +EC SLCK  IP DD
Sbjct: 68  SYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDD 127

Query: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLA---- 184
           AKFINKLIKNGFFQNWLIDGLPAAR++HD +TK+DFYG GF LG V V Q V        
Sbjct: 128 AKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQ 187

Query: 185 ----------------------SSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEY 222
                                 SS   +E  AR+     NMV   E P+  NH+DI +EY
Sbjct: 188 VASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK--NMVKTREFPYFANHFDIKIEY 245

Query: 223 HDRGEGNYRVVGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVW 279
           HDRGEGNYRVVGV V+P   K S+   C      L+L E  DNEV F+YSV+F  S T W
Sbjct: 246 HDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSW 305

Query: 280 ATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQ 339
           ATRWDKYLHVYDP+IQWFSLINF               +RALKSDFARY E NLDD FQ+
Sbjct: 306 ATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQE 365

Query: 340 DSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399
           DSGWKL HGDVFR P +S++LSILVGSG Q+FLMV  SIFFAA+G LSPSSRGSL + MF
Sbjct: 366 DSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMF 425

Query: 400 ILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGT 459
           ILYALFGF GSY SMG+YKFF+GPYWKAN+I+TP+L+PG + + I+ LNFFL+F  SSG 
Sbjct: 426 ILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGV 485

Query: 460 IPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPA 519
           IP + L F++ LWF+ SIPLS AGSL+A KKC+W EHPTKTN+IARQIPFQPWYLKT+PA
Sbjct: 486 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPA 545

Query: 520 TLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNL 579
           TLIAG+FPFGSIAVELYFIY+SLWFNKIFYMFGF                         L
Sbjct: 546 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCL 605

Query: 580 ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639
           ENW+WQWR F VGGVGCA Y+F+HSI+FTKFKLGGFTTIVLY+GYS +IS LC +VTG+I
Sbjct: 606 ENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSI 665

Query: 640 GFISSMLFVKKIYSSVKVD 658
           GFISSM F++KIYSS+KVD
Sbjct: 666 GFISSMFFIRKIYSSIKVD 684

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/673 (63%), Positives = 521/673 (77%), Gaps = 15/673 (2%)

Query: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60
           +M ++I+ LL  Y+ LT AF LPG++PTTY K DEIPLLVN LTPS+ FQH+D+ G DI 
Sbjct: 18  VMKQSIWLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDIS 77

Query: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120
            +KEH+LYS+DYY  + HFC+PEHVE+QPESLGSI+FGDRIYNSPF ++MLE +EC +LC
Sbjct: 78  SDKEHYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALC 137

Query: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV 180
           + TIP  DAKFINKLIK+GFFQNWL+DGLPAARK+ D +TK+++YGTGF LG   V+  +
Sbjct: 138 ENTIPGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTI 197

Query: 181 GG--LASSKLNLENP---------AREAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEG 228
            G  + S+   L++          ARE KN+  N+V  VE+P+  NH+DI VE+HDRG+ 
Sbjct: 198 DGKVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDD 257

Query: 229 NYRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDK 285
           NYRVVGVTV+P S   S+ D C+K +  LIL E  DNE+ F+YSV+F+ S+TVWATRWDK
Sbjct: 258 NYRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDK 317

Query: 286 YLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKL 345
           YLH+YDP IQWFSLINF               +RAL SD +RY E NLD+ F +DSGWKL
Sbjct: 318 YLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKL 377

Query: 346 GHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALF 405
           GHGDVFR P KSMLLS+LVGSG QLFLM+  SIF AA+G++SP SRGSLP+ MF+ YALF
Sbjct: 378 GHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALF 437

Query: 406 GFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTAL 465
           GF GSY SMGVYKFF+GPYWKAN+ILTPIL+PG +F+ IV +NFFLLF+ SSG IP + L
Sbjct: 438 GFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTL 497

Query: 466 IFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGL 525
            F+I LWF +SIPLS AGS+IA+K CNW EHPTKTN+IARQ+P+QPWYL+T+ ATLIAG+
Sbjct: 498 FFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGI 557

Query: 526 FPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQ 585
           F FGSIAVELYFIYSSLWFNKIFYMFGF                         LENW+WQ
Sbjct: 558 FCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQ 617

Query: 586 WRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSM 645
           WRSFI+GG+GC+ Y+F+HSI+FTKFKLGGF TIVLY GYS IISALC VVTGAIGF S M
Sbjct: 618 WRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCM 677

Query: 646 LFVKKIYSSVKVD 658
           LF++KIYS+VK++
Sbjct: 678 LFIRKIYSAVKIE 690

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/672 (64%), Positives = 514/672 (76%), Gaps = 15/672 (2%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           M K I+  L +Y+AL  AF LPGV+PTTY   DEIPLLVN LTPS+ FQHKD+ G D+  
Sbjct: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KEHFLYS+DYY  K HFCKPEHVEKQPESLGS++FGDRIYNSPF +KMLE++EC +LCK
Sbjct: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181
            TIP  DAKFIN LIKNGFFQNWL+DGLPAAR ++D +TK+++YGTGF LG   V+Q VG
Sbjct: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180

Query: 182 GLA-----------SSKLNLENPAREAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229
           G              SK      AR+ KN+  N+V  +E+    NH++I VEYHDRG GN
Sbjct: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240

Query: 230 YRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKY 286
           YRVVGVTV+P S   S+   C+     L L+E +DN+V F+YSV+FI S+TVWATRWDKY
Sbjct: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300

Query: 287 LHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLG 346
           LHVYDP IQWFSLINF               +RA++SDFARY E NLD+ F +D+GWKLG
Sbjct: 301 LHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLG 360

Query: 347 HGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFG 406
           HGDVFRIP KSM+LS+LVGSG QLFLM+  SIFFAA+G++SP+SRGSLP+ MF+LYALFG
Sbjct: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420

Query: 407 FCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALI 466
           F GSY SMGVYKFF+GPYWKAN+I+TPIL+PG +F+ IV +NFFLLF+ SSG IP   L 
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480

Query: 467 FVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLF 526
           F+I LWF +SIPLS AGS IA+K+C W EHPTKTN+IARQ P QPWYL+T+ ATLIAG+F
Sbjct: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540

Query: 527 PFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQW 586
            FGSIAVELYFIYSSLWFNKIFYMFGF                         LENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQW 600

Query: 587 RSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSML 646
           RSFI+GG+GC+ Y+F+H+I+FTKFKLGGF T+VLYVGYS IISALC VVTGAIGF SSM+
Sbjct: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660

Query: 647 FVKKIYSSVKVD 658
           F++KIYS +KV+
Sbjct: 661 FIRKIYSRIKVE 672

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/657 (64%), Positives = 499/657 (75%), Gaps = 7/657 (1%)

Query: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68
           LL  +++ T AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QH+D+QGN + G+KE+FLY
Sbjct: 8   LLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLY 67

Query: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128
           S+DYY+ + HFC+P+HVEKQPESLGS++FGDRIYNSPF + ML+ +EC  LC  TIP +D
Sbjct: 68  SYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGND 127

Query: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV-GGLASSK 187
           AKFINKLIKNGFFQNWLIDGLPAAR+++D +TK++FYG GF LG+V V Q      A  +
Sbjct: 128 AKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQ 187

Query: 188 LNLENPAREAKNVN---NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KS 241
               N   E        ++V   E P+  NH+DI +EYHDRG G+YRVVGV V+P   K 
Sbjct: 188 AETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKR 247

Query: 242 STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLIN 301
           S    C   +  LIL E  DNEV F+YSV+F  S T WATRWDKYLHVYDP+IQWFSLIN
Sbjct: 248 SITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLIN 307

Query: 302 FXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLS 361
           F               +RALKSDFARY E NL+D FQ+DSGWKL HGDVFR P  S+LLS
Sbjct: 308 FSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLS 367

Query: 362 ILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFN 421
           ILVGSG QLFLMV  SIFFAA+G LSPSSRGSL + MFILYALFGF GSY SMG+YKFFN
Sbjct: 368 ILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFN 427

Query: 422 GPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSL 481
           GPYWKAN++LTP+LVPG + + IV LNFFL+   SSG IP   L F++ LWF+ SIPLS 
Sbjct: 428 GPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSF 487

Query: 482 AGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSS 541
            GSLIA KKC W EHPTKTN+IARQIPFQPWYLKT+PATLIAG+FPFGSIAVELYFIY+S
Sbjct: 488 GGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTS 547

Query: 542 LWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIF 601
           LWFNKIFYMFGF                         LENW+WQWR FIVGGVGCA Y+F
Sbjct: 548 LWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVF 607

Query: 602 VHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           +HSI+FTKFKLGGF TIVLYVGYS +IS LC +VTG+IGFISSM F+++IYSS+KVD
Sbjct: 608 IHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/652 (65%), Positives = 510/652 (78%), Gaps = 12/652 (1%)

Query: 17  TSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPK 76
           T AFYLPGVAPTTY +GDEIPLLVNHL+PS+ +QHK+D+G D+  +K  +LYS+DYY+ +
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 77  LHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLI 136
            HFC+PE +EKQPESLGSI+FGDRIYNSPF + MLE ++C SLCK TIP +DAKFINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 137 KNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG------GLASSKLNL 190
           KNGFFQNWLIDGLPAA + HD +T +DFYG+GF LG V V QAV        +A++    
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194

Query: 191 ENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP----KSSTGDI 246
           E  AR+AKNV   + NVE+ +  NHYDI +EYHDRG G+YRVVGV V+P    +SS G  
Sbjct: 195 ELDARDAKNVKT-IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGS- 252

Query: 247 CTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXX 306
           C      L L E EDN+V F+YSV F+PSET WATRWDKYLHVYDPTIQWFSL+NF    
Sbjct: 253 CESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIV 312

Query: 307 XXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGS 366
                      ++ALK+DFARY EFNLDD FQ+D+GWKL HGDVFRIP KSMLLS+LVGS
Sbjct: 313 LLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGS 372

Query: 367 GTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWK 426
           G QLF+M++ +IFFAA+G LSPSSRG L + MF+LYALFGF GSY SMGVYKFF GPYWK
Sbjct: 373 GVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWK 432

Query: 427 ANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLI 486
           ANM+LTPILVPG +FI+I+ +NFFL++  SSG IP   L F+++LWF+ SIP + AGSL+
Sbjct: 433 ANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLV 492

Query: 487 ANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNK 546
           ANKKCNW EHPTKT +IARQIPFQPWYLKT+PAT IAG+FPFGSIAVE+YFIY+SLW+NK
Sbjct: 493 ANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK 552

Query: 547 IFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSII 606
           IFYMFGF                         LENW WQWRSFIVGGVGCA Y+F+HSI+
Sbjct: 553 IFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSIL 612

Query: 607 FTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           FTKFKLGGFTT+VLY+GYS IIS LC +VTG+IGF+SSM FV+KI+SS+KVD
Sbjct: 613 FTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/653 (66%), Positives = 507/653 (77%), Gaps = 17/653 (2%)

Query: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77
           +AFYLPGVAPTTY   DEIPLLVNHL+PS+ +QH+ + G ++KG+K  +LYS+DYY+ + 
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137
           HFC+PE + K+PESLGSI+FGDRIYNSP+ IKMLE + C  LC   IP  DA+FINKLIK
Sbjct: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139

Query: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGL---------ASSKL 188
           NGFFQNWLIDGLPAAR +HD  T SDFYG GF LG+V V QAV             S+KL
Sbjct: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKL 199

Query: 189 NLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGD 245
           +     R+AKNV  M+ NVE+P+  NH+DI VEYHDRGEGN RVVGVTVDP   K S+  
Sbjct: 200 S----TRDAKNVQ-MLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPG 254

Query: 246 ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXX 305
            C      L+L E  DNEV F+YSVRF+ S+TVWATRWDKYLH YDPTIQWFSL+NF   
Sbjct: 255 TCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIV 314

Query: 306 XXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVG 365
                       ++AL+SDFARY E NLD+ FQ+DSGWKL HGDVFRIP KSMLLSILVG
Sbjct: 315 VVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVG 374

Query: 366 SGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYW 425
           SG QLFLM++VSIFFAA+G LSPSSRGSL + MF+LYALFGF GSY SMGVYKFF GPYW
Sbjct: 375 SGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYW 434

Query: 426 KANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSL 485
           KANMILTP+LVPG L +SIVGLN FLL + SSGTIP   L F+++LWF+IS+P +LAGSL
Sbjct: 435 KANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSL 494

Query: 486 IANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFN 545
           IA+KKC+W EHPTKTN++ARQ+PFQPWYLKTV AT IAG+FPFGSIAVELYFIY+SLW+N
Sbjct: 495 IAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYN 554

Query: 546 KIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSI 605
           KIFYMFGF                        +LENW+WQWRSFIVGGVGCA Y+FVHSI
Sbjct: 555 KIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSI 614

Query: 606 IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           +FTK KLGGF TIVLYVGYS +IS LC +VTG+IGF+SSM FV++IYSS+KV+
Sbjct: 615 LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/685 (61%), Positives = 500/685 (72%), Gaps = 35/685 (5%)

Query: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68
           +LS+++A T  FYLPG AP TY +GD IPLLVNHLTPSLNFQH DD GN+IKG+K   LY
Sbjct: 7   VLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLY 66

Query: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128
            +DYY  KLHFC+PE +EKQPESLGS++FG++IYNSPF++KMLE+ EC  LC  TIP  D
Sbjct: 67  PYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKD 126

Query: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGG--LASS 186
           AKFINKLIKNGF QNWLIDGLPAARKLHD +T ++FYG GF LG V VRQAVGG  ++ S
Sbjct: 127 AKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSES 186

Query: 187 KLNLENPAREAKN-----------------------------VNNMVHNVEIPFLFNHYD 217
           +  L+   R+AKN                             V+N+V NVE+P   NH+D
Sbjct: 187 EKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFD 246

Query: 218 INVEYHDRGEGNYRVVGVTVDPKS----STGDICTKKSGGLILLETEDNEVQFSYSVRFI 273
           I VEYHDRG G++RVVGV V+P S     +          L L E +DNEV F+YSV+F 
Sbjct: 247 IEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFT 306

Query: 274 PSETVWATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNL 333
           PS+T WATRWDKYLH+YDP IQWFSLINF               +RALKSD +RY EFNL
Sbjct: 307 PSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNL 366

Query: 334 DDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGS 393
            D F++DSGWKL HGDVFR P  SMLLS+LVGSG QLFLM+ +SI  +A+GILSPSSRGS
Sbjct: 367 GDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGS 426

Query: 394 LPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLF 453
           LP+AMF+ YA+FGF GSY SMG+YKFF GPYWKANMILTP+L+PG++F++++ +N  L F
Sbjct: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYF 486

Query: 454 SRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWY 513
             SS  IP   L+F++ LW + SIPL+ AGSLI+ KKCNW EHPTKTNEI RQIPFQPW+
Sbjct: 487 VGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWF 546

Query: 514 LKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXX 573
           LKTVPATLI GL  FGSIAVELYFIYSSLWFNKIFYMFGF                    
Sbjct: 547 LKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIIT 606

Query: 574 XXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCA 633
                 ENW WQWRSF +GG+GC+ YIF+HSI+FT+FKLGGF TIVLYVGYS +IS L  
Sbjct: 607 YRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTC 666

Query: 634 VVTGAIGFISSMLFVKKIYSSVKVD 658
           +VTGAIGFI SM FV++I++S+KVD
Sbjct: 667 IVTGAIGFICSMFFVRRIFASIKVD 691

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/654 (64%), Positives = 502/654 (76%), Gaps = 19/654 (2%)

Query: 8   CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL 67
           CLL+   +L  AFYLPGVAPTTY   DEI LLVNHLTPS+NFQH+D+ GN +KG+KEH+L
Sbjct: 10  CLLT---SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYL 66

Query: 68  YSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPAD 127
           YS+DYY+ K HFCKPE+V +QP SLGS++FGDRI+NSPF + MLE +EC  LC   IP +
Sbjct: 67  YSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGE 126

Query: 128 DAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSK 187
           DAKF+NKLIKNGF QNWLIDGLPA R++HD +T S+FYGTGF LG V V +   G + S 
Sbjct: 127 DAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE---GFSDSN 183

Query: 188 LNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTG 244
                   E K +   +  +E+P+L NHYDIN+EYHDRG  NYRVVGVTVDP   K S+ 
Sbjct: 184 -------DEEKKI---MKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSS 233

Query: 245 DICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXX 304
           D C   SG L L ETE+NEV F+YSV+FI S+TVWATRWDKYLHVYDPTIQWFSLIN   
Sbjct: 234 DSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSV 293

Query: 305 XXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILV 364
                        +RALK+D +RY EFNLD+ F +DSGWKL HGDVFRIP +S+LLSILV
Sbjct: 294 IVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILV 353

Query: 365 GSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPY 424
           GSG QLFLM+A SI FAA+G LSPSSRGSLP+ MF+LYALFGF GSY SM +YKFF GP 
Sbjct: 354 GSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPL 413

Query: 425 WKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGS 484
           WK N++LTP+LVPG +F++I+ LNFFL+F RSSG IP   L  +I+LWF+ SIPLS AGS
Sbjct: 414 WKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGS 473

Query: 485 LIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWF 544
           LIA+K+C    HPTKTN+IARQIP QPWYLKT+P +LIAG+FPF SIAVELYFIY+SLWF
Sbjct: 474 LIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWF 533

Query: 545 NKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHS 604
           NKIFYMFGF                         LENW+WQWRSFI+GG GCA Y+F+HS
Sbjct: 534 NKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHS 593

Query: 605 IIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           I+FTKFKLGGFTT+VLY+GYS +IS LC +VTG+IGFISSM F++KIYSSVKVD
Sbjct: 594 ILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/669 (61%), Positives = 499/669 (74%), Gaps = 21/669 (3%)

Query: 8   CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL 67
           CL++  L++T+ FYLPGVAPTTY + D IPLLVNHLTPS+ F+HKD  GN++  +KE+FL
Sbjct: 11  CLIT--LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFL 68

Query: 68  YSFDYYFPKLHFCKP--EHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIP 125
           YS+DYY+ KLHFCKP    ++KQPESLGSILFGDRIYNSPF +KML ++ C  LC   IP
Sbjct: 69  YSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIP 128

Query: 126 ADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG---- 181
            DDAKFIN LIK+GF QNWLIDGLPAAR+L+D  TKS FYG+GF LG+V + Q V     
Sbjct: 129 GDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPS 188

Query: 182 ----------GLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYR 231
                      + S +L+ E  A E +    +V +VE  +  NH+DI++EYHDRG   YR
Sbjct: 189 HTTPKQPIVEDVLSQELD-EEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYR 247

Query: 232 VVGVTVDPKSSTGD--ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHV 289
           +VGVTV+P S   D  IC    G L L E  D +V F+YSV F  S+TVWATRWDKYLH+
Sbjct: 248 IVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHI 307

Query: 290 YDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGD 349
           YDPTIQWFSLINF                +ALK+DF RY EFNL+D+F +DSGWKL HGD
Sbjct: 308 YDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGD 367

Query: 350 VFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCG 409
           VFRIP KSMLLSI VGSGTQLF M++  +  AA+G LSPS+RGSLP+ MFILYA+FGF G
Sbjct: 368 VFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVG 427

Query: 410 SYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVI 469
           SY SMGVY+FFNGPYWKANMILTP++VPG +F+ I+ +N FL+F  SS  +P   L  ++
Sbjct: 428 SYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMV 487

Query: 470 VLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFG 529
           +LW ++S+PLS AGSLI+ K+C W +HPTKTNE+ RQIPFQPWYLKTVPATLI G+FPFG
Sbjct: 488 LLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFG 547

Query: 530 SIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSF 589
           SIAVELYFIYSSLWFNKIFYMFGF                         LENWRWQWRSF
Sbjct: 548 SIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSF 607

Query: 590 IVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVK 649
           I+GG+GC+ YIF+HSI+FT+FKLGGF TIVLYVGYS +I+ LCA+VTGAIGFIS+M FVK
Sbjct: 608 IIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVK 667

Query: 650 KIYSSVKVD 658
           KIYSS+KV+
Sbjct: 668 KIYSSIKVE 676

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/673 (60%), Positives = 503/673 (74%), Gaps = 17/673 (2%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           M ++I+  L  Y+ +  AF LPG++PTTY   DEIPLLVN LTPS+ FQH+D+ GNDI  
Sbjct: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KEHFLYS+DYY  + HFC+PEHVEKQPESLGS++FGDRIYNSPF ++MLE +EC +LCK
Sbjct: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181
            TIP  DA+FIN+LI +GFFQNWL+DGLPAAR ++D +TK+++YGTGF LG   V Q VG
Sbjct: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180

Query: 182 G------LASSKLNLENPA-----REAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229
                  +  + ++  N       R  KN+  N V  VE+P+  NH++I VE+H+RG  +
Sbjct: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240

Query: 230 YRVVGVTVDP----KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDK 285
           YR+VGVTV+P    +SS G  C++    L L E  DNEV F+YSV+F+ S TVWATRWDK
Sbjct: 241 YRIVGVTVNPVSIERSSPGS-CSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDK 299

Query: 286 YLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKL 345
           YLH+YDP IQWFSLI F               +RALKSD  RY E NL++ F +D+GWKL
Sbjct: 300 YLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKL 359

Query: 346 GHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALF 405
            HGDVFR P KSMLLS+LVGSG QLFLM+  SIFFAA G++SP SRGSL + MF+LYALF
Sbjct: 360 SHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALF 419

Query: 406 GFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTAL 465
           GF GSY SMGVYKFF+GPYWKAN+I+TPIL+PG + + IV +N FLLF+ SSG IP  +L
Sbjct: 420 GFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSL 479

Query: 466 IFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGL 525
            F+I LWF++SIPLS  GS++A+K+C+W EHPTKTN+IARQIP QPWYL+T  AT++AG+
Sbjct: 480 FFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGI 539

Query: 526 FPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQ 585
           F FGSIAVELYFIYSSLWFNKIFYMFGF                         LENW WQ
Sbjct: 540 FSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQ 599

Query: 586 WRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSM 645
           WRSFI+GG+GC+ Y+F+HSI+FTKFKLGGF T+VLY+GYS I+S LC VVTGAIGF SSM
Sbjct: 600 WRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSM 659

Query: 646 LFVKKIYSSVKVD 658
           +F++KIY +VKV+
Sbjct: 660 IFIRKIYYAVKVE 672

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/652 (61%), Positives = 485/652 (74%), Gaps = 12/652 (1%)

Query: 16  LTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFP 75
           + SAFYLPGVAPTTY KGDEIPLLVNHLTPS  FQH D +G+ + G+KE FLYS+DYY+ 
Sbjct: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71

Query: 76  KLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKL 135
           K HFC+PE++ KQPESLGSI+FGDRIYNSPF + MLEN+ C  LCK  IP DDAKFINKL
Sbjct: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131

Query: 136 IKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSK------LN 189
           I+NGFF NWL+DGLPAAR++HD +T S FYG GF LG V V   +    + K      + 
Sbjct: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191

Query: 190 LENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDI 246
           + +  +E K  +  +   E+ +  NH+DI +EYHDRGE NYRVVGV+V P   K  + D 
Sbjct: 192 IADADKELKERSAKL--TELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDS 249

Query: 247 CTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXX 306
           C  +   L+L E  DN V F+YSV F+PS+T+WATRWDKYLHVYDP IQWFSLI+F    
Sbjct: 250 CDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIV 309

Query: 307 XXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGS 366
                       RALK+D +RY E NLDD FQ+++GWKL HGDVFR P+++MLLS+LVGS
Sbjct: 310 ILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGS 369

Query: 367 GTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWK 426
           G QLFLM   +I FA +G+LSPSSRGSL + MFILYALFG  GSY SM VYKFFNG  WK
Sbjct: 370 GAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWK 429

Query: 427 ANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLI 486
            NMILTPIL+P ++FIS++GLN FL+F  SSG IP   ++ ++VLWF+ SIPLS+AGS+I
Sbjct: 430 LNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSII 489

Query: 487 ANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNK 546
           + KK  W + PT TN+IARQIPFQPWYLKTVPA+LIAG FPFGSI VELYFIYSSLWFNK
Sbjct: 490 SRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNK 548

Query: 547 IFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSII 606
           IFYMFGF                         +ENW+WQWR F +GG GCAFY+FVH+I+
Sbjct: 549 IFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAIL 608

Query: 607 FTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           FTKFKLGG TT+VLY+GYS++IS LC ++TGA+GF+SS+ FV+KIY S+KVD
Sbjct: 609 FTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/648 (61%), Positives = 479/648 (73%), Gaps = 6/648 (0%)

Query: 16  LTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFP 75
           L  AFYLPGVAPTTY +GD++PLLVNHLTPS  ++H D   +D  G+KE FLYS+DYY+ 
Sbjct: 19  LVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYK 77

Query: 76  KLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKL 135
           K HFC+P  ++KQPESLGSI+FGDRIYNSPF +++L+N EC SLCK  IP  DAKFINKL
Sbjct: 78  KFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKL 137

Query: 136 IKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG-GLASSKLNLENPA 194
           I NGFFQNW+IDGLPAARK+ D KT   FYG GF LG V V         S    LE   
Sbjct: 138 ILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYEPDTRSLHDELELQL 197

Query: 195 REAKNVNNMVHNV-EIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDICTKK 250
              KNV +    V EIP+  NHYDI +EYHDRGE NYR+VGVTV+P   K  + D C   
Sbjct: 198 NAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCEST 257

Query: 251 SGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXXXXXX 310
              L+L ETEDNEV F+YSV+FI S+TVWATRWDKYLHVYDP IQWFSLINF        
Sbjct: 258 GKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLS 317

Query: 311 XXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQL 370
                    ALK+D ARY E NLD  F++++GWKL HGDVFR P+K++LLS+LVGSG QL
Sbjct: 318 SVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQL 377

Query: 371 FLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMI 430
            LM+  +I FA +G LSPSSRGSL + MF+LYA+FG  GS+ SM  YKFFNG  W+ N++
Sbjct: 378 ALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLV 437

Query: 431 LTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKK 490
           LTP+LVPG +   ++GLNFFL+F  SSG IP   ++ +++LWF+ISIPLS  GS+IA KK
Sbjct: 438 LTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKK 497

Query: 491 CNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYM 550
           CNW EHPTKTN+IARQIPFQPWYLKT+P  L+AG+FPFGSIAVELYFIYSSLWFNKI+YM
Sbjct: 498 CNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYM 557

Query: 551 FGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKF 610
           FGF                         +ENW+WQWRSF++GG GCAFY+F HSI+FTKF
Sbjct: 558 FGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKF 617

Query: 611 KLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           +LGG TTIVLY+GYS++IS LC +VTGAIGF+SS++ V+KIYS VKVD
Sbjct: 618 RLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/688 (59%), Positives = 494/688 (71%), Gaps = 32/688 (4%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           M+  I  L  ++ +  S FYLPGVAPTTY +GD IPLLVNHLTP++ +QH D+ GND+ G
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-G 59

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KE  LYS+DYY+PK HFC+PE +EKQ ESLGSI+FGDRIYNSPF I+ML+N+EC SLC 
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQA-- 179
            +IPADDAKFINKLI NGFFQNWL+DGLPAARK  DV+TKS+FY  GF LG V +  +  
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 180 -------------VGGLASSKLNLEN------PA-------REAKNVNNMVHNVEIPFLF 213
                         G   S+K   E+      PA       ++  N   +V  +E P+  
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFA 239

Query: 214 NHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSV 270
           NH++I V+YHDRG GNYRVVGV V+P   K  + D C K    L L ETE  EV FSYSV
Sbjct: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSV 299

Query: 271 RFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEE 330
           +F PSETVWATRWDKYLHVYDP IQWFSLINF                  L  D +RY +
Sbjct: 300 KFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ 359

Query: 331 FNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSS 390
            NLDD FQ+++GWKL HGDVFR P++S++LS+LVGSG QLFLM A +I FA +G+LSPSS
Sbjct: 360 INLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSS 419

Query: 391 RGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFF 450
           RGSL + MFILYALFG  GSY SM  YKFF GPYWK NM+LTPILVPGLLF  ++ LNFF
Sbjct: 420 RGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFF 479

Query: 451 LLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQ 510
           L+   S+G IP   +  +++LWF+ SIPLS+AGSLIA KKC W EHPTKT +I RQIPFQ
Sbjct: 480 LVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQ 539

Query: 511 PWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXX 570
           PWYLKTVPA+LIAG+FPFGSIAVELYFIYSSLWFNKIFYMFGF                 
Sbjct: 540 PWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITV 599

Query: 571 XXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISA 630
                   LENW+WQWR F +GG GCA Y+F+H+I+FTKF+LGGFTTIVLYVGYSL++S 
Sbjct: 600 LLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSL 659

Query: 631 LCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           L  ++TG +GF+SS+ FV++IYSSVKVD
Sbjct: 660 LSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/668 (59%), Positives = 478/668 (71%), Gaps = 29/668 (4%)

Query: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77
             FYLPGVAPTTY +GD IPLLVNHLTPS+ F+H DD G D  G++E FLYS+DYY+ K 
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKF 76

Query: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137
           HFCKPE +EKQ ESLGSI+FGDRIYNSPF ++ML+++EC +LC   IPA+DAKFINKLI 
Sbjct: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136

Query: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLG-----------------NVHVRQAV 180
           NGFFQNWL+DGLPAARK  D +TKS+FY  GF LG                 + H + A 
Sbjct: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196

Query: 181 GGLASSKLNLENPAREAK-------NVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVV 233
             +A     L+ P++          +   +V  +E  +  NH++I V+YHDRG G+YRVV
Sbjct: 197 KPVAQDDY-LDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255

Query: 234 GVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVY 290
           GV V+P+S    + + C      L L E E+  V FSYSV+F PS+TVWATRWDKYLHVY
Sbjct: 256 GVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVY 315

Query: 291 DPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDV 350
           DP IQW+SLINF                R L+ D +RY + NLDD FQ+++GWKL HGDV
Sbjct: 316 DPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375

Query: 351 FRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGS 410
           FR P KS+LLS+LVGSGTQLF+M A +I FA +G+LSPSSRGSL + MFILYALFG  GS
Sbjct: 376 FRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGS 435

Query: 411 YVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIV 470
           Y SM  YKFF G YWK NMILTPILVPGLLF  ++GLNFFL+   S+G IP   +  +++
Sbjct: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495

Query: 471 LWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGS 530
           LWF+ SIPLSLAGSLIA KKC W EHPTKT +I RQIPFQPWYLKT PA LIAG+FPFGS
Sbjct: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555

Query: 531 IAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFI 590
           IAVELYF+YSSLWFNKIFYMFGF                         LENW+WQWR F 
Sbjct: 556 IAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFW 615

Query: 591 VGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKK 650
           +GG GCA Y+F+H+I+FTKFKLGGF TIVLYVGYSL+IS L  ++TGA+GF+SS+ FV++
Sbjct: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675

Query: 651 IYSSVKVD 658
           IYSS+KVD
Sbjct: 676 IYSSIKVD 683

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/669 (57%), Positives = 484/669 (72%), Gaps = 13/669 (1%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61
           ++ +I CL+S ++  ++AFY+PG++  TY  GD I L VN LTPS+ F+H D+ G  +  
Sbjct: 4   LLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVAN 63

Query: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121
           +KEHFLYS+DYY+ K HFC+PE VE++ ESLGS+LFGDRIYNSPF + MLE +EC  LCK
Sbjct: 64  DKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCK 123

Query: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181
            TIPADDAKFINKLIKNGFF NWLIDGLP+ARK++D KT+S FY +GFPLG+V V    G
Sbjct: 124 TTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSG 183

Query: 182 GL-----ASSKLNLEN----PAREAKNV-NNMVHNVEIPFLFNHYDINVEYHDRGEGNYR 231
           G        SKL  E       REAKNV   ++   E+ +  NH++I++EYHDRG  NYR
Sbjct: 184 GSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYR 243

Query: 232 VVGVTVDPKSSTGD---ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLH 288
           VVGVTVDP S   D    CT     L L E  +N+V F+YSV FI SET WATRWDKYLH
Sbjct: 244 VVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLH 303

Query: 289 VYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHG 348
            YDP+IQWFSLINF               +RALK D +RY + NLD++F +DSGWKL HG
Sbjct: 304 TYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHG 363

Query: 349 DVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFC 408
           DVFR+P K+M+LSI VGSG QLFLM+   +  AA+G +SPS RG+LP+ MF+LYA+FGF 
Sbjct: 364 DVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFV 423

Query: 409 GSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFV 468
           GSY SMGVYKFF+GPYWKANMILTP+LVPG + + I+ LNFFLL   SSGTIP + +I +
Sbjct: 424 GSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILM 483

Query: 469 IVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPF 528
           I LW ++S+PLS  GS +A KKCNW ++PT  NEI R+IP QPWY++++P  L++G+ PF
Sbjct: 484 ICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPF 543

Query: 529 GSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRS 588
           G+IAVELYFIYSSLW+NKIFYMFGF                         LENWRWQWRS
Sbjct: 544 GAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRS 603

Query: 589 FIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFV 648
           F+ GG+GCAFYIF++SI FT+FK  GF +I+LY+GYS +I  +  ++TGA+ F+ +M FV
Sbjct: 604 FVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFV 663

Query: 649 KKIYSSVKV 657
           K+I++S+KV
Sbjct: 664 KRIFTSIKV 672

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/666 (57%), Positives = 485/666 (72%), Gaps = 14/666 (2%)

Query: 1   MMMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIK 60
           +++  +FCL     ++  AF LPG+ P TY KGD+IPLLVNHLTPS++F HK+++G DI 
Sbjct: 4   VILSLLFCL-----SVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDIS 58

Query: 61  GNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLC 120
             K++ ++S+DYY+ K HFC+P H+EK   S+GSILFGDRIYNSPF + MLEN+ C  LC
Sbjct: 59  TAKKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLC 118

Query: 121 KVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV 180
           +  IP  DA+FINKLIKNG++QNW IDGLPAAR+++D +TKS FYG GF LG V +RQ  
Sbjct: 119 ESIIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTT 178

Query: 181 GG--LASSKLNLENPA-REAKN-VNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVT 236
           G   L  S  ++ + A R+AKN V N++  VE+P+  NH+DI +EYH+RG GNYRVVG T
Sbjct: 179 GDKLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGAT 238

Query: 237 VDP----KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDP 292
           V+P    + S GD CT     L L E EDN V  +YSV F+PS+T W TRWDKYLHVYDP
Sbjct: 239 VNPVSIARKSAGD-CTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDP 297

Query: 293 TIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFR 352
            IQWFSLINF               ++ALKSDFARY   NLDD  +++SGWKL HG VFR
Sbjct: 298 KIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFR 357

Query: 353 IPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYV 412
           IP   M+LSILVGSG QLFL++  ++F AAI ILSP  RG+LP+AM ILY LFGF  SYV
Sbjct: 358 IPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYV 417

Query: 413 SMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLW 472
           SMGVYKFF GPYWK NM+LTPILVPGL+ I+ + LN FL+FS SS  +P   ++ +I+LW
Sbjct: 418 SMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLW 477

Query: 473 FIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIA 532
           F +SIPLS+AGSL+A KKC+W EHPT TN+IA+ IP Q WYLKT+PA+LI GLF FGSI+
Sbjct: 478 FAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSIS 537

Query: 533 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVG 592
           V+LYFIY+SLWFN IFYM+GF                          ENW+WQWR F +G
Sbjct: 538 VQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIG 597

Query: 593 GVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIY 652
           G+GC+ Y+ +HS+ F + KLGGFT I+LY+GYS +++AL  +VTG++GF+SSM F+K+I+
Sbjct: 598 GLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIF 657

Query: 653 SSVKVD 658
           SSVKVD
Sbjct: 658 SSVKVD 663

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/660 (57%), Positives = 467/660 (70%), Gaps = 8/660 (1%)

Query: 3   MKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGN 62
           M   F  LS+  A++ A +LPG++PT Y    EI L VNHLTPS +FQHKD  GN+IK +
Sbjct: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60

Query: 63  KEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKV 122
           KEH+LYS+DYY  KLHFCKPE+V +Q ESLGS+LFGDR+YNSPF + MLE++ C SLCK 
Sbjct: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120

Query: 123 TIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV-- 180
            IP +DA FINKLIKNGF  NWL+DGLPA   +++ +  S     GFPLG+V + Q V  
Sbjct: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN 180

Query: 181 GGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPK 240
           G +A+ +   E     A   +N+V N+E+P L NHYDI ++YH+   G YR+VGV V+PK
Sbjct: 181 GAMATPR---EETGISAHG-SNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPK 236

Query: 241 S--STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFS 298
           S   T + C      + L E +DNEV ++YSVR++     WATRWD Y   YD T+QWFS
Sbjct: 237 SIKQTSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFS 296

Query: 299 LINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSM 358
           LI+                +RALKSDFARY E NLDD F ++SGWKL HGDVFR+P+KS+
Sbjct: 297 LISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSL 356

Query: 359 LLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYK 418
           LLS+LVGSG QL L+    I  AAI   +  SR  LP+  F+LYALFGF GSY SMGVY+
Sbjct: 357 LLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYR 416

Query: 419 FFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIP 478
           FF GPY K NMILTP L+PGL+ ++I+ LNFFLL + SS  IP +AL  V++LW IIS+P
Sbjct: 417 FFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVP 476

Query: 479 LSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFI 538
           LSLAGSL A K C+W +HPTKTN+IARQIPFQPWYLKT+PA L+AG+FPF SIAVELYFI
Sbjct: 477 LSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFI 536

Query: 539 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAF 598
           Y+SLWF++ FYMFGF                         LENW+WQWRSFIVGG+G A 
Sbjct: 537 YNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAV 596

Query: 599 YIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           YIF+HSI FT+FKL GFTTIVLYVGYS++IS LC + TGA+GF SSM  V+KI+SSVKVD
Sbjct: 597 YIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/619 (56%), Positives = 449/619 (72%), Gaps = 7/619 (1%)

Query: 47  LNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPF 106
           +++ HK+ +G DI  + +  +YS+DYY+ KLHFCKPEHVEK   S+GS+LFGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 107 SIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYG 166
            + ML+N+ C  LC  TI   DAKFINKLIKNG++QNWLIDGLPAAR+++D +TKS+FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 167 TGFPLGNVHVRQAVGG--LASSKLNLEN-PAREAKN-VNNMVHNVEIPFLFNHYDINVEY 222
            GF LG V +RQ  G   L +S     +   R+AKN V N++ ++E+P+  NH+DI +EY
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180

Query: 223 HDRGEGNYRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVW 279
           HDRG  NYRVVGVTV+P S   S    C      L L E+E N + F+YSV FIPSET W
Sbjct: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240

Query: 280 ATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQ 339
            TRWDKYLHVYDPTIQW S++NF               ++ALKSDF+RY E NLD+T ++
Sbjct: 241 VTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIKE 300

Query: 340 DSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399
           D+ WKLGHGDVFR PD  MLLSILVGSG QLFLM+  +IF  A+G+++P SRG+LP+ MF
Sbjct: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360

Query: 400 ILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGT 459
           +LY  F F  S+VSMGVYKFFNG  W  N ILTP LVPGLL + I+GLN FL+F  SSG 
Sbjct: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSGV 420

Query: 460 IPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPA 519
           IP      +I+LWF I +PLS+ GSL+A K C+W  HPTKTN +++ IP Q WYL+T+PA
Sbjct: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480

Query: 520 TLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNL 579
           +LI GLF FGS++VELYF+Y+SLWFNKIFYM+GF                        + 
Sbjct: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLSA 540

Query: 580 ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639
           ENW+WQWRSF++ G+GC+FY+F+HS++FT+ KLGGFT  +LY+GYS +I++L  VVTGA+
Sbjct: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600

Query: 640 GFISSMLFVKKIYSSVKVD 658
           GF+SSMLFV+ IYS+VKVD
Sbjct: 601 GFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/653 (54%), Positives = 464/653 (71%), Gaps = 16/653 (2%)

Query: 13  YLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDY 72
           +L L   FYLPG APTTY +GD IPLLVNH+TP++     D  G D + +KE +LY++DY
Sbjct: 10  WLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDY 67

Query: 73  YFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFI 132
           Y+P+LH C+P+ +EK  ESLGSI+FGDR++NSPF +KMLE + C +LC+ T+PA+DAKFI
Sbjct: 68  YYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFI 127

Query: 133 NKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLEN 192
           N+LI++GFF NWL+DGLPA R++HD +T + FYGTGF LG V +R       +   N E 
Sbjct: 128 NQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-IR------GTEDRNQEE 180

Query: 193 PAREAKNVNNMVHN----VEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKS---STGD 245
           P         ++      V +P+  NH++I V+YH R E   RVVGV+V P+S     GD
Sbjct: 181 PGEIELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGD 240

Query: 246 ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXX 305
            C     GL+L ET D +V F+YSVRF  S+  WATRW KYLHVYDP +QW+SLINF   
Sbjct: 241 KCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLV 300

Query: 306 XXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVG 365
                        RALK+D  RY +FNLD+ FQ+D GWKL H DVFR P K++LLS+ VG
Sbjct: 301 VLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVG 360

Query: 366 SGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYW 425
           SG QLFLM A ++F A +G LSPSSRGSL + MF+LYA+FG  GSY+SM  YK F G  W
Sbjct: 361 SGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKW 420

Query: 426 KANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSL 485
           K NM+LTP+LVPG++F +++ +NFFL+  +SSG +P   ++ ++VLWF++SIP+S+ GSL
Sbjct: 421 KVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSL 480

Query: 486 IANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFN 545
            A KK  W +HPTKT++IA+QIP QPWYL+T PA  IAGLFPFG+IAVELYFIY+S+WFN
Sbjct: 481 FARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFN 540

Query: 546 KIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSI 605
            +FYMFGF                         +ENW WQWRSFI+GG+GC+ Y+F++SI
Sbjct: 541 TMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSI 600

Query: 606 IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
           +FTKF+LGGF TIVLYVGYSL+IS L  +VTG IGF+SS+ FV+KIYSS+KVD
Sbjct: 601 LFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/647 (44%), Positives = 399/647 (61%), Gaps = 56/647 (8%)

Query: 15  ALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYF 74
            ++  FY PGV+P TY  GDEIPLLVN+L+                     FL++ DYY 
Sbjct: 12  GVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYS 52

Query: 75  PKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINK 134
             +  CKP  +++Q ESLGS++FGDR+YNSPF + ML+N EC  LC  TI   D    N 
Sbjct: 53  DSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNT 109

Query: 135 LIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPA 194
                +  NWL+DGLP                    LG      A G   +S+L +   A
Sbjct: 110 FFGYRYSYNWLVDGLPV-------------------LGIDGTSDANGYHNNSELFMGYQA 150

Query: 195 REAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKS---STGDICTKKS 251
            E K            +++NH+DI + Y+DRG+G YRVV     P S   +  ++C+K +
Sbjct: 151 DEQK------------YIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDA 198

Query: 252 GGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFXXXXXXXXX 311
             + +       + F+YSV F  S+  W+TRWD+YLHVYD  IQ   LI+F         
Sbjct: 199 KPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSS 258

Query: 312 XXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLF 371
                  R LK D A Y EFNLDD FQQD  WK+ HG+VFR P K++LLS+ VGSG+QLF
Sbjct: 259 VLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLF 318

Query: 372 LMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMIL 431
            M   ++   + G LSPS+RGSL + MF+LYALFG  GSY SM +YKFF G  WK N+IL
Sbjct: 319 FMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLIL 378

Query: 432 TPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKC 491
           TP+L+P  LF++ V LNFFL++++SSG +P   ++ +I+LWFI+S+P+S+ GSL++ K  
Sbjct: 379 TPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLN 438

Query: 492 NWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMF 551
            W EHP KTN+IARQ+P QPWY+KT  AT +AG+FPFG++AVELY+IY+S+W   IF+M+
Sbjct: 439 RWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMY 498

Query: 552 GFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFK 611
           GF                         +ENW+WQWRSFI+GGVGC+ Y+F+HS+ F KFK
Sbjct: 499 GFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFK 558

Query: 612 LGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658
             GF ++VLY+GYS ++S +C +VTG+IGF++++ FV+KIYS++KVD
Sbjct: 559 FPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  160 bits (405), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 177/715 (24%), Positives = 276/715 (38%), Gaps = 122/715 (17%)

Query: 2   MMKTIFCLLSVYLALTSAFYLPG-----------VAPTTYGKGDEIPLLVNHLTPSLNFQ 50
           ++ T+ CL+S+Y+      Y              + P  Y KGD + L+VN +       
Sbjct: 8   LVLTLLCLISIYILFGKGVYQRSRKGSILENSGWLRPNYYSKGDPVELIVNKV------- 60

Query: 51  HKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEHVEKQPE--SLGSILFGDRIYNSPFSI 108
                        E  L    Y +  L F  P  + K+P   SL  I+ GDR + S + +
Sbjct: 61  -------------ESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYIL 107

Query: 109 KMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDG-LPAARKLHDVKTKSDFYGT 167
              E+ +C  LC      +  K   +L+KNG+   WLID  LPA            +Y +
Sbjct: 108 NFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWLIDDELPAVTTFISTTDHKKYYAS 167

Query: 168 GFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGE 227
           GFPLG V                 +P      +N             H  I + Y+    
Sbjct: 168 GFPLGFV-----------------DPETGKTYLN------------THVMIVIRYNTVDT 198

Query: 228 GNYRVVGVTVDPKSSTGDICTKKSGG-----LILLETEDNE--VQFSYSVRFIPSETV-W 279
             + + G  + PKS+    C   S       L++ E +D+   + F+YSV +     V W
Sbjct: 199 NKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDW 258

Query: 280 ATRWDKYLHVYD------PTIQWFSLINFXXXXXXXXXXXXXXXMRALK------SDFAR 327
             RWD YL+  +          W SL N                 R  K      SD ++
Sbjct: 259 EHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVILYRTFKISRRSFSDISK 318

Query: 328 YEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILS 387
            EE +    +     W L      + P  ++L+ I V  G Q    V  S+  +      
Sbjct: 319 -EEDDKGSIYVVARKWLLNE----QTPLANVLI-IFVSMGVQFLFTVLGSLIISCSLKKL 372

Query: 388 PSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFN----------GPYWKANMILTPILVP 437
            + R S+ +   + +    F  S+    + K               Y+    +L   L+P
Sbjct: 373 HNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLP 432

Query: 438 GLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHP 497
             + +  + LN  +    S+  +P   ++F+I ++F++ IPLSL G  IA K  N    P
Sbjct: 433 SFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLLGGYIAVKSTN--SKP 490

Query: 498 TKTNEIA---------RQIPFQPWYLKTVP----ATLIAGLFPFGSIAVELYFIYSSLWF 544
           + +  I          + I   P  L   P    A L  GLFPF  I VEL ++Y SLW 
Sbjct: 491 SFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWL 550

Query: 545 NKI--FYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENW---RWQWRSFIVGGVGCAFY 599
            K   +Y +GF                        N  +     W+W SF +G   CAFY
Sbjct: 551 EKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFY 609

Query: 600 IFVHSIIFTKFKLG--GFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIY 652
           + V+S+ +  F L   GF++I + V Y  + + +C   TG+I  ++S  FV+KIY
Sbjct: 610 MEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  155 bits (392), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 171/690 (24%), Positives = 279/690 (40%), Gaps = 117/690 (16%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y  GD + LLVN +   L                      F Y +  L F  P  
Sbjct: 41  LQPNVYRWGDHVELLVNKVESDLT--------------------QFPYGYYDLPFTCPPT 80

Query: 85  VEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
            +K+P   SL  I+ GDR + S + +K  ++  C +LC         +   +L++ G+  
Sbjct: 81  EDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 143 NWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
            WLID  LPAA           +Y +GFPLG V                 +P  E   +N
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFV-----------------DPDTEKTYLN 183

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGG-----LIL 256
             V  V            + Y+      + +VG  V PKS +   C   S G     LI+
Sbjct: 184 THVMMV------------IRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIV 231

Query: 257 LETEDN--EVQFSYSVRFIPSETV-WATRWDKYLHVYDPT------IQWFSLINFXXXXX 307
            E ED    + F+YSV +     V W+ RW+ +L+  + +        W +L N      
Sbjct: 232 PENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISF 291

Query: 308 XXXXXXXXXXMRALKSDF-ARYEEFN--LDDTFQQDSGWKLGHGDVFRIPDKSM---LLS 361
                      R ++    A  EEF    D+  + DS + +    + +    S+   +L+
Sbjct: 292 LLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFKILT 351

Query: 362 ILVGSGTQ-LFLMVAVSIFFAAIGILSPSSRGSLPSAMFIL----YALFGFCGSYVSMGV 416
           I V  G Q LF ++    F  ++  L       L  A F L    Y    F G+++ +  
Sbjct: 352 IFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDH 411

Query: 417 YKFFNGPYWKANM--ILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFI 474
               +G   +     IL    +PGL+ IS   LN+ +  + SS  +P   ++  + ++F+
Sbjct: 412 RTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFV 471

Query: 475 ISIPLSLAGSLIANK--KCNWGEHPTKTNEIARQIPFQPWYLKTVPATL----------- 521
           I IPLSL G  ++++  +      P  ++  AR I  +P      P TL           
Sbjct: 472 ICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KP---CRAPTTLAPRKISERLTF 526

Query: 522 ------IAGLFPFGSIAVELYFIYSSLWFNKI--FYMFGFXXXXXXXXXXXXXX------ 567
                 I G  PF  I VEL +IY S+W  K   +Y++GF                    
Sbjct: 527 DFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGC 586

Query: 568 -XXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGY 624
                        ++WR  W+ F++ G  CA+Y+ ++S+  IF   K+ GF +I + V Y
Sbjct: 587 YVMMRKHKRVATFDSWR--WKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSY 643

Query: 625 SLIISALCAVVTGAIGFISSMLFVKKIYSS 654
           SLI + +C    G++G+++S   V +++ +
Sbjct: 644 SLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  154 bits (388), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 169/693 (24%), Positives = 279/693 (40%), Gaps = 128/693 (18%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y +GDE+ L+VN +   L                        Y +  L F  P  
Sbjct: 41  LQPNFYFQGDEVELIVNKVESDLT--------------------QLPYAYYDLPFTCPPT 80

Query: 85  VEKQP--ESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
           + K+P   SL  I+ GDR + S + +K  ++  C  LC      +  K   KL+++G+  
Sbjct: 81  MHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVV 140

Query: 143 NWLID-GLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
            WLID  LPAA        +  +Y +GFPLG V                 +P      +N
Sbjct: 141 QWLIDEELPAATTFISTIDQKKYYASGFPLGFV-----------------DPDTGKVYLN 183

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGG-----LIL 256
               +V +   +N  D+N          + +VG  V PKS +   C   S       +++
Sbjct: 184 T---HVMLVIRYNTVDVN---------KHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVI 231

Query: 257 LETEDNE--VQFSYSVRFIPSETV-WATRWDKYLH----VYDPTIQ--WFSLINFXXXXX 307
            E +D+   + F+YSV +     V W  RWD YL+      + T Q  W SL N      
Sbjct: 232 PENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVF 291

Query: 308 XXXXXXXXXXMRALKS------DFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLS 361
                     +R+ KS      D  + EE      ++    W +      R P  ++L+ 
Sbjct: 292 LMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINE----RTPLANLLI- 346

Query: 362 ILVGSGTQLFLMVAVSIFFAAIGILSPSSR--------GSLPSAMFILYALFGFCGSYVS 413
                   LF+ + V   F  +G L+ S           S+ +   + + L  F  SY+ 
Sbjct: 347 --------LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIG 398

Query: 414 MGVYKFFNGPYWKAN----------MILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPT 463
             + +  N    K             IL    +PG++ I  + LN  +    S+  +P  
Sbjct: 399 SVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFK 458

Query: 464 ALIFVIVLWFIISIPLSLAGSLIANKKCNWGE------HPTK------TNEI--ARQIPF 509
            ++  I ++FI+ IPLS+ G  +AN     G       H ++       N++   + I  
Sbjct: 459 TVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFL 518

Query: 510 QPWYLKTVPAT---LIAGLFPFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXX 564
               LK++      L++G+FPF  I VEL ++Y S+W  K   +Y +GF           
Sbjct: 519 FGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIV 578

Query: 565 XXXXXXXXXXXXXNL---ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLG--GFTTIV 619
                        ++    N  W+W SF +G   CA+Y+ ++S+ +  F L   GF++I 
Sbjct: 579 VGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIF 637

Query: 620 LYVGYSLIISALCAVVTGAIGFISSMLFVKKIY 652
           + V Y  + + LC    G+I  ++S  FV+K+Y
Sbjct: 638 ISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  152 bits (384), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 173/733 (23%), Positives = 289/733 (39%), Gaps = 128/733 (17%)

Query: 5   TIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNH--------LTPSLNFQHKDDQG 56
           T+  ++ V L L + FY    +  T G G E P++ +         +TP  NF  K D  
Sbjct: 11  TLMAIVVVMLILRNQFY----SSRTRGHGQE-PVISSSQKNLYDGWITP--NFYRKGDPL 63

Query: 57  NDIKGNKEHFLYSFDYYFPKLHFCKPEHVEKQPE--SLGSILFGDRIYNSPFSIKMLENQ 114
             I    E  L    Y +  L F  P  + K+P   SL  I+ GDR + S + +K  E+ 
Sbjct: 64  ELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDN 123

Query: 115 ECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDG-LPAARKLHDVKTKSDFYGTGFPLGN 173
            C +LC      +  + ++KL++ G+   WLID  LPAA           +Y +GFPLG 
Sbjct: 124 PCETLCARKTTKEGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGF 183

Query: 174 VHVRQAVGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVV 233
           +                 +P            + +  +L NH  + + +H        +V
Sbjct: 184 I-----------------DP------------DTDKTYLHNHVMLVIRFHASDNDKNTIV 214

Query: 234 GVTVDPKSSTGDICTKKSGGL----ILLETEDNEVQ---FSYSVRFIPS-ETVWATRWDK 285
           G  V P+S +   C   S       I++  ++NE+    F+YSV +    E  W  RWD 
Sbjct: 215 GFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDY 274

Query: 286 YLHV----YDPTIQ--WFSLINFXXXXXXXXXXXXXXXMRALKSD---------FARYEE 330
           +L+      + +IQ  W SL N                +R + +D             E 
Sbjct: 275 FLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEG 334

Query: 331 FNLDDTFQQDSGWKLGHGDVFRIPDKSM-----------LLSILVGSGTQLFLMVAVSIF 379
              +D    D   K G   V+ +    +           +L +LV  G Q    +  S+ 
Sbjct: 335 IETEDDLDDD---KYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLT 391

Query: 380 FAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMI--------- 430
            +       + R S+ +   + + L  F  S+V   +         KAN +         
Sbjct: 392 ISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDY 451

Query: 431 --LTPIL-------VPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSL 481
              +PI        +PG++ +S   LN  +    S+  +P   ++F + ++FI+ IPLSL
Sbjct: 452 KKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSL 511

Query: 482 AGSLIANK---KCNWGEHPTKTNEIA---------RQIPFQPWYLKTVPATLIAGLFPFG 529
            G ++AN       W    TK    +          +  F P          + G+FP  
Sbjct: 512 FGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLL 568

Query: 530 SIAVELYFIYSSLWFNKI----FYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENW--- 582
            I VE+ ++Y SLW  K     FY F F                          E+    
Sbjct: 569 VIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVR 628

Query: 583 -RWQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639
             W+W+ F +G  G   Y+ ++S+  IF    + GF++I++ + YSLI + +C++  GA+
Sbjct: 629 NNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGAL 687

Query: 640 GFISSMLFVKKIY 652
            ++++  F+ KIY
Sbjct: 688 SYLTASWFINKIY 700

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  151 bits (382), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 163/699 (23%), Positives = 282/699 (40%), Gaps = 124/699 (17%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + PT Y  GD + ++VN                 I+ +     Y   YY   L F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNK----------------IESDATQLPYG--YY--DLPFTCPPT 72

Query: 85  VEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
           V+K+P   SL  ++ GDR + S + ++  ++ ECT LC      D  + ++K IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 143 NWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
            W ID  LPAA        +  +YG+GFPLG   V +  G +                  
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLG--FVDEETGKV------------------ 172

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLET-- 259
                    ++ NH  + + YH   + N+ +VG  + PKS +   C   S      E   
Sbjct: 173 ---------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVV 223

Query: 260 -----EDNEVQFSYSVRFIPS-ETVWATRWDKYLHVYDPT------IQWFSLINFXXXXX 307
                ED  + F+YSV +    +  W  R++ +    + +        W SL N      
Sbjct: 224 PEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLANSASIAF 283

Query: 308 XXXXXXXXXXMR--ALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVG 365
                     ++   + +     +E      F     W          P    L   +V 
Sbjct: 284 LMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNWFYDDR-----PVMPHLFICIVS 338

Query: 366 SGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYW 425
            G      V  S+  +       + R S+ +   + + L  F  S+V   +    N    
Sbjct: 339 MGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTLLIENNKLIM 398

Query: 426 K--------ANMILTPI----LVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWF 473
           +        +N++L  +    L+PG++ ++ + LN  +    S+  +P   ++ ++ ++F
Sbjct: 399 RRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYF 458

Query: 474 IISIPLS-LAGSLIANKKCNWGEH----------PTKTNEI-----------ARQIPFQ- 510
           I+ IPLS L GS+ ANK                  T+ N+I            R++ ++ 
Sbjct: 459 IVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKV 518

Query: 511 PWYLK-------TVPATLIAGLFPFGSIAVELYFIYSSLWFNKI--FYMFGFXXXXXXXX 561
            W LK       TV + L +G+FPF  I VEL F+Y S+W+ K   +Y +GF        
Sbjct: 519 RWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILL 578

Query: 562 XXXXXXXXXXXXXXXXNLENW----RWQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGF 615
                            + +      W+W++F +    CA+Y+  +SI  +F    +  F
Sbjct: 579 CLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDF 637

Query: 616 TTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSS 654
           ++I++ V YSL+ +ALC +  G+IG+++S+ FVK++Y S
Sbjct: 638 SSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  143 bits (360), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 169/724 (23%), Positives = 275/724 (37%), Gaps = 132/724 (18%)

Query: 11  SVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSF 70
           S+  +  S  Y   + P  Y  GD + L+VN +                    E  L   
Sbjct: 38  SIIYSSQSNLYDGWITPNFYKNGDPLELIVNKV--------------------ESDLTQL 77

Query: 71  DYYFPKLHFCKPEHVEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128
            Y +  L F  P  + K P   SL  I+ GDR + S + +   E+  C  LC      + 
Sbjct: 78  PYAYYDLPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEG 137

Query: 129 AKFINKLIKNGFFQNWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSK 187
            + ++KLI+ G+   WLID  LPAA           +Y +GFPLG               
Sbjct: 138 MQTLDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGF-------------- 183

Query: 188 LNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC 247
                          M  +    +L NH  + + +H    G   +VG  V P+S +   C
Sbjct: 184 ---------------MDPDTGKTYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHC 228

Query: 248 TKKSGGL----ILLETEDNEVQ---FSYSVRFIPS-ETVWATRWDKYLHVYD------PT 293
              S       I +  ++NE+    F+YSV +    E  W  RWD +L+  +        
Sbjct: 229 PGASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQ 288

Query: 294 IQWFSLINFXXXXXXXXXXXXXXXMRALKSD---------FARYEEFNLDDTFQQDSGWK 344
             W S  N                +  + +D             E    +D    D   K
Sbjct: 289 FHWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNND---K 345

Query: 345 LGHGDVFRI---------PDKSML--LSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGS 393
                V+ +         PD   L  L +LV  G Q    V  S+  +       + R S
Sbjct: 346 YSKNSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNS 405

Query: 394 LPSAMFILYALFGFCGSYVSMGV-----YKFFNGPYW------KANMILTPIL------- 435
           + +   + + +  F  S+V   +      + FN  Y+      K     +PI        
Sbjct: 406 VLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSS 465

Query: 436 VPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANK------ 489
           +PG++ IS   LN  +    S+  +P   ++F I ++FI+ IPLSL G ++AN       
Sbjct: 466 LPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 490 ---KCNWGEHPTKTNEIARQIPFQPWYLKTV--PATLIAGLFPFGSIAVELYFIYSSLWF 544
                   E  +K N++   +P  P     +      + G+FP   I VE+ ++Y SLW 
Sbjct: 526 WLSGITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWL 583

Query: 545 NKI----FYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENW----RWQWRSFIVGGVGC 596
            K     FY F F                          E+      W+W+ F +G  G 
Sbjct: 584 EKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG- 642

Query: 597 AFYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSS 654
             Y+ ++S+  IF    + GF++I++ + YSL+ + +C +  GA+ ++++  F+ KIY  
Sbjct: 643 GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-H 701

Query: 655 VKVD 658
           VKV+
Sbjct: 702 VKVN 705

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 158/673 (23%), Positives = 267/673 (39%), Gaps = 103/673 (15%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y  GD + L+VN +         + +  DI          F YY   L F  P  
Sbjct: 41  LKPNVYSIGDPLELVVNTV---------ESEITDIP---------FGYY--DLPFTCPPT 80

Query: 85  VEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
            EK+P   SL  I+ GDR + S + + + ++  C  LC      +  +    LIK+G+  
Sbjct: 81  PEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMV 140

Query: 143 NWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
            W+ID  LPAA           +Y  GFPLG+V  R       SS++             
Sbjct: 141 QWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVDPR-------SSRV------------- 180

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLETED 261
                    F  NH  + + Y+        +VG    PKS +   C   S      E  D
Sbjct: 181 ---------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGASKDFKPFEITD 231

Query: 262 NEVQ------FSYSVRFIP-SETVWATRWDKYLHVYD------PTIQWFSLIN---FXXX 305
             ++       +YSV +   +E  W+ RW  Y++          T  W +L N       
Sbjct: 232 PPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLF 291

Query: 306 XXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVG 365
                        R         E  +  D F   + W L     F++      L + V 
Sbjct: 292 VTFIVIVNLIMIFRNPNEQLESKENEDSSDIFNVANNW-LRARQGFQLNR----LIVCVS 346

Query: 366 SGTQLFLMV----AVSIFFAAIGILSPSSRGSLPSAMFILYALFG-FCGSYVSM----GV 416
            G Q+  M+    A+S+    +  +  +S  ++ +  F+  A    F G+++ M      
Sbjct: 347 MGIQVMFMILGPLAISLSLTRLHNIK-NSVLTIAALCFVAGAFMASFVGTWLKMDQNISA 405

Query: 417 YKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIIS 476
           Y F+N  +     +L    +PG + +  + LN  +    S+  +P   ++  +  +F++ 
Sbjct: 406 YTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVC 461

Query: 477 IPLSLAGSLIANKKCNWGEH--PTKTNEIARQIPFQPWY----LKTVPATLIAGLFPFGS 530
           I +SL G  +A +      H  P  T    R++  +       L    A LI+G  PF  
Sbjct: 462 IVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVI 521

Query: 531 IAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLE-----NWR 583
           I VEL ++Y S+W  K  ++Y++ F                         L      +  
Sbjct: 522 IYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQN 581

Query: 584 WQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGF 641
           W+WR F++   GC++Y+ ++S+  IF    + G + + + V YS I + LC + TG++G+
Sbjct: 582 WRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGY 640

Query: 642 ISSMLFVKKIYSS 654
           ++S  FVKKI+ +
Sbjct: 641 LTSSWFVKKIHRT 653

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 156/660 (23%), Positives = 266/660 (40%), Gaps = 102/660 (15%)

Query: 46  SLNFQHKDDQGNDIKGNK-EHFLYSFDYYFPKLHF-CKP-EHVEKQPESLGSILFGDRIY 102
           S NF    D+  DI  NK E  L  F Y +  LHF C P + ++  P +   IL+G++ +
Sbjct: 58  SPNFYEYGDKV-DITVNKVESDLTHFSYGYYDLHFTCPPSQDMKPLPLTFSDILYGNKKW 116

Query: 103 NSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLI-DGLPAARKLHDVKTK 161
            S + +   ++++C  LC      +  K   +LIK  +   WL  D LP A    + K K
Sbjct: 117 QSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKDK 176

Query: 162 SDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVE 221
             +Y +GFPLG                   +P  +   +N            NH  I + 
Sbjct: 177 KKYYSSGFPLGQY-----------------DPETDEAYIN------------NHVMIVIR 207

Query: 222 YHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGL----ILLETEDNE-VQFSYSVRFIPSE 276
           YH   +G   +VG  V PKS +   C   S       I    ED E + F+Y+V +    
Sbjct: 208 YHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVYWREDF 267

Query: 277 TV-WATRWDKYLH---VYDPTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFN 332
            V W  RW+ +++   + + T   F  I F               +  +     + +E +
Sbjct: 268 KVDWKNRWNFFINGGELKESTSNQFHWITF------ANGIIVTSCLLLIVIAILKRQETD 321

Query: 333 LDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQ-LFLMVAVSIFFAAIGILSPSSR 391
              T Q  + W      +F        L++LV  G   LF  +   I   ++        
Sbjct: 322 GSITTQLAAEWSKARVPLF------FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGS 375

Query: 392 GSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPIL---VPGLLFISIVGLN 448
             L  A+F+  +     GS+ S  +     G   +  ++ + I    +PG+  + ++ LN
Sbjct: 376 SVLTCAVFLFIS-----GSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLN 430

Query: 449 FFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIA---- 504
           + L  + ++ T+P   +  +   +FI+ +P+S+ G   A++        T  N  A    
Sbjct: 431 YILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEV 490

Query: 505 RQIPFQPWYLKT-----------VPATLIAGLFPFGSIAVELYFIYSSLWFNK--IFYMF 551
            +   +P Y+++           +  TL  GL PF  I VEL F Y SLW  K  ++Y++
Sbjct: 491 NKHDTRPLYVESKNSIPFVLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLY 550

Query: 552 GFXXXXXXXXXXXXXXXXXXXXXXXXNLEN------W------------RWQWRSFIVGG 593
           GF                        N  N      W             W+W++F +GG
Sbjct: 551 GFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG 610

Query: 594 VGCAFYIFVHSIIFTKF--KLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKI 651
              A+Y+  +SI++  F  +   F +  L+V YS + + LC    G++ ++SS+ F+ K+
Sbjct: 611 -AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  137 bits (345), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 161/721 (22%), Positives = 276/721 (38%), Gaps = 135/721 (18%)

Query: 12  VYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFD 71
           V+    + +Y   + P  Y KGD + L+VN +                    E  L    
Sbjct: 39  VFSGQDNTYYDGWITPNFYKKGDPLELIVNKV--------------------ESDLTQLP 78

Query: 72  YYFPKLHFCKPEHVEKQP--ESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDA 129
           Y +  L F  P  + K+P   SL  I+ GDR + S + +   E+  C +LC      +  
Sbjct: 79  YAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGM 138

Query: 130 KFINKLIKNGFFQNWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKL 188
           + ++KL++ G+   WLID  LPAA           +Y +GFPLG V              
Sbjct: 139 QSLDKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFV-------------- 184

Query: 189 NLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICT 248
              +P            +    +L NH  + + +H        +VG  V P+S +   C 
Sbjct: 185 ---DP------------DTGKTYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCP 229

Query: 249 KKSGGL----ILLETEDNEVQ---FSYSVRFIPS-ETVWATRWDKYLHVYD------PTI 294
             S       I++  ++NE+    F+YSV +    E  W  RWD +L+  +         
Sbjct: 230 GASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQF 289

Query: 295 QWFSLINFXXXXXXXXXXXXXXXMRAL-----KSDFARY----EEFNLDDTFQQDSGWKL 345
            W S  N                ++ +      +D  +Y    E   ++D    D   K 
Sbjct: 290 HWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDD---KY 346

Query: 346 GHGDVFRIPDKSM-----------LLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSL 394
           G   V+ +    +           +L +LV  G Q    V  S+  +       + R S+
Sbjct: 347 GKNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSV 406

Query: 395 PSAMFILYALFGFCGSYV-----------SMGVYKFFNGPYWKANMILTPIL-------V 436
            +   + + L  F  S+V           S+ +    +   +      +P+        +
Sbjct: 407 ITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSL 466

Query: 437 PGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANK---KCNW 493
           PGL+ +S   LN  +    S+  +P   ++F I ++FI+ IPLSL G  +AN      +W
Sbjct: 467 PGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHW 526

Query: 494 GEHPTKTNEIAR---------QIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWF 544
               TK               +  F P          + GLFPF  I VEL ++Y S+W 
Sbjct: 527 LSGITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVWL 583

Query: 545 NKI--FYMFGFXXXXXXXXXXXXXXXXXXXXXXXX-------NLENWRWQWRSFIVGGVG 595
            K   +Y +GF                               ++ N  W+W+ F +G  G
Sbjct: 584 EKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRN-NWRWKCFEMGFSG 642

Query: 596 CAFYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYS 653
              Y+ ++S+  IF    + GF++ ++ + YSL+ + +C +  G + ++++  F+ KIY 
Sbjct: 643 -GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYH 701

Query: 654 S 654
           S
Sbjct: 702 S 702

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  136 bits (343), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 158/687 (22%), Positives = 268/687 (39%), Gaps = 115/687 (16%)

Query: 43  LTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEHVEKQPE--SLGSILFGDR 100
           +TP  NF  K+D    I    E  L    Y +  L F  P  + K+P   SL  I+ GDR
Sbjct: 53  ITP--NFYKKNDFLELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDR 110

Query: 101 IYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDG-LPAARKLHDVK 159
            + S + ++  E+  C +LC         + ++KL++ G+   WLID  LPAA       
Sbjct: 111 KWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVVQWLIDDELPAATTFISTT 170

Query: 160 TKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDIN 219
               +Y +GFPLG V                 +P            + +  +L NH  + 
Sbjct: 171 DHKKYYASGFPLGFV-----------------DP------------DTDKTYLHNHVILV 201

Query: 220 VEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGG-----LILLETEDN--EVQFSYSVRF 272
           + +H  G+    VVG  V PKS +   C   S       +++ E E +   + F+YSV +
Sbjct: 202 IRFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYW 261

Query: 273 IPS-ETVWATRWDKYLHVYD------PTIQWFSLINFXXXXXXXXXXXXXXXMRALKSD- 324
               E  W  RW+ +L+  +          W SL N                +R +++D 
Sbjct: 262 REEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDK 321

Query: 325 --------FARYEEFNLDDTFQQDSGWKLGHGDVFRI---------PDKSML--LSILVG 365
                       E    +D+   D   K G   V+ +         PD   L  L +LV 
Sbjct: 322 KNTDSHKYLINTEGIEAEDSLDDD---KYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVS 378

Query: 366 SGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYV-----------SM 414
            G Q    +  S+  +       + R S+ +   + + L  F  S+V           ++
Sbjct: 379 FGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNI 438

Query: 415 GVYKFFNGPYWKANMILTPIL-------VPGLLFISIVGLNFFLLFSRSSGTIPPTALIF 467
            V    +   +K     +PI        +PG++ I    LN  +    S+  +P   ++F
Sbjct: 439 NVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVF 498

Query: 468 VIVLWFIISIPLSLAGSLIANK------------KCNWGEHPTKTNEIARQIPFQPWYLK 515
            I ++F++ IPLSL G ++AN             K     + +K  +   +  F P    
Sbjct: 499 FISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTRFNPL--- 555

Query: 516 TVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXX 575
                 + G+FP   I VE+ ++Y SLW  K  + F +                      
Sbjct: 556 VHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGS 615

Query: 576 XXNLE--------NWRWQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGYS 625
              +            W+WR F +G  G   Y+ ++S+  IF    + GF++I++ + YS
Sbjct: 616 YLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSILISICYS 674

Query: 626 LIISALCAVVTGAIGFISSMLFVKKIY 652
           L+ + LC +  GA+  +++  F+ +IY
Sbjct: 675 LLFNILCGLGLGALSCLTASWFINRIY 701

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  133 bits (334), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 170/723 (23%), Positives = 275/723 (38%), Gaps = 132/723 (18%)

Query: 11  SVYLALTSAFYLPG-VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYS 69
           SV  A+T  +   G V P  Y  GD + L+VN +                    E  L  
Sbjct: 36  SVLSAITLNYNSHGWVNPNLYKIGDHVELIVNKV--------------------ESDLTQ 75

Query: 70  FDYYFPKLHFCKPEHVEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPAD 127
             Y +  L F  P   EK+P   SL  I  GDR + S + +    +  C  LC      +
Sbjct: 76  LPYAYYDLPFICPPTKEKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKE 135

Query: 128 DAKFINKLIKNGFFQNWLID-GLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASS 186
                 +L++ G+   WLID  LPAA         + +Y  GFP+G V  R         
Sbjct: 136 GMIKAKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRTGK------ 189

Query: 187 KLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDI 246
                                   FL NH  + + YH   E  + +VG  V PKS +   
Sbjct: 190 -----------------------TFLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYH 226

Query: 247 CTKKSGG----LILLETEDNE---VQFSYSVRFIPS-ETVWATRWDKYLHVYDPT----- 293
           C   +       I++  +D+E   + F+YSV +    E  W  RW+ +L+  + +     
Sbjct: 227 CPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKAN 286

Query: 294 -IQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGH---GD 349
              W S +N                ++            N      QD+         G 
Sbjct: 287 QFHWMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKISGS 346

Query: 350 VF----------RIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399
           VF          +IP    L+  L   G Q    +  S+  +       + R ++ +   
Sbjct: 347 VFVNAKTWITVGKIPYWKALIC-LTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSL 405

Query: 400 ILY----ALFGFCGSYVSMGVYKFFNGPYWKANMILTPIL---------VPGLLFISIVG 446
           I +    A+ G+ GS + +  Y+   G Y +  +  T +          +PGLL +    
Sbjct: 406 ICFICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFS 463

Query: 447 LNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPT-------K 499
           LN  +L   S+  +P    +F++ ++F+  IPLSL G ++A   C    + T       +
Sbjct: 464 LNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLR 522

Query: 500 TNEIARQIP---------FQPWYLK------TVPATLIAGLFPFGSIAVELYFIYSSLWF 544
            N I+R+           +Q           T    L  G F F  I VEL ++Y S+W 
Sbjct: 523 RNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWL 582

Query: 545 NKI--FYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWR-----WQWRSFIVGGVGCA 597
            K   +Y +GF                          +N R     W W+SF++G   CA
Sbjct: 583 EKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCA 641

Query: 598 FYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSV 655
           +Y+ ++S+  IF    + GF++I + V YSL+ + +C    G++ +++S + V +IY   
Sbjct: 642 WYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY--- 698

Query: 656 KVD 658
           KVD
Sbjct: 699 KVD 701

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  124 bits (311), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 154/698 (22%), Positives = 263/698 (37%), Gaps = 140/698 (20%)

Query: 48  NFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHF-CKPEHVEKQPE-SLGSILFGDRIYNSP 105
           N   ++D    I    E  L  F Y + +L F C P +V+K    SL  I+ GDR + S 
Sbjct: 59  NVYEENDPVEIIVNKIESDLTQFPYAYYELPFTCPPTNVKKPLHLSLNEIIRGDRKWQSD 118

Query: 106 FSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDG-LPAARKLHDVKTKSDF 164
           + +   +++ C  LC      D  +  ++LIK G+   WLID  LPAA      K    +
Sbjct: 119 YLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQWLIDDELPAATTFISTKDHKKY 178

Query: 165 YGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHD 224
           Y +GFPLG                              M  +    +L NH  + + YH 
Sbjct: 179 YASGFPLG-----------------------------FMDKDTGKTYLNNHVMLVIRYHT 209

Query: 225 RGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLETEDNE-----VQFSYSVRFIPSETV- 278
                + +VG+ V PKS +   C   S      E    E     + F+YS+ +     V 
Sbjct: 210 VDINKFTIVGLEVYPKSVSDYHCPGASKNFDHYEVNTEETETTYIPFTYSIYWREEFNVD 269

Query: 279 WATRWDKYLHVYD------PTIQWFSLINFXXXXXXXXXXXXXXXMRALKSDFARYEEFN 332
           W  RW+ +++  +          W SL N                 +++ +D     E  
Sbjct: 270 WTNRWNFFINSGEISQEKSSQFHWISLANSVVIVTLMTLVVALILAKSVSTD-----ETV 324

Query: 333 LDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRG 392
              T Q  S W + H  +         L++    G Q    +  S+  +     S +   
Sbjct: 325 STSTSQVASQWVVQHSYLLN------HLNVFTAMGVQFLFTILGSLIISC----SMNKLH 374

Query: 393 SLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPIL-------VPGLLFISIV 445
           ++ +++  +  +    G+Y S      F G    AN   T  +       +PG     ++
Sbjct: 375 NIRNSVLTMALMCFISGAYTSS-----FVGALLSANHNTTIKISIACGSALPGFTLCVVL 429

Query: 446 GLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIA---NKKC----------- 491
            LN  +    S+  +P   ++ +I ++FI+ IPLS+ G + A    +KC           
Sbjct: 430 ILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINR 489

Query: 492 ------NWGEHPTKTNEIA-------RQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFI 538
                 ++ + P   N++         ++P      + V  T+I+G+ PF  I VEL F+
Sbjct: 490 FFLLNIHYDDQPVVENKVHLPRISGNSKLPLM--LRQPVLLTVISGIVPFIVIYVELLFV 547

Query: 539 YSSLWFNKI--FYMFGFXXXXXXXXXXXXXXXXX---------------------XXXXX 575
           Y SLW  K   +Y++GF                                           
Sbjct: 548 YKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMH 607

Query: 576 XXNLENWRWQWRSFIVG---------------GVGCAFYIFVHSIIF--TKFKLGGFTTI 618
              L+  R Q  +F+                 G   A+Y+  +S+ +  T  K+  F++I
Sbjct: 608 SPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQIGGSVAWYLEAYSLYYFLTVLKIRDFSSI 667

Query: 619 VLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVK 656
           +L+  YS + + LC    GA+G++S   FV +I+++ K
Sbjct: 668 LLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 161/687 (23%), Positives = 272/687 (39%), Gaps = 126/687 (18%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y KGD++ L+VN +                    E  L    Y +  L F  P  
Sbjct: 37  LTPNIYRKGDDVELIVNKI--------------------ESDLTKLPYGYYDLPFICPPT 76

Query: 85  VEKQP--ESLGSILFGDRIYNSPFSIKMLENQECTSLC-KVTIPADDAKFINKLIKNGFF 141
            +++P   SL  IL GDR + S +S+   ++ +C  LC + T P    K IN L+K  + 
Sbjct: 77  NQRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYI 135

Query: 142 QNWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNV 200
             W ID  LPA+           +Y  GF LG V                 +P       
Sbjct: 136 VQWSIDNDLPASTTFISTSENRKYYIPGFSLGFV-----------------DP------- 171

Query: 201 NNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC---TKKSGGLILL 257
                + E  +L NH  + + YH   + ++ +VG+ V PKS +   C   ++      L+
Sbjct: 172 -----DTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELV 226

Query: 258 ETEDNEVQ---FSYSVRFIPS-ETVWATRWDKYLHVYDPT------IQWFSLINFXXXXX 307
             +D EV    F+YSV +    +  W  R+  + +  + +       +W  L N      
Sbjct: 227 ANDDEEVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITDKFRWILLANSSGLAL 286

Query: 308 XXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIP----DKSMLLSIL 363
                     +R  K         N ++    +S  K G  DV        D+++  + L
Sbjct: 287 FISMIVSVIFLRISKK--------NKNENSAIES--KKGSMDVIARKWLRNDRTIHFNFL 336

Query: 364 VGSGTQLFLMVAVSIFFAAIGILSPSS--------RGSLPSAMFILYALFGFCGSYVSMG 415
           +     + +   V   F  +G L+ S         R S+ + + + + L GF  S+V   
Sbjct: 337 I-----VLVSFGVHFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTC 391

Query: 416 VYKFFNGPYWKANM----------ILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTAL 465
           +    N   +K ++          +    L+P ++ I  + LN  +    SS  +P   +
Sbjct: 392 LIMQKNKTMYKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTI 451

Query: 466 IFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYL-KTVPATL--- 521
           +F+I ++FI+ IPLSL G   A+  C        ++   +++      L +T+ +     
Sbjct: 452 LFLISIYFIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDP 511

Query: 522 -------IAGLFPFGSIAVELYFIYSSLWFNKI-------FYMFGFXXXXXXXXXXXXXX 567
                  I GLFPF  I VEL  +Y  +W  K        F                   
Sbjct: 512 FSGLLASIGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIIS 571

Query: 568 XXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGYS 625
                     +LEN  W+WRSF +    CA+Y+ ++S+  IF      GF++I+L V  S
Sbjct: 572 AYIMMHSSRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSS 629

Query: 626 LIISALCAVVTGAIGFISSMLFVKKIY 652
            + + LC    G+IG++++  FV ++Y
Sbjct: 630 ALFNGLCGCALGSIGYLATCWFVGRVY 656

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 128/571 (22%), Positives = 210/571 (36%), Gaps = 113/571 (19%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y +GD++ L VN +   +              N  +  Y   +  P     KP H
Sbjct: 44  IKPNVYKRGDKVDLTVNKVESEIT-------------NLPYGYYDLRFVCPPSETKKPLH 90

Query: 85  VEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNW 144
           +     SL  ++ GDR + S ++++    Q+C  LC      D  +  ++LI+  +  +W
Sbjct: 91  L-----SLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHW 145

Query: 145 LIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNM 203
           LIDG LPAA      ++   FY  GFPLG V                             
Sbjct: 146 LIDGDLPAATTFASTRSGKKFYTAGFPLGRVD---------------------------- 177

Query: 204 VHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC--TKKSGGLILLETED 261
            H  +   L NH  + + Y       Y +VG  V P+S +   C    KS    ++ TE+
Sbjct: 178 -HETDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEE 236

Query: 262 NEVQ---FSYSVRFIPSETV-WATRWDKYLH----VYDPTIQ---WFSLINFXXXXXXXX 310
            EV    F+YSV +     + W+ RW+ +      + +  +    W SL N         
Sbjct: 237 TEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVVALMT 296

Query: 311 XXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQ- 369
                  ++    DF     F            +     V+ +      L++    G Q 
Sbjct: 297 LFIALIFLKIRADDFVGTLAF------------EWASQPVYYLTQ----LNLAASMGIQF 340

Query: 370 LFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANM 429
           LF ++  S    ++  +       L +A     A+    G+Y S  V      P  K N+
Sbjct: 341 LFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTSSLVGSLL-APGPKMNL 394

Query: 430 ---ILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLI 486
              +L    +P L  + +   N  +    SS  +P   L+ ++  +F+I +PLS  G   
Sbjct: 395 GTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFS 454

Query: 487 ANKKCNWGEHPTKTNEIARQIPFQ--------------PWYLKTVPA--------TLIAG 524
           A K  +        N    ++PF                   K +PA        T++ G
Sbjct: 455 ARKLRS--APANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTG 512

Query: 525 LFPFGSIAVELYFIYSSLWFNK--IFYMFGF 553
             PF     EL F+Y SLW  K  ++ ++GF
Sbjct: 513 FPPFVVTCTELLFVYRSLWLQKTNLYSLYGF 543

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 584 WQWRSFIVGGVGCAFYIFVHSIIFTKF--KLGGFTTIVLYVGYSLIISALCAVVTGAIGF 641
           W+W++F+ G    A+Y  ++S+ +  F   L  F++I+L+V Y+ + + +C    GA+G+
Sbjct: 619 WRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGY 677

Query: 642 ISSMLFV 648
           ++ + F+
Sbjct: 678 LTCLWFL 684

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 112/273 (41%), Gaps = 58/273 (21%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y KGD++ +++N +                    E   + + YY   L F  P  
Sbjct: 40  IKPNVYKKGDKVDVIINKVV------------------SETARFPYGYY--DLQFVCPPS 79

Query: 85  VEKQPE--SLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
            +K+P   SL  I+ GDR + S +++   E  +C  LC      +  K  + LI+ G+  
Sbjct: 80  DKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVA 139

Query: 143 NWLI-DGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
           +WLI D LPAA      K+   FY  GFPLG V    AV G                   
Sbjct: 140 HWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEV---DAVTGKTR---------------- 180

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC--TKKSGGLILLET 259
                     L+NH  + V Y       + ++G  V PKS +   C    K      + T
Sbjct: 181 ----------LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPYEINT 230

Query: 260 EDNEVQ---FSYSVRFIPSETV-WATRWDKYLH 288
           E++E+    F+YS+ +     + W+ RW+ ++H
Sbjct: 231 EESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 67/142 (47%), Gaps = 26/142 (18%)

Query: 436 VPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGE 495
           +PGL+  +++ LN  +    SS  IP   ++  +  +F+IS PLSL G   A K  N   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AA 458

Query: 496 HPTKTNEIARQIPFQ-----PWYLKTVPA-----------------TLIAGLFPFGSIAV 533
                N I++  PF       +  ++ PA                 T++AG+ PF  I V
Sbjct: 459 KLAPANAISKS-PFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICV 517

Query: 534 ELYFIYSSLWFN--KIFYMFGF 553
           EL+++Y S+W      +Y++GF
Sbjct: 518 ELFYVYKSMWLQTTNFYYLYGF 539

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 584 WQWRSFIVGG-VGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFI 642
           W+W+SF+ GG V     ++    +     L   ++I+L+V Y+ + + +C    GA+G++
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 643 SSMLFVKKIYSSVK 656
           S + F+  I SS K
Sbjct: 675 SCLWFLSHISSSSK 688

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 139/680 (20%), Positives = 250/680 (36%), Gaps = 97/680 (14%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y  GD + LLVN    +LN   K            +  +   +  P     KP H
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLNADLK-----------PYIYHDLPFVCPPTSVRKPVH 95

Query: 85  VEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNW 144
           +E       S+  GD +  S + +K  ++ EC  LC      +       +IK  +   W
Sbjct: 96  LE-----FDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQILW 150

Query: 145 LIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNM 203
            ID  LP +       T+   Y  GFPLG                      R  K+ N +
Sbjct: 151 SIDDELPISMPYISTITQRKKYIPGFPLG----------------------RFDKDKNKV 188

Query: 204 VHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGG-----LILLE 258
                  +L+NH  + + Y+   +  + +VG  V  +S +   C   S       L++ E
Sbjct: 189 -------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYELVIPE 241

Query: 259 TEDNE--VQFSYSVRFIPS-ETVWATRW---DKYLHVYDPTIQWFSLI-NFXXXXXXXXX 311
            +D+   + F+YSV +    +  W +RW   D  +   DP +   S++ N          
Sbjct: 242 NDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKSMLSNIMQPTRTGLF 301

Query: 312 XXXXXXMRALKSDFARYEEFNLDDTFQQ--DSGWKLGHGDVFRIPDKSMLLSILVGSGTQ 369
                    +        E N   T  Q     W   +    +    + +L++++  G Q
Sbjct: 302 LLPLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESNNINLKSSFSASILTLVISMGVQ 361

Query: 370 -LFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYA----LFGFCGSYVSMGVYKFFNGPY 424
            +F ++ + I   +I  L   S   L + +FI +        F G+++ M +    +  Y
Sbjct: 362 SIFSLIGIIILKLSIYKLHDISNIVLLN-IFIWFIEGILASSFLGTWLRMNILNKKSINY 420

Query: 425 WKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGS 484
                IL   L+P LL I +  ++  +    SS   P   L  +I  ++II +P S+ G 
Sbjct: 421 NPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFSIIGG 480

Query: 485 LIANK----------------KCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPF 528
            +A K                + N  +   +     R        L T+  +LI  + PF
Sbjct: 481 GLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSLITAIVPF 540

Query: 529 GSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXN-------LEN 581
             I  ELY+I+++ W N   ++  F                        N       +  
Sbjct: 541 FIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLVGLFVNIMMTKKGISQ 600

Query: 582 WR-----WQWRSFIVGGVGCAFYIFVHSI--IFTKFKLGGFTTIVLYVGYSLIISALCAV 634
           WR      +W  F+       +   ++S+  I    ++ GF+  VL + Y++ ++ +  +
Sbjct: 601 WRDDPISLRWSCFL-NSFNICYLTGLYSLYYIIEVIRIHGFSMTVLTIFYTIALNVILGI 659

Query: 635 VTGAIGFISSMLFVKKIYSS 654
             GAI +++    + K+Y +
Sbjct: 660 SCGAIAYMTCYWLIIKLYKN 679

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 110/507 (21%), Positives = 184/507 (36%), Gaps = 98/507 (19%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEH 84
           + P  Y  GD++ +  N   P            D     +  L  +D     L F  P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP------------DDPAVSQPALCYYD-----LPFVCPPS 102

Query: 85  VEKQP--ESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
             K+P   SL  +  GD +  S + ++  +++ C  LC         +    LIKN +  
Sbjct: 103 DTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 143 NWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
            W +D  LP        K     Y  GF LG                  +N   +A    
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGY----------------FDNQTGQA---- 202

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLET-- 259
                    +L  H    V YH      + +VG+ V P+S     C   S   I LE   
Sbjct: 203 ---------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLEVKV 253

Query: 260 -EDNE----VQFSYSVRFIPS-ETVWATRWDKY------LHVYDPTIQWFSLINFXXXX- 306
            E+N+    + FSYSV +    +  W  RWD +      L   D +  W+SLIN      
Sbjct: 254 PENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLINSNSITV 313

Query: 307 ---XXXXXXXXXXXMRALKSDFARYEEFNLDD----------TFQQDSGWKLGHGDVFRI 353
                         MR L +   +  + ++            T    SG +      F +
Sbjct: 314 GVITFLCLVISMNRMRILYNKSWKKRQLSITTTTTTRYPNIFTICITSGIQF-----FFL 368

Query: 354 PDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVS 413
              S+L++  +    Q+   + V++FF A GI+     G+L    FIL            
Sbjct: 369 LISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTLIQRTFILTN---------- 418

Query: 414 MGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWF 473
                 F   Y+  N IL    +P  + +S+  +N  +  S  +   P    ++    +F
Sbjct: 419 ------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYF 472

Query: 474 IISIPLSLAGSLIANKKCNWGEHPTKT 500
           I+SIPLS+   +++ +  ++ ++P+++
Sbjct: 473 ILSIPLSIISGVLSTRFISFPKYPSRS 499

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 151/707 (21%), Positives = 252/707 (35%), Gaps = 158/707 (22%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHF-CKPE 83
           V P  Y  G+E+ +L+N +                 G       S+ YY   L F C P 
Sbjct: 40  VRPRIYQDGEEVEMLLNQVV----------------GKPGEL--SYGYY--DLQFTCTPT 79

Query: 84  HVEKQ-PESLGSILFGDRIYNSPFSIKMLENQECTSLC-KVTIPADDAKFINKLIKNGFF 141
              +    SL  +  GDR + S + +      +C++LC + T P+   +  + LI+  + 
Sbjct: 80  KSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYT 138

Query: 142 QNWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNV 200
              LID  +PA++    ++    +Y  GFPLG V                 +P       
Sbjct: 139 VQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFV-----------------DP------- 174

Query: 201 NNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC--TKKSGGLILLE 258
                  ++ +L NH+ + + Y+      Y +VG  V PKS + D C  + K      + 
Sbjct: 175 -----ETDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYAVN 229

Query: 259 TEDNEVQF---SYSVRFIPSETV-WATRWDKYLHVYDPTIQWFSLINFXXXXXXXXXXXX 314
             + +V F   +YSV +     V W  RW+ YL   D  +                    
Sbjct: 230 PSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN------------------K 271

Query: 315 XXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMV 374
               R +K     +    L       S   LG G +F     S    +  G+   LFL  
Sbjct: 272 SLCFRGIKVTMV-FIILTLMSLAIIVSRLGLGTGSMFITAVASEW--VRRGAPCLLFLNT 328

Query: 375 AVS-----IFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANM 429
            VS     IF A   +L   S G L +    L  +   C  Y++      F G     N+
Sbjct: 329 FVSMGIQVIFAAPATLLLICSMGKLHNISNFLVCIAALC--YMTGIFMSAFGGILLSGNL 386

Query: 430 -----------ILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIP 478
                      +L    +P L    +V  N           +P   +  ++ L+F++S+P
Sbjct: 387 LDNKAQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLP 446

Query: 479 LSLAGSLIANKKCN-------------------------W--GEHPTKTNEIA--RQIPF 509
           LSL G   A+ K                           W   E+ T+        QIP 
Sbjct: 447 LSLLGGTSASYKLKDQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM 506

Query: 510 QPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFN-----------------------K 546
             W  K    T I G+ PF +I +++ FI+  LW +                       +
Sbjct: 507 --WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVME 564

Query: 547 IFYMFGFXXXXXXXXXXXXXXXXXXXXXXXXNLENWRWQWRSFIVGGVGCAFYIFVHSII 606
           I  +  +                         + +WR  W++F +GG   A+Y   +S+ 
Sbjct: 565 ICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWR--WKAFYMGGAA-AWYWEAYSLY 621

Query: 607 FTKF--KLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKI 651
           +  F  +L  F +I+LY+ Y  +++       G+IG+++   F+ K+
Sbjct: 622 YMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 114/492 (23%), Positives = 195/492 (39%), Gaps = 71/492 (14%)

Query: 25  VAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYY-FPKLHFCKPE 83
           V P TY  GD + ++VN +      Q KD  G+  +G       S+ Y+  P  + C P 
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYHDLP--YICPPT 92

Query: 84  HVEKQ-PESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQ 142
           + +K    SL  +  GD    S + +K   + +C +LC         +   ++I   +  
Sbjct: 93  NTKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIV 152

Query: 143 NWLIDG-LPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVN 201
           NW ID  LPAA       T+   Y  GF LG                  ++P   +  +N
Sbjct: 153 NWFIDDYLPAATTYISSVTRKKKYFEGFSLG-----------------WKDPETGSYYIN 195

Query: 202 NMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDIC---TKKSGGLILLE 258
                       NH  + + Y+   +  + +VG  V PKS     C    +  G   L +
Sbjct: 196 ------------NHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKD 243

Query: 259 TEDNE----VQFSYSVRFIPS-ETVWATRWDKY-------LHVYDPTIQWFSLIN----F 302
            E+N+    + FSYSV +    E  W TRW  +       L   D ++Q   + N    +
Sbjct: 244 LENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLLHWY 303

Query: 303 XXXXXXXXXXXXXXXMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSI 362
                          +  L  D   ++   + +  +    W      + +     +L +I
Sbjct: 304 SPYTTVIIFTILLFLVSLLVLDINSHKLVFMSNP-KTVIAWATTANKLNKTWKNILL-NI 361

Query: 363 LVGSGTQ-LFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYA--LFG-FCGSYVSMGVYK 418
           LV  G Q LF+ + V +  +++  L   S   +   +  + A  L G F G+++ M +++
Sbjct: 362 LVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMYMFQ 421

Query: 419 FFNGPYWKANM-ILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISI 477
               P +   M I+   ++PGL    +   N    F   + + P   L ++I ++FI SI
Sbjct: 422 KKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFSI 481

Query: 478 PLSLAGSLIANK 489
           P+SL G  +A K
Sbjct: 482 PMSLIGGSLAVK 493

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 103/270 (38%), Gaps = 64/270 (23%)

Query: 27  PTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEHVE 86
           P+ Y +G+ + LLV+++     +  ++  G                Y+  L  C P    
Sbjct: 39  PSAYTRGERVQLLVDNI-----WTDREVWG----------------YYETLFTCPPPAEA 77

Query: 87  KQP-ESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWL 145
           +    SLG +   +  + S + + +    +C  LC   +  D  + + ++I++G    W 
Sbjct: 78  RAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWT 137

Query: 146 IDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREAKNVNNMVH 205
           +DGLPAA    D +  S  Y  GF LG V                     E  +V     
Sbjct: 138 LDGLPAATTYPD-RQSSYRYEAGFKLGEVDA-------------------ETGHVR---- 173

Query: 206 NVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLE----TED 261
                 L NH  + V Y    +G Y +VG    P+S  G+ CT   GG    E      D
Sbjct: 174 ------LHNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCT---GGQTEYEHFWLNPD 224

Query: 262 NE----VQFSYSVRF-IPSETVWATRWDKY 286
            +    V F+Y+V +   S   W  RW  Y
Sbjct: 225 AQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

>ZYRO0C13200g Chr3 (1047580..1047888) [309 bp, 102 aa] {ON} similar
           to uniprot|P38208 Saccharomyces cerevisiae YBL018C POP8
           Subunit of both RNase MRP which cleaves pre- rRNA and
           nuclear RNase P which cleaves tRNA precursors to
           generate mature 5' ends
          Length = 102

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 57  NDIKGNKEHFLYSFDYYF----PKLHFCKPEHVEKQ--PESLGSILFGDRIYNSPFSIKM 110
           N +K     F    +Y+F     K+ + K  H++K     ++ + +  D +   P ++ +
Sbjct: 9   NALKRTHGIFGEGIEYFFLNQDDKIAYLKVSHLDKDTFSSAVSTYISSDSLVGVPMTVTI 68

Query: 111 LENQECTSLCKVTIPADDAKFINKLIK 137
           L  QE +SL ++ I  DD  ++NK I+
Sbjct: 69  L--QEVSSLTELQINDDDKLWLNKAIE 93

>NCAS0B08960 Chr2 (1722216..1724465) [2250 bp, 749 aa] {ON} Anc_1.29
           YCL045C
          Length = 749

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 12/109 (11%)

Query: 87  KQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLI 146
           K PE+   ILF   +  +  +IK LE  +  SL K+ I  DDA+FI +  KNG     LI
Sbjct: 147 KDPET-SLILFNATLPLNYKAIKFLET-DYASLLKILIETDDARFIFQSYKNG----ELI 200

Query: 147 DGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAR 195
           D       L+D+   +DF  T   + +  +      LA+   N+ NP +
Sbjct: 201 DEWEKDESLNDI---ADF--TFIEVTDKSIDTIADDLAAES-NISNPLK 243

>Smik_10.50 Chr10 (83672..85462) [1791 bp, 596 aa] {ON} YJL181W
           (REAL)
          Length = 596

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 226 GEGNYRVVGVTVD---PKSSTGD--ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWA 280
            EG+Y+++ +      P   TGD  +C+    G +L  TE N+V+          ET W 
Sbjct: 234 SEGDYQILELGRSLMFPLLRTGDFKVCSIDDAGAVLTFTEANDVRLEICSL---DETSWV 290

Query: 281 TRWDKYLHVYD 291
           T+W   L  +D
Sbjct: 291 TQWKSCLQNHD 301

>KNAG0M00710 Chr13 complement(118300..119919) [1620 bp, 539 aa] {ON}
           
          Length = 539

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query: 376 VSIFFAAIG-ILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPI 434
           +++F  + G IL   +   +  A FI   +   C   V    +      YWK+N   T I
Sbjct: 152 LALFIGSWGLILCCHAAPRINYAAFIALRVLLGCAEGVVTPCFTIITAQYWKSNEQFTRI 211

Query: 435 L----VPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIV 470
                + GL  I +  + + L+  + S +IP   L+FVI+
Sbjct: 212 CFWFGMNGLGVIMLNSMAYGLVLHKDSYSIPAWKLLFVII 251

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 198 KNVNNMVHNVEIP-FLFNHYDINVEYHDR---GEGNYRVVGVTVDPKSSTGDICTKKSGG 253
           K+ NN ++NV +P  L + +  + E   +   G GN  +    ++P+S T DIC    GG
Sbjct: 584 KHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGG 643

Query: 254 LI 255
           +I
Sbjct: 644 II 645

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,127,167
Number of extensions: 3053809
Number of successful extensions: 8884
Number of sequences better than 10.0: 59
Number of HSP's gapped: 8868
Number of HSP's successfully gapped: 88
Length of query: 658
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 542
Effective length of database: 40,180,143
Effective search space: 21777637506
Effective search space used: 21777637506
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)