Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_543.105.477ON87687642750.0
TPHA0J027905.477ON88282224080.0
ZYRO0D11308g5.477ON86877622730.0
TDEL0A034105.477ON83776422610.0
Suva_8.1925.477ON87975621090.0
Skud_15.3045.477ON88375621040.0
Smik_15.3205.477ON87377820970.0
YOR141C (ARP8)5.477ON88175820890.0
TBLA0A025305.477ON85475519350.0
KAFR0E025305.477ON84277519330.0
NCAS0H022905.477ON86376719300.0
CAGL0I07161g5.477ON83774618780.0
Kwal_55.212505.477ON77574518640.0
SAKL0G03608g5.477ON79474218650.0
KLTH0F14960g5.477ON77574518090.0
Ecym_23115.477ON77578817910.0
KNAG0B040205.477ON93480717760.0
AFR135W5.477ON79177017530.0
NDAI0C013705.477ON97468316060.0
KLLA0E03213g5.477ON78879815160.0
Kpol_479.253.161ON3911971111e-04
TBLA0F008703.161ON3911761101e-04
ZYRO0B04928g3.161ON3911751092e-04
Kpol_520.117.448ON4881531092e-04
YDL029W (ARP2)3.161ON3911971047e-04
Smik_4.2063.161ON3911971047e-04
TDEL0C031207.448ON438691048e-04
Suva_4.2203.161ON3911971030.001
Skud_4.2223.161ON3911971030.001
NCAS0C035503.161ON3921971030.001
KAFR0C01040na 1ON3371971020.001
KLTH0F06490g3.161ON3911751020.001
Kwal_33.141773.161ON3371751010.002
TPHA0A009203.161ON3911211010.002
SAKL0C07370g3.161ON3911211010.002
KNAG0K01130na 1ON3931751010.002
CAGL0K05335g7.448ON5291091010.002
NDAI0G029003.161ON3911761010.002
ADR316W3.161ON3911941000.002
TDEL0B068602.593ON4611031000.002
CAGL0K01595g3.161ON3911761000.003
Ecym_52373.161ON391176990.003
TDEL0D046103.161ON391176980.004
KLLA0C03850g3.161ON391197970.005
Ecym_23062.593ON407100950.009
KNAG0H036502.117ON38778950.009
Kpol_181.22.593ON46399940.012
ACR184C7.448ON40186910.032
NCAS0B071302.117ON38166900.034
KAFR0F005902.117ON386112900.042
Suva_15.3262.117ON38472900.042
Skud_8.1902.117ON38471890.043
Ecym_63301.287ON480316890.052
Suva_16.3647.448ON48099890.061
CAGL0H09042g2.117ON387239880.066
NCAS0A147207.448ON48569880.071
Smik_8.2102.117ON38471870.090
YPR034W (ARP7)7.448ON47777870.091
TPHA0I013002.117ON37991860.12
YHR129C (ARP1)2.117ON38471860.12
TPHA0N014302.593ON472143860.14
SAKL0F13772g7.448ON42282850.15
Smik_16.2787.448ON47669850.15
TBLA0B010702.117ON38382850.15
ZYRO0F01122g2.593ON46291850.17
NDAI0A013007.448ON56584850.17
KLTH0C05324g7.448ON39982840.21
TBLA0H028002.593ON48498840.22
Suva_13.2022.593ON46792840.22
NDAI0B044602.117ON38178820.31
Skud_16.3217.448ON47999830.33
CAGL0M03201g1.287ON493317830.33
AGR099C8.251ON30575810.35
KAFR0K021507.448ON49079810.49
TDEL0B048102.117ON37376810.51
Kwal_27.105527.448ON35182800.61
KLLA0F03036g5.8ON31158790.66
TBLA0F004507.448ON48274790.77
AFR051W2.117ON40578790.87
ABR084W2.593ON46478790.89
Skud_12.3516.63ON35077780.97
NCAS0E041705.8ON31460781.00
Skud_13.1892.593ON46798781.1
KLLA0E22925g2.117ON380105781.2
ZYRO0G05676g2.117ON38173781.2
SAKL0E11814g2.117ON37978781.2
Ecym_63852.117ON37778771.2
Suva_7.5795.8ON31358771.2
NDAI0G030408.23ON37550771.3
ZYRO0F02772g8.23ON37550771.3
Skud_6.318.23ON36050771.3
KNAG0L002508.23ON37550771.3
KAFR0D009408.23ON37550771.3
Kpol_1058.158.23ON37550771.3
TBLA0C004408.23ON37550771.3
ABR222W8.23ON37650771.3
TDEL0C004708.23ON37550771.3
TPHA0D002508.23ON37550771.3
NCAS0C037008.23ON37550771.3
CAGL0K12694g8.23ON37550771.3
Suva_6.188.23ON37550771.3
Smik_6.398.23ON37550771.3
YFL039C (ACT1)8.23ON37550771.3
SAKL0B00968g8.23ON37550771.4
Ecym_15208.23ON37650771.4
TBLA0C071205.8ON31286771.4
KNAG0B021107.448ON48598771.5
KLTH0B05940g2.117ON38376752.4
YMR033W (ARP9)2.593ON46798752.5
Smik_13.2032.593ON46798752.8
YLR270W (DCS1)6.63ON35077742.9
Suva_10.3676.63ON35077743.0
Smik_12.3456.63ON35077743.0
ZYRO0G17182g7.448ON46569743.1
KAFR0L010807.266ON62683753.1
Ecym_35058.251ON30558733.6
KLTH0H10736g1.317ON81088743.6
Kpol_1060.65.8ON31499725.4
NCAS0H030602.593ON47232725.7
KAFR0B031308.704ON84470719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_543.10
         (876 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...  1651   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   932   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   880   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   875   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   816   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   815   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   812   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   809   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   749   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   749   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   748   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   728   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   722   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   723   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   701   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   694   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   688   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   679   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   623   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   588   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    47   1e-04
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    47   1e-04
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    47   2e-04
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    47   2e-04
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    45   7e-04
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    45   7e-04
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    45   8e-04
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    44   0.001
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    44   0.001
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    44   0.001
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    44   0.001
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    44   0.001
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    44   0.002
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    44   0.002
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    44   0.002
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    44   0.002
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    44   0.002
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    44   0.002
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    43   0.002
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    43   0.002
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    43   0.003
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    43   0.003
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    42   0.004
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    42   0.005
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    41   0.009
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    41   0.009
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    41   0.012
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    40   0.032
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    39   0.034
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    39   0.042
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    39   0.042
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    39   0.043
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    39   0.052
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    39   0.061
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    39   0.066
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    39   0.071
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    38   0.090
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    38   0.091
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    38   0.12 
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    38   0.12 
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    38   0.14 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    37   0.15 
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    37   0.15 
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    37   0.15 
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    37   0.17 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    37   0.17 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    37   0.21 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    37   0.22 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    37   0.22 
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    36   0.31 
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    37   0.33 
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    37   0.33 
AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON} Sy...    36   0.35 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    36   0.49 
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    36   0.51 
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    35   0.61 
KLLA0F03036g Chr6 complement(283504..284439) [936 bp, 311 aa] {O...    35   0.66 
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    35   0.77 
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    35   0.87 
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    35   0.89 
Skud_12.351 Chr12 (622291..623343) [1053 bp, 350 aa] {ON} YLR270...    35   0.97 
NCAS0E04170 Chr5 complement(823119..824063) [945 bp, 314 aa] {ON...    35   1.00 
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    35   1.1  
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    35   1.2  
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    35   1.2  
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    35   1.2  
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    34   1.2  
Suva_7.579 Chr7 complement(1012777..1013718) [942 bp, 313 aa] {O...    34   1.2  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    34   1.3  
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    34   1.3  
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    34   1.3  
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    34   1.3  
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    34   1.3  
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    34   1.3  
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    34   1.3  
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    34   1.3  
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    34   1.3  
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    34   1.3  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    34   1.3  
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    34   1.3  
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    34   1.3  
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    34   1.3  
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    34   1.3  
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    34   1.4  
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    34   1.4  
TBLA0C07120 Chr3 complement(1730198..1731136) [939 bp, 312 aa] {...    34   1.4  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    34   1.5  
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    33   2.4  
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    33   2.5  
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    33   2.8  
YLR270W Chr12 (681186..682238) [1053 bp, 350 aa] {ON}  DCS1Non-e...    33   2.9  
Suva_10.367 Chr10 (642604..643656) [1053 bp, 350 aa] {ON} YLR270...    33   3.0  
Smik_12.345 Chr12 (619425..620477) [1053 bp, 350 aa] {ON} YLR270...    33   3.0  
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    33   3.1  
KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {...    33   3.1  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    33   3.6  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...    33   3.6  
Kpol_1060.6 s1060 (11822..12766) [945 bp, 314 aa] {ON} (11822..1...    32   5.4  
NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.5...    32   5.7  
KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {O...    32   9.6  

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 1651 bits (4275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/876 (92%), Positives = 808/876 (92%)

Query: 1   MASDDETANGSAVGNSSVVFEEQVADVASGEGNSSEVSGDKQNSNNKXXXXXXXXXXXXX 60
           MASDDETANGSAVGNSSVVFEEQVADVASGEGNSSEVSGDKQNSNNK             
Sbjct: 1   MASDDETANGSAVGNSSVVFEEQVADVASGEGNSSEVSGDKQNSNNKVDEVDEIEEDEIE 60

Query: 61  XXXXXXXXXXXXPSEMSSIMGTPIGDHGSVGNGKHSEFSPKKRKLDNKIIESTDSKKQDK 120
                       PSEMSSIMGTPIGDHGSVGNGKHSEFSPKKRKLDNKIIESTDSKKQDK
Sbjct: 61  GEDDEDEEEQDQPSEMSSIMGTPIGDHGSVGNGKHSEFSPKKRKLDNKIIESTDSKKQDK 120

Query: 121 AESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSH 180
           AESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGR             TGIERVDNSH
Sbjct: 121 AESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSH 180

Query: 181 LQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALN 240
           LQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALN
Sbjct: 181 LQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALN 240

Query: 241 NGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNS 300
           NGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNS
Sbjct: 241 NGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNS 300

Query: 301 LYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPE 360
           LYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPE
Sbjct: 301 LYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPE 360

Query: 361 IVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXX 420
           IVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLN             
Sbjct: 361 IVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELL 420

Query: 421 XXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIM 480
             VTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIM
Sbjct: 421 SDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIM 480

Query: 481 QESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLL 540
           QESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLL
Sbjct: 481 QESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLL 540

Query: 541 ENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFD 600
           ENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFD
Sbjct: 541 ENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFD 600

Query: 601 EVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDL 660
           EVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDL
Sbjct: 601 EVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDL 660

Query: 661 YAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSK 720
           YAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSK
Sbjct: 661 YAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSK 720

Query: 721 MNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSK 780
           MNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSK
Sbjct: 721 MNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSK 780

Query: 781 ASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKG 840
           ASTTP               TELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKG
Sbjct: 781 ASTTPEEEEKIKQSIKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKG 840

Query: 841 ASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           ASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY
Sbjct: 841 ASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/822 (57%), Positives = 596/822 (72%), Gaps = 32/822 (3%)

Query: 74  SEMSSIMGTPIGDHGSVGNGKHSEFSPKKRKLDNKIIESTDSKKQDKAESPEKGNNTDSG 133
           SE+SS++GTP GD G   +  H +   KKRKLD    ES+  K  +K  S E  N +D  
Sbjct: 74  SELSSVVGTPTGDFGK-SDAFHDD---KKRKLD----ESSPDKNAEKPNS-EMTNRSDIS 124

Query: 134 NAT--PSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQML 191
           N +  P +T   K+   +LE+RRLGR             TGIE+ +N ++Q TGLF  + 
Sbjct: 125 NGSNKPVST---KMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIP 181

Query: 192 LVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTT-------------ANTPDVVDLKA 238
           LVNQKNCSSDYLK + Q+FALRERK LRNNT +                ANTP+V DLK 
Sbjct: 182 LVNQKNCSSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKN 241

Query: 239 LNNGSSASLVDE-VLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIP 297
           +N+ S+ SL+DE +L  N D+I F+DPTTTIVIHPGSRYLKIGFAKD++PLV+P+CVA P
Sbjct: 242 VNSESNVSLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFP 301

Query: 298 KNSLYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQA 357
           KNSLYSENV E  + K E+S+     K Q+QQSFR+RMRYYKRKIQ NSHERVR+FN Q+
Sbjct: 302 KNSLYSENVEETIVSK-EESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQS 360

Query: 358 KPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXX 417
           KPE VEDK ++ R+EWI N DKIY+GEEA RC+K+ FIIRYPF KGGS N          
Sbjct: 361 KPEKVEDKTEYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLP 420

Query: 418 XXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAV 477
                ++ LFEYAL++   ++  ++  + K+ILVIPD+FEKSH+ET++R+LLKEM+FQAV
Sbjct: 421 EIIGDISNLFEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAV 480

Query: 478 AIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTL 537
           AIMQESLAA YGAGI  A+CIVNIGATQT +AC+DEGTV E+SLI LDYGGDDIT+LF  
Sbjct: 481 AIMQESLAASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLH 540

Query: 538 FLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFK 597
            LL+N FP+QDLD++S+HGW   E LKK + TFEDAN+TVQLYNF+K  PG  +EK EFK
Sbjct: 541 LLLQNEFPYQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFK 600

Query: 598 VFDEVILAPLALFYPDIFQELKKLDSKNKFN--LEDQLPVSRDLYTDSINDWRSVSQLQC 655
           VFDEVI APL LFYP+IF+ + + + K + N  L+DQLP S DLYT+  +DWRS+SQ+QC
Sbjct: 601 VFDEVINAPLGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQC 660

Query: 656 LDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVS 715
           LD D Y+GN N+LD+ITK+LN N + ++ + +   + +  +NY  L+KAIIQSITNA V+
Sbjct: 661 LDNDTYSGNDNDLDVITKLLNANLNLDDMDLINNDQNENEKNYTSLDKAIIQSITNAVVT 720

Query: 716 MDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEI 775
           MD SKM QFY NIMVVGG+S+IP LDF+LTDRINIWRP+ L +  FP FF+N+ KQVK+ 
Sbjct: 721 MDTSKMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDF 780

Query: 776 QSTSKASTTPXXXXXXXXX-XXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPE 834
            + +K++  P                TEL+KY +++ESQ   +H  PV+VLPPP DM+P 
Sbjct: 781 NTANKSNNRPEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDPS 840

Query: 835 VLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           VLNWKGASVL Q+KLIEEL+VTN DWDMLGSRILQYKCLF Y
Sbjct: 841 VLNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/776 (55%), Positives = 556/776 (71%), Gaps = 25/776 (3%)

Query: 114 DSKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGI 173
           ++KK+D     +K    D   A P     KKVP HLLEKRRLGR              GI
Sbjct: 105 NNKKRDSQGKFKKYPKLDPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFARKLKKIGI 160

Query: 174 ERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDV 233
           E+V+ + L  TGLF  M+L+NQKN SSDYLKKD+QVFALR+RK LRNNT V + ANTPDV
Sbjct: 161 EKVETNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDV 220

Query: 234 VDLKALNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSC 293
            DLK   NG++  L +      D+DID +D  TT+VIHPGS  LK+GFAKDE+P V+PSC
Sbjct: 221 ADLKR-ENGNTTELNEAA---GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSC 276

Query: 294 VAIPKNSLYSE------NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSH 347
           VAIPK+ L+++      N    + D+  + E +   KA++Q SFRERMR+YKRK+QPN+H
Sbjct: 277 VAIPKSELHNQIPMDQKNQTCYTRDQPTEFEEI---KAEMQHSFRERMRFYKRKVQPNAH 333

Query: 348 ERVRTFNEQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLN 407
           E+V  FN+ +KPE++EDKND+ RI WI   D+ Y+G +A RC+K++F+IRYP  KGGS N
Sbjct: 334 EQVINFNKVSKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFN 393

Query: 408 XXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRI 467
                           T L E+ L      + ++Q  Q KV+LVIPDLFEKSH+ETL R 
Sbjct: 394 IASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRC 453

Query: 468 LLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYG 527
           L+ EMQFQAVAIMQESLA CYGAGIST++C+VNIGATQT IACVDEGTVL++S I LDYG
Sbjct: 454 LITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYG 513

Query: 528 GDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIP 587
            DDIT+LF LFLL++ FP+QD D+++ HGW LAE+LKKNY TF+DAN+TVQLYNF+KRIP
Sbjct: 514 SDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIP 573

Query: 588 GKVSEKYEFKVFDEVILAPLALFYPDIFQELK---KLDSKNKFNLEDQLPVSRDLYTDSI 644
           G+ +EK++FKVFDEVILAPL+LFYP I  +L+   K  S+N+  LE +LP+SRD++TD++
Sbjct: 574 GQQAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNE-KLESELPISRDIFTDNL 632

Query: 645 NDWRSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKA 704
           +DWRS+SQ +CLD  LY GN +E  ++ K+L+  S  +E +     E D R+NY PLEKA
Sbjct: 633 DDWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKA 692

Query: 705 IIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHF 764
           I+QSITNAC+S DVSKM+ FY+NI+V GG SN+P  DF+LTDRINIWRP+ L +T+FP  
Sbjct: 693 IVQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDL 752

Query: 765 FKNISKQVKEIQSTSK----ASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSY 820
           +K +SKQ+K+I+++ K     S  P                EL +Y   IESQ N DH+ 
Sbjct: 753 YKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTL 812

Query: 821 PVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           PV+VLPPPRD++P +L WKGASVLAQIKL+EEL++T  DWD+ GSRILQYKC+FTY
Sbjct: 813 PVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/764 (55%), Positives = 547/764 (71%), Gaps = 17/764 (2%)

Query: 115 SKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIE 174
           +K Q++A+   K    D   A P     KKVP HLLEKRRLGR              GIE
Sbjct: 89  AKSQERAK---KHPRLDPAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIE 141

Query: 175 RVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVV 234
           +++++ L  TGLF  +LL+NQKN SSDYLKKD+Q+FALRERKTLRNNT  S+  NTPDV+
Sbjct: 142 KIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVI 201

Query: 235 DLKALNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCV 294
           D+K  N       V + +   D+DID +D  TT+VIHPGSR+L+IGFAKDE PLVVPSCV
Sbjct: 202 DIKNTNTE-----VPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCV 256

Query: 295 AIPKNSLYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFN 354
           AIPK  L  E  +E  + K E  E    +K+ +Q SFRERMRYYKRK+  N+HE+V ++N
Sbjct: 257 AIPKTELNDE-FQEAPL-KREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYN 314

Query: 355 EQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXX 414
           + +KP+++ED+ND G I WI  S K Y+G EA +C+KE F IR PF KGGS N       
Sbjct: 315 KNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYA 374

Query: 415 XXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQF 474
                   V  L E+AL+    ++ +AQ  Q KV+LVIPDLF KSH+ET  R LL EMQF
Sbjct: 375 SLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQF 434

Query: 475 QAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRL 534
           QAVAI+QESLA CYGAG S+++C+VNIGAT T+IAC+DEGTVLENSL+ LDYGGDD+T+L
Sbjct: 435 QAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKL 494

Query: 535 FTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKY 594
           F LFLL++ FP+QD D++S+HGW LAE+LKK Y TF+DAN+ VQLYNF+KR+P + SE+Y
Sbjct: 495 FALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQY 554

Query: 595 EFKVFDEVILAPLALFYPDIFQELKKLDSKNK--FNLEDQLPVSRDLYTDSINDWRSVSQ 652
           EFKVFDEV LAPLALFYP+I   L    S++    N+E QLP SRD++T+++NDWRS+SQ
Sbjct: 555 EFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQ 614

Query: 653 LQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNA 712
            +CLDGDLY+GN N   I++K+L++ +S ++++     E D R+NY PLEKAIIQSITNA
Sbjct: 615 SECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNA 674

Query: 713 CVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQV 772
              +DV+KM+ FY+NI+VVGG S IP LDF+LTDRINIWRP+ L  T+FP+F+K ++KQ 
Sbjct: 675 STPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQA 734

Query: 773 KEIQSTSKASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMN 832
           K+I++  K   +                 EL+ Y +SIE+Q   +H  PV VLPPPRDM+
Sbjct: 735 KDIKTAGKTGES-EEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMD 793

Query: 833 PEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
              L WKGA VLAQIKL+EEL++T+TDWD+ GSRILQYKCLFTY
Sbjct: 794 AAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/756 (53%), Positives = 531/756 (70%), Gaps = 25/756 (3%)

Query: 131 DSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQM 190
           D   A P     KKVP HLLEKRRLGR              GIE+V+ + L  TGLF  +
Sbjct: 139 DPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPL 194

Query: 191 LLVNQKNCSSDYLKKDDQVFALRERKTLRNN-TTVSTTANTPDVVDLKALNNG--SSASL 247
           LL+NQKN SSDYLKKDDQ+FALR+RK LRNN TT  ++ NTPDVVD+K+L N   S+A L
Sbjct: 195 LLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDMKSLPNSEPSTAPL 254

Query: 248 VDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLY---SE 304
                   +D+ID NDPT TIVIHPGS  +KIGF KDE P+VVP+CVA+PK  L     +
Sbjct: 255 --------NDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPKKWLNLANDQ 306

Query: 305 NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVED 364
           N   +S+ + + SE    +K++++++FRERMRYYKRK+  N+HE+V +FNE +KPE+V  
Sbjct: 307 NEGNISLQR-KQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNESSKPEVVSV 365

Query: 365 KNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVT 424
           KND   IEWI +  K+Y+G +A RC  E F+IR PF KGG  N               V 
Sbjct: 366 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-KGGCFNIDSPYYKSLAELISDVI 424

Query: 425 RLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESL 484
           +L EYAL     ++   +  Q KV+LVIPD+F+KSH+ET  R+LL E+QFQAVAI+QESL
Sbjct: 425 KLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQAVAIIQESL 484

Query: 485 AACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNF 544
           A CYGAGIST++C+VNIGAT+T IACVDEGTVLENS + LDYGGDDITRLF L LL+++F
Sbjct: 485 ATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLFALLLLQSDF 544

Query: 545 PFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVIL 604
           P QD  ++S HGW LAEQLKKN+ TF+DA++ VQLYNF+ R P K +EKYEFK+FDEV+L
Sbjct: 545 PLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPTEKYEFKLFDEVML 604

Query: 605 APLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGN 664
           APLALF+P IF+ ++    KN  +LE QLP SRDL+T+ +NDW S+SQ +  +GDLY   
Sbjct: 605 APLALFFPQIFKLIRAPSGKNS-SLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYCNL 663

Query: 665 TNELDIITKVLNINSSTEEYEG-LETTEVDGRENYVPLEKAIIQSITNACVSMDVSKMNQ 723
            ++L I+ K L+ ++  ++ +   E      +EN  PLEKAIIQSITNA V+ DV++M+ 
Sbjct: 664 NDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAIIQSITNASVTADVTRMSS 723

Query: 724 FYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQS---TSK 780
           FY+NI++VGG+S IP LDF+LTDRINIWRP  L +T+FP F+K ++K++K+++S   ++ 
Sbjct: 724 FYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLESHFVSAP 783

Query: 781 ASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKG 840
             T                  EL +   SIE Q   +H +P++++PPPRDMNP ++ WKG
Sbjct: 784 EKTEEENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPRDMNPALIIWKG 843

Query: 841 ASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           ASVLAQIKL+EELF+TN DWD+ GSRILQYKC+FTY
Sbjct: 844 ASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/756 (52%), Positives = 533/756 (70%), Gaps = 25/756 (3%)

Query: 131 DSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQM 190
           D   A P     KKVP HLLEKRRLGR              GIE+V+ + L  TGLF  +
Sbjct: 143 DPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPL 198

Query: 191 LLVNQKNCSSDYLKKDDQVFALRERKTLRNN-TTVSTTANTPDVVDLKALNNG--SSASL 247
           +L+NQKN SSDYLKKDDQ+FALR+RK LRNN TT  ++ NTPDVVDLK L++   S+A L
Sbjct: 199 MLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDLKNLSHTEPSTAPL 258

Query: 248 VDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLY---SE 304
                   +D+ID NDPT TIVIHPGS  +KIGF KDE P++VP+CVA+PK  L      
Sbjct: 259 --------NDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCVAVPKKWLNLGNGP 310

Query: 305 NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVED 364
           N   +S+ + E S+    +K++++++FRERMRYYKRK+  N+HE+V +FNE +KPEI+ +
Sbjct: 311 NEDNISLQR-EQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISE 369

Query: 365 KNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVT 424
           KND   IEWI +  K+Y+G +A RC  E F++R PF +GGS N               VT
Sbjct: 370 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPF-QGGSFNINSPYYESLAELISDVT 428

Query: 425 RLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESL 484
           +L EYAL     ++   +  Q KV+LVIPD+F+K+H+ET  R+LL E+QFQAVA++QESL
Sbjct: 429 KLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVAVIQESL 488

Query: 485 AACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNF 544
           A CYGAGIST++C+VNIGAT+T IACVDEGTVLE+S + L+YGGDDITRLF L LL+++F
Sbjct: 489 ATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALLLLQSDF 548

Query: 545 PFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVIL 604
           P QD  +D+ HGW LAEQLKKN+ TF+DA++ VQLYNF+ R P + SEKYEFK+FDEV+L
Sbjct: 549 PLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEKYEFKLFDEVML 608

Query: 605 APLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGN 664
           APLALF+P IF+ ++    KN  NLE QLP SRDL+T+ +NDW S+SQ +  +GDLY+  
Sbjct: 609 APLALFFPQIFKLIRSSSGKNS-NLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYSNL 667

Query: 665 TNELDIITKVLNINSSTEEYEGLETTEVD-GRENYVPLEKAIIQSITNACVSMDVSKMNQ 723
            ++L I+ K+L  ++  ++ +       D  +EN+ PLEKAIIQSI NA ++ DV++MN 
Sbjct: 668 NDDLKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANASITADVTRMNS 727

Query: 724 FYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQS---TSK 780
           FY+NI++VGGTS IP LDF+LTDRINIWRP  L + +FP F+K ++K++K+++S    + 
Sbjct: 728 FYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHFVNAP 787

Query: 781 ASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKG 840
             T                  EL +   +IE+Q   +H +PV+++PPPRDMNP ++ WKG
Sbjct: 788 DKTEEENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRDMNPALIIWKG 847

Query: 841 ASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           ASVLAQIKL+EELF+TN DWD+ GSRILQYKC+FTY
Sbjct: 848 ASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/778 (52%), Positives = 544/778 (69%), Gaps = 28/778 (3%)

Query: 112 STDSKKQDKAESPE---KGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXX 168
           S D + Q  A++ +   K    D   A P     KKVP HLLEKRRLGR           
Sbjct: 111 SRDKRAQPTAQTSKRYKKYPKLDPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFAKTL 166

Query: 169 XXTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNN-TTVSTT 227
              GIE+V+ + L  TGLF  ++L+NQKN SSDYLKKDDQ+FALR+RK LRNN TT  ++
Sbjct: 167 KKIGIEKVEATTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS 226

Query: 228 ANTPDVVDLKAL--NNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDE 285
            NTPDV+DLK L  +  ++ASL        +++ID ND T TIVIHPGS  +KIGF KDE
Sbjct: 227 TNTPDVIDLKNLPHSEANTASL--------NEEIDLNDSTATIVIHPGSNSVKIGFPKDE 278

Query: 286 TPLVVPSCVAIPKNSL---YSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKI 342
            P++VP+CVA+PK  L    SEN    S+ + E SE+   +K+ ++++FRERMRYYKRK+
Sbjct: 279 HPVLVPNCVAVPKKWLNLESSENDEIFSLQR-EQSEKFHSIKSDMEKNFRERMRYYKRKV 337

Query: 343 QPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNK 402
             N+HE+V +FNE +KPEI+ +KND   I+WI +  K+Y+G +A RC  E FIIR PF K
Sbjct: 338 PGNAHEQVISFNENSKPEIISEKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPF-K 396

Query: 403 GGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIE 462
           GGS N               VT+L EYAL     ++  A+  Q KV+LVIPD+F+KSHIE
Sbjct: 397 GGSFNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIE 456

Query: 463 TLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLI 522
           T  R+LL E+QFQAVAI+QESLA CYGAGIST++C+VNIGA++T IACVDEGTVLE+S I
Sbjct: 457 TFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAI 516

Query: 523 KLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNF 582
            LDYGGDDITRLF LFLL+++FP QD  ++S HGW LAEQLKKN+ TF+DA++ VQLYNF
Sbjct: 517 TLDYGGDDITRLFGLFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNF 576

Query: 583 VKRIPGKVSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTD 642
           + R P + +EKYEFK+FDEV+LAPLALF+P IF+ ++    KN  +LE QLP SRDL+T+
Sbjct: 577 INRSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSDKNS-SLEFQLPESRDLFTN 635

Query: 643 SINDWRSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEG-LETTEVDGRENYVPL 701
            +NDW S+SQ +  +G+LY    ++L+I+ K+L  ++  ++ +   E      +EN+ PL
Sbjct: 636 ELNDWNSLSQFESKEGNLYCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPL 695

Query: 702 EKAIIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTF 761
           EKAIIQSI NA ++ DV++MN FY+NI++VGG+S IP LDF+LTDRINIWRP  L + +F
Sbjct: 696 EKAIIQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASF 755

Query: 762 PHFFKNISKQVKEIQS---TSKASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDH 818
           P F+K ++K++K+++S    +   T                  EL +   +IE+Q   +H
Sbjct: 756 PQFYKKLTKEIKDLESHFVNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEH 815

Query: 819 SYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
            +P++++PPPRDMNP ++ WKGASVLAQIKL+EELF+TN DWD+ GSRILQYKC+FTY
Sbjct: 816 VFPISIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/758 (52%), Positives = 535/758 (70%), Gaps = 29/758 (3%)

Query: 131 DSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQM 190
           D   A P     KKVP HLLEKRRLGR              GIE+V+ + L  TGLF  +
Sbjct: 141 DPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPL 196

Query: 191 LLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVS-TTANTPDVVDLKAL--NNGSSASL 247
           +L+NQKN SSDYLKKDDQ+FALR+RK LRNN T   ++ NTPDV+DLK+L  +  S+A L
Sbjct: 197 MLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDVIDLKSLPHSEASAAPL 256

Query: 248 VDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSL---YSE 304
                   +D+ID NDPT TIVIHPGS  +KIGF KD+ P+VVP+CVA+PK  L    SE
Sbjct: 257 --------NDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSE 308

Query: 305 NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVED 364
           +V  + + + E SE    +K++++++FRERMRYYKRK+  N+HE+V +FNE +KPEI+ +
Sbjct: 309 HVENVCLQR-EQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISE 367

Query: 365 KNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVT 424
           KND   IEWI +  K+Y+G +A RC  E F+IR PF +GGS N               VT
Sbjct: 368 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELISDVT 426

Query: 425 RLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESL 484
           +L E+AL     ++   +  Q KV+LVIPD+F+KSH+ET  R+LL E+QFQAVAI+QESL
Sbjct: 427 KLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESL 486

Query: 485 AACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNF 544
           A CYGAGIST++C+VNIGA +T IACVDEGTVLE+S I LDYGGDDITRLF LFLL+++F
Sbjct: 487 ATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDF 546

Query: 545 PFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVIL 604
           P QD  +DS HGW LAE+LKKN+ TF+DA++ VQLYNF+ R P + +EKYEFK+FDEV+L
Sbjct: 547 PLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEVML 606

Query: 605 APLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGN 664
           APLALF+P IF+ ++    KN  +LE QLP SRDL+T+ +NDW S+SQ +  +G+LY   
Sbjct: 607 APLALFFPQIFKLIRTSSHKNS-SLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDL 665

Query: 665 TNELDIITKVLNINSSTEEYEGLETTEVDG---RENYVPLEKAIIQSITNACVSMDVSKM 721
            ++L I+ ++L+ ++  ++ +  +  E  G   +EN+ PLEKAI+QSI NA ++ DV++M
Sbjct: 666 NDDLKILNRILDAHNIIDQLQ--DKPENYGNTLKENFAPLEKAIVQSIANASITADVTRM 723

Query: 722 NQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQS---T 778
           N FY+NI++VGG+S IP LDF+LTDRINIWRP  L + +FP F+K ++K++K+++     
Sbjct: 724 NSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVN 783

Query: 779 SKASTTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNW 838
           +   T                  EL +   +IE Q   +H +PV+++PPPRDMNP ++ W
Sbjct: 784 APDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIW 843

Query: 839 KGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           KGASVLAQIKL+EELF+TN+DWD+ GSRILQYKC+FTY
Sbjct: 844 KGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/755 (48%), Positives = 509/755 (67%), Gaps = 27/755 (3%)

Query: 134 NATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLV 193
           N    +++NKK   HLLEKRRLGR             +GIE+++   +  TGLF   +L+
Sbjct: 115 NPKIDSSKNKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAMLI 174

Query: 194 NQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTAN-TPDVVDLKALNNGSSASLVDEVL 252
           NQKN SSDYLKKD Q+FA+R RK +R N   +T+ N TPD  + +   N ++        
Sbjct: 175 NQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAA-------- 226

Query: 253 NKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSID 312
              D+DI+  DP+TTIVIHPGS++LKIG+A+D  P+++PSCVA+PKN  + + V EL+ +
Sbjct: 227 --QDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQ-FLDTVSELNDN 283

Query: 313 ---KIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHG 369
                + SE+    K +L +SF+ERMR+YKRK+Q N HE+V +FN+ +KPE V +KND  
Sbjct: 284 FNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIE 343

Query: 370 RI-EWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFE 428
            +  WIN+  K YFG +A RC+KENFIIRYPF  GGS N               V     
Sbjct: 344 DVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLV 403

Query: 429 YALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACY 488
           + LT     +  +     K++LVI D+FEKSH+E ++R+LL EMQF AVAI+QESLA CY
Sbjct: 404 HILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCY 463

Query: 489 GAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQD 548
           GAG+ +++C+VN+GATQT IACVDEG+++E+S++ LDYGGDDIT+LF++ LL++ FP+ D
Sbjct: 464 GAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTD 523

Query: 549 LDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLA 608
           L++++ H W LAE+LKK++ TF DAN+TVQLYNF+KR+PG++ +KYEF+ F+EV+LAPL+
Sbjct: 524 LNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLS 583

Query: 609 LFYPDIFQELK--KLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTN 666
           LFYP + + LK  +L       ++ QLP SRD++T  +NDW+S++Q  CL+ +LY+  ++
Sbjct: 584 LFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSD 643

Query: 667 ELDIITKVLNINSSTEEYEGLETTEVDGRE-----NYVPLEKAIIQSITNACVSMDVSKM 721
           E+ ++ + LNI+ + EE       E+D        NY  LEKAIIQSI NA  S+D+SK+
Sbjct: 644 EISMLKRTLNIHLNLEEIRD----EIDKEHEIPNSNYTSLEKAIIQSIANASASLDISKI 699

Query: 722 NQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKA 781
           N FY+NI++VGG + IP LDF+L DRI IWRP+ L   +FP F+K ++K +KE+ +  K 
Sbjct: 700 NSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKT 759

Query: 782 STTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGA 841
           + T                TE   Y   +E Q + D  +PV++LP PR+M+P  L WKGA
Sbjct: 760 NKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGA 819

Query: 842 SVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           SVLAQIKL+EELFVT  DWDM GSRILQ+KC+FTY
Sbjct: 820 SVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/775 (49%), Positives = 513/775 (66%), Gaps = 56/775 (7%)

Query: 139 TTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQKNC 198
           T    KVP+HLLE+RR+GR              GIE+++N  L QTGLF  + L+NQKN 
Sbjct: 87  TMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLNLINQKNY 146

Query: 199 SSDYLKKDDQVFALRERKTLRNNTTVSTTANT--PDVVDLKALNNGSSASLVDEVLNKND 256
           SSDY++KDDQ+FALRERKTLR++T  +    +    VVDLK                  D
Sbjct: 147 SSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPKAVVDLKT--------------GVMD 192

Query: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSIDKIED 316
           D+ID NDP +TI+I PGS  +KIGFA DETPL++P+ VAIPK         E  ++  E 
Sbjct: 193 DEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTESKLN-TEQ 251

Query: 317 SERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINN 376
           SE    +K +L  +F+ERMRYYKR+IQPNSHE+V++FN  A+PE + D ND  RI WI  
Sbjct: 252 SEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPARIRWITQ 311

Query: 377 SDKIYFGEEAERCNKENFIIRYPFN---KGGSLNXXXXXXXXXXXXXXXVTRLFEYALTK 433
           +DK+Y+G +A  C +  F  R PF     G   N               V +L E+ L K
Sbjct: 312 NDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLIEFGLNK 371

Query: 434 RDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIS 493
             E+  +    + K ILVIPDLFEKSH+E + R+LL E+ F AVAI+QESLA CYGAGIS
Sbjct: 372 LLEAKNK---DKYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGIS 428

Query: 494 TASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDS 553
           T++C+VN+GA++T+++C+DEG VLENSLI L+YGGDDITRLF++ L  NNFP+QD +++S
Sbjct: 429 TSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVES 488

Query: 554 THGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLALFYPD 613
             GW +AE LKK   T +DA++TVQL NF+KR+  + +EKYEFK FDEV+LAPLALF P 
Sbjct: 489 IAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKTFDEVMLAPLALFAPR 548

Query: 614 IFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITK 673
           IF  L+  +SKN   L+ QLP S+DL+T  +NDWRS++Q  C +   Y   ++EL ++T 
Sbjct: 549 IFSYLRNEESKNS-TLQYQLPESKDLFTHELNDWRSMTQEACKNNGSYCDISDELQLLTA 607

Query: 674 VLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSKMNQFYANIMVVGG 733
           +L ++S  E ++   TT +D + N +PL+KAIIQSIT+AC+S+D SKM+ FY+NI+VVGG
Sbjct: 608 LLEVDSKLEAFQSEATTTLDNKRNMLPLDKAIIQSITDACLSLDPSKMDSFYSNILVVGG 667

Query: 734 TSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEI----QSTSK--------- 780
           +SNIP  DF+LTDRINIWRP+ L  ++FP F+KN+SK++K++    QST+K         
Sbjct: 668 SSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMESQSTAKLQAQTGSVV 727

Query: 781 ---ASTTPXXXXXXXXXXXXX----------------XXTELRKYLNSIESQGNGDHSYP 821
               S+TP                               T+L+ Y++++ESQ + +H +P
Sbjct: 728 PTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKLQDYISNVESQNSNEHYFP 787

Query: 822 VAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           V V+PPPRDM+  +L+WKGASVLAQIKL+EELF+TN DWDM GSRILQ+KC+FTY
Sbjct: 788 VGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKCIFTY 842

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/767 (48%), Positives = 515/767 (67%), Gaps = 15/767 (1%)

Query: 117 KQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERV 176
           K  K E P+K       N  P     KKVP HLLEKRRLGR              GIE+V
Sbjct: 105 KTTKEEGPQKKVQKVEPNKVPL---GKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKV 161

Query: 177 DNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVS-TTANTPDVVD 235
           ++  +  TG+F  +LL+NQKN SSDYL+KD+Q+FALRERKTLR+NTT + +++NTP+V D
Sbjct: 162 ESVPVPMTGMFQPLLLINQKNYSSDYLRKDEQIFALRERKTLRSNTTQNISSSNTPEVTD 221

Query: 236 LKALNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVA 295
           L+++   S+ +      N N+D+I  NDP TTIVIHPGS +LK+GFA DE P ++P+CVA
Sbjct: 222 LQSVRETSNFTTA----NGNNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPNCVA 277

Query: 296 IPKNSLYSENV---RELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRT 352
           +PK    + N+   ++ S++ IED+E+   +KA++++SF ERMRYYKR+IQPN H++V +
Sbjct: 278 LPKTDFNNTNIIKSKQTSVN-IEDNEKFESLKAEMEESFEERMRYYKRRIQPNGHDQVVS 336

Query: 353 FNEQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXX 412
           FN  +KPE +  +ND   I+WI +  K ++G++A RC  ENFI RYPF KGGS N     
Sbjct: 337 FNRLSKPESLPVQNDPAHIDWITDGTKRFYGDDALRCTDENFIKRYPFKKGGSFNTSSNS 396

Query: 413 XXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEM 472
                     V  L E  L+    +I  +Q  Q KV+LVIPD FEKSH+E   R+L+ E+
Sbjct: 397 YKSLQDLLSDVVGLIEGTLSSDKFNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVTEL 456

Query: 473 QFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDIT 532
           QFQAVAI+QESL+ CYG+G+  ++C+VN+G+ +TT+ACVDEG VL+NSLI LDYG +D+T
Sbjct: 457 QFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVACVDEGIVLDNSLITLDYGSNDVT 516

Query: 533 RLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIP-GKVS 591
           +LF  FLL+ +FP+++ DL+ST GW LAE+L K   TF+DA++TVQL NF+KR P G   
Sbjct: 517 KLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGNTV 576

Query: 592 EKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNK-FNLEDQLPVSRDLYTDSINDWRSV 650
           EK +FKVF+EV+LAPLALFYP+IF+ L+  +S+ +   LE QLP SRD++TD INDWRS+
Sbjct: 577 EKLDFKVFEEVMLAPLALFYPEIFKLLRSKESEEQNAELEYQLPPSRDIFTDKINDWRSL 636

Query: 651 SQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSIT 710
           SQ  C++   +    +E +++ K ++  ++ E +      E     N+ PL+KAI++SIT
Sbjct: 637 SQNDCINHQTFCDIHDEYELLKKAVDCPNTLETFMDNPPEEKKSTFNFTPLDKAIVESIT 696

Query: 711 NACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISK 770
            A + +DVSKM  FY+NI+VVGG S IP  D +L DR+NIWRP+ L    F HF++ ++K
Sbjct: 697 TASLGLDVSKMATFYSNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTK 756

Query: 771 QVKEIQSTSKA-STTPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPR 829
           Q+KE+QS                        TEL KYL  IE Q   +H  PV V+P P 
Sbjct: 757 QLKELQSLKTGDGEEEIKEDELNEKISELIKTELTKYLEVIEQQSGNEHFLPVEVIPSPN 816

Query: 830 DMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           +++P  + WKGASVLAQIKL+EELF+TN DWD+ G+RILQYK + TY
Sbjct: 817 EIDPGSIAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY 863

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/746 (47%), Positives = 518/746 (69%), Gaps = 12/746 (1%)

Query: 143 KKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDY 202
           KKVP HLLEKRRLGR              GIERV+N +L Q+GLF  + L+NQKN SSDY
Sbjct: 92  KKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDY 151

Query: 203 LKKDDQVFALRERKTLRN-NTTVSTTANTPDV----VDLKALNNGSSASLVD-EVLNKND 256
           L+KD+  FA+RERK +RN N   S  A T ++          ++ S  +LVD +   ++ 
Sbjct: 152 LRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSASMASSASLDALVDTDTKLQSV 211

Query: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSE-NVRELSIDKIE 315
           +DIDFNDP  TIVIHPGS  +KIG A DE P+ +P+ VA+P++ + +  +   +++  IE
Sbjct: 212 EDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIE 271

Query: 316 DSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWIN 375
             ++   +  QL+ +F+ERM+YYKRK+Q N+HE+V +FN  +KPE V DKND G+I+WI 
Sbjct: 272 LDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIY 331

Query: 376 NSDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRD 435
           N+DK Y+GE+A+RC  + FI+R PF K G  N               V+ L + AL+   
Sbjct: 332 NADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDK 391

Query: 436 ESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTA 495
            +IT+++ +  K ++VIPDLF+KSH+ET  R+LL EM F++VA+MQESLA CYGAGIST 
Sbjct: 392 FNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTP 451

Query: 496 SCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTH 555
           +C+VNIGA Q  IACVD+GT++++S + LDYGG+D+T L  + L ++ FP+++ +L + +
Sbjct: 452 TCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLY 511

Query: 556 GWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLALFYPDIF 615
           GW  AE  KK + TF+DA++ VQL+NF+KR+PG  SEKY+FKVFDEVILAPL LFYP+IF
Sbjct: 512 GWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAPLGLFYPEIF 571

Query: 616 ---QELKKLDSKN-KFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDII 671
              QE ++  +K  +  L  Q+  SRD+YT+S+NDWRS++Q  C +  +Y    ++L+II
Sbjct: 572 KYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEII 631

Query: 672 TKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSKMNQFYANIMVV 731
              L++N+  E+ +     E   ++ +VPL+KAI+QSITNA +++D+SK++QFY+NI++V
Sbjct: 632 QHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIV 691

Query: 732 GGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST-TPXXXXX 790
           GG +NIP LDF+L+DRINIWRP  L  ++FP+F+K+++KQ+K+IQ+++K++T        
Sbjct: 692 GGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQEQE 751

Query: 791 XXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLI 850
                      EL K + S+E   +GDH + V VLP PR+++P +L+WKGASVLAQIKLI
Sbjct: 752 VAERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLI 811

Query: 851 EELFVTNTDWDMLGSRILQYKCLFTY 876
           EEL+++  DWD+ G+R+LQYKC+F Y
Sbjct: 812 EELYISRNDWDVHGNRVLQYKCIFAY 837

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/745 (48%), Positives = 482/745 (64%), Gaps = 32/745 (4%)

Query: 137 PSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQK 196
           P   +N KVP HLLEKRRLGR              GIE+ DN  L Q GLF  + L+NQK
Sbjct: 58  PQVKQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQK 117

Query: 197 NCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALNNGSSASLVDEVLNKND 256
           N SSDYLK+DDQ+FA+RERK+LRN T   +T + PD                    + + 
Sbjct: 118 NYSSDYLKRDDQIFAMRERKSLRNATASQSTPDMPD--------------------DDDQ 157

Query: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSIDKIED 316
           + +D +    TIVIHPGS+ LKIGFA D  P  +PSCVA+PK S   +        +  D
Sbjct: 158 ESVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKRSQSLQG----ETKQPHD 213

Query: 317 SERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINN 376
           +E     K  +QQ F+ERMRYYKRKI PNSH+ V  FN +  PEI+ + ND  RI+WI+ 
Sbjct: 214 TEEYQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEIIPEHNDLHRIDWIDQ 273

Query: 377 SDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDE 436
             + Y+G+EA RC   +F +R+PF KG   N               V  L ++AL++   
Sbjct: 274 PSRPYYGKEATRCLPSHFTVRHPFWKG-RFNIESPDYSSLQELLNDVCELLKFALSQPKI 332

Query: 437 SITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTAS 496
            +  +QI   KV++V+PDL++K+++ET  R+LL ++ FQAVAI+QESLA+CYGAGI  ++
Sbjct: 333 DVKPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGEST 392

Query: 497 CIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHG 556
           C+V+IGAT T IACVDEG V ENS+I LDYGGDDITRLF  FLLE+NFP+QDLDLDS  G
Sbjct: 393 CVVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQG 452

Query: 557 WTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKV-SEKYEFKVFDEVILAPLALFYPDIF 615
           W+L EQLK+ Y TF+DA++T+QLYNF+KRIPGK  +EK+EFKVFDEV+ AP+ LF+P +F
Sbjct: 453 WSLVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVMTAPMGLFFPHVF 512

Query: 616 QELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITKVL 675
             LK+ ++     ++ QLP S+D++T   N+ +SVSQL C   + Y     +LDI+ K+L
Sbjct: 513 PLLKEQNNPTNEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYCDMGRDLDILQKLL 572

Query: 676 NINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMD--VSKMNQFYANIMVVGG 733
           N+ S  EEY+   +  V+    Y  LEKAII+SITNACVS+D   +K  QFY+NI+VVGG
Sbjct: 573 NLPSEIEEYQSAASANVEPA--YTALEKAIIESITNACVSLDNNHAKAAQFYSNILVVGG 630

Query: 734 TSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKASTTPXXXX--XX 791
           +S  P LDF+LTDRINIWRP+ L   T P F   +SKQVKE + T+K S           
Sbjct: 631 SSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQTNKLSEIKEEEELLSQ 690

Query: 792 XXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIE 851
                     EL+ Y   +++ G  +  +P+ VLP PR+M+P +L WKG SV A++KLIE
Sbjct: 691 KKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPREMDPALLTWKGGSVFARLKLIE 750

Query: 852 ELFVTNTDWDMLGSRILQYKCLFTY 876
           EL+V+  DWD+L SRILQYKC+F Y
Sbjct: 751 ELYVSANDWDVLNSRILQYKCIFDY 775

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/742 (49%), Positives = 494/742 (66%), Gaps = 21/742 (2%)

Query: 143 KKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDY 202
           KKVP HLLEKRRLGR              GIE+ DNS LQQTGLF  +LL+NQKN SSDY
Sbjct: 66  KKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYSSDY 125

Query: 203 LKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALNNGSSASLVDEVLNKNDDDIDFN 262
           LKKDDQ+FA+RERK+LRN  + +   NT       A++N +   + +E  N ++DD +  
Sbjct: 126 LKKDDQIFAMRERKSLRNPNSGNGNGNT----GNNAVSNATPEVIPEEEDNDDNDDAEGT 181

Query: 263 DPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIP---KNSLYSENVRELSIDKIEDSER 319
           D   TIVIHPGS++LKIGFA D  P  VPSC+AIP   KNS+ S  +RE S         
Sbjct: 182 DDLNTIVIHPGSKFLKIGFATDVLPQSVPSCIAIPRATKNSVRSPQIREPS--------E 233

Query: 320 LVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNSDK 379
             G+K+ +QQ F+ERMRYYKRK+ PN+H+ V  FN + +PE++ + ND  R+EWI N   
Sbjct: 234 FDGLKSAIQQDFKERMRYYKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRVEWIQNGSN 293

Query: 380 IYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDESIT 439
            ++GEEA RC   +F +RYPF +G S N               V  L EY L +    +T
Sbjct: 294 QFYGEEATRCLPSHFTLRYPFARG-SFNVESPYYMSFQELLGDVQSLLEYCLKQEKIDVT 352

Query: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499
           + Q    K++LVIPDL++K+++ET   +LL +M FQAVAI+QESLA  YGAGIS ++C+V
Sbjct: 353 KQQFANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVV 412

Query: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTL 559
           +IGAT T IACVDEGTVL NS + LDYGGDDITRLF+ FLL++ FP+ D DL + HGW L
Sbjct: 413 DIGATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGWML 472

Query: 560 AEQLKKNYATFEDANMTVQLYNFVKRIPGKV-SEKYEFKVFDEVILAPLALFYPDIFQEL 618
           AE LKK + TF+DAN+ VQLYNF+KR PG+  ++KYEFKVFDEV+LAP+A+F+P I   L
Sbjct: 473 AESLKKEFTTFQDANVAVQLYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMFFPKILSLL 532

Query: 619 KKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITKVLNIN 678
               ++ +  + +Q P S+D+YT   N+ RS+SQ +C +   Y   T +LDI+ K+LN+ 
Sbjct: 533 NPQKTQQEHYVTNQFPRSKDIYTLRDNNPRSISQRECHENKTYCDMTRDLDILQKILNLP 592

Query: 679 SSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMD--VSKMNQFYANIMVVGGTSN 736
              +EY     ++    +N  PLEKAI++SITNA +S+D  +S++  FY+N++VVGG S 
Sbjct: 593 DEIDEYSNSNLSKKHHHDNITPLEKAIVESITNASISLDNNMSRLGNFYSNLLVVGGGSK 652

Query: 737 IPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAS--TTPXXXXXXXXX 794
            P LDF+LTDRINIWRP+ L   T   F+K +++Q+K+ +  +K S  T P         
Sbjct: 653 FPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFEQENKVSEVTDPEQLATLKKK 712

Query: 795 XXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELF 854
                  EL+ Y  S+++ G  ++ +P+ VLPPPRDM+P VL WKG SVLA+IKL+EEL+
Sbjct: 713 LLKMVKLELQSYWESVDALGGNENVFPINVLPPPRDMDPAVLTWKGGSVLARIKLVEELY 772

Query: 855 VTNTDWDMLGSRILQYKCLFTY 876
           +T  DWD+LGSRILQYKC+F Y
Sbjct: 773 ITAKDWDVLGSRILQYKCIFDY 794

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/745 (47%), Positives = 477/745 (64%), Gaps = 32/745 (4%)

Query: 137 PSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQK 196
           P   +  KVP HLLEKRRLGR              GIE+ DN  L Q GLF  + L+NQK
Sbjct: 58  PHAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQK 117

Query: 197 NCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALNNGSSASLVDEVLNKND 256
           N SSDYLK+DDQ+FA+RERK+LRN      T + P+  D ++++  S A           
Sbjct: 118 NYSSDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQ---------- 167

Query: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSIDKIED 316
                     TIVIHPGSR LKIG A +  P  +P CVA+PK    S++  E  +D+   
Sbjct: 168 ----------TIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDE--- 214

Query: 317 SERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINN 376
            E  +  K  +QQ F+ERMRYYKRK+ PNSH+    FN +  PE + + ND  R++WI +
Sbjct: 215 -EEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQD 273

Query: 377 SDKIYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDE 436
           + K Y+G++A RC   +F +R+PF KG   N               V+ L ++AL++   
Sbjct: 274 ASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKFALSQPKI 332

Query: 437 SITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTAS 496
            +  +QI   KV++V+PD F+K+++ET  R+L+ +++FQAVA++QESLA+CYGAGI  ++
Sbjct: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392

Query: 497 CIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHG 556
           C+V+IGAT T IACVDEG V++NS+I LDYGGDDIT+LF  FLLE+NFP+QDLDL+S  G
Sbjct: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEG 452

Query: 557 WTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKV-SEKYEFKVFDEVILAPLALFYPDIF 615
           W+L EQLK+ YATF+DA++T+QLYNF+KRIP K  +EK+EFKVFDEV+ AP+ LF+P I 
Sbjct: 453 WSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512

Query: 616 QELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITKVL 675
           + LK  +      +  QLP S+D++T   N+ +SVSQL C     Y     +LDI+ K+L
Sbjct: 513 RLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLL 572

Query: 676 NINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMD--VSKMNQFYANIMVVGG 733
           N+ S  EEY+   +T  +    Y PLEKAI++SITNACVS+D   SK   FY+NI+VVGG
Sbjct: 573 NLPSEIEEYQS--STCANLEPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGG 630

Query: 734 TSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKASTTP--XXXXXX 791
           +S    LDF+LTDRINIWRP+ L   T P F   +SKQVKE + T K S           
Sbjct: 631 SSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIKDEEELAAQ 690

Query: 792 XXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIE 851
                     EL+ Y   +++ G  +  +P  VLP PR+M+P +L WKG SV A++KLIE
Sbjct: 691 KKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIE 750

Query: 852 ELFVTNTDWDMLGSRILQYKCLFTY 876
           EL+V+ +DWD+LGSRILQYKC+F Y
Sbjct: 751 ELYVSESDWDILGSRILQYKCIFDY 775

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/788 (45%), Positives = 504/788 (63%), Gaps = 48/788 (6%)

Query: 110 IESTDSKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXX 169
           +E T +  + K   PE G          ++T++KKVP+HLLEKRRLGR            
Sbjct: 15  MEVTAAATEGKVTKPETGG--------VASTQSKKVPQHLLEKRRLGRIKAAEEFARKLK 66

Query: 170 XTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTAN 229
             GIE+ DN H+ QTGLF    L+NQKN SSDYL+KDDQ+F++RERK LR+    S T +
Sbjct: 67  KIGIEKQDNIHISQTGLFRVHSLINQKNYSSDYLRKDDQIFSMRERKNLRSGNVNSITNS 126

Query: 230 TPDVVDLKALNNGSSASLVDEV-LNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPL 288
           +  ++ L  + +       DEV  N ++D +D    T TIVIHPGSR LKIG + D  PL
Sbjct: 127 SQPLIALPDVQD-------DEVKTNGDEDGLDDTADTNTIVIHPGSRSLKIGLSTDVFPL 179

Query: 289 VVPSCVAIPKNSLYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHE 348
            +PSCVAI +    SE V   S  + ++ E  +G   Q+Q  F+ERMRYYKRKI PNSHE
Sbjct: 180 SIPSCVAIAR----SEQVEVPSQPRYDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHE 235

Query: 349 RVRTFNEQAKPEIVEDKNDHGRIEWINNSD---KIYFGEEAERCNKENFIIRYPFNKGGS 405
           +V ++N + +PE + + ND  RIEWI  SD   K+Y+GE AERC  E F++RYPF   GS
Sbjct: 236 QVLSYNSKCQPEKIPEHNDLHRIEWIKKSDASTKVYYGEYAERCLPEGFLLRYPF-ANGS 294

Query: 406 LNXXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLY 465
            N               V  L  +AL++   +I+++Q     V+L+IPDLFEKS++E + 
Sbjct: 295 FNVKSPNYNSLQELLNDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMI 354

Query: 466 RILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLD 525
           R+L+ EM FQAVA++QESLA+CYGAG+S ++C+++IG ++T I+CVDEG V++NS IKL 
Sbjct: 355 RLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLS 414

Query: 526 YGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKR 585
           YGGDDIT+LF   LL++NFP++D +L++  GW LAEQLKKN+ TF+DA++ VQL+NF KR
Sbjct: 415 YGGDDITKLFAELLLQSNFPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKR 474

Query: 586 IPG-KVSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSI 644
            P    +EKYEFK+F+EV+++P+A FYP I   LK     NK+ ++ QLP SRD YT   
Sbjct: 475 NPNISGAEKYEFKLFNEVMVSPMAYFYPQILALLKPPVEVNKY-VQQQLPPSRDPYTCKP 533

Query: 645 NDWRSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGR--------- 695
           +D +SVS L  L G  Y   + +LDI+ K+++I   T++ E L     DG          
Sbjct: 534 DDPQSVSNLGSLSGKWYTEMSKDLDIVRKLISI---TDKVEALSANSSDGTASDTIVENT 590

Query: 696 ---ENYVPLEKAIIQSITNACVSM--DVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINI 750
               NY+PL+KAII+S+TNA V +  ++SK+  FY+N+++VGG+S +P LD +LTDRINI
Sbjct: 591 EEVSNYMPLDKAIIESVTNAAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINI 650

Query: 751 WRPKALCNTTFPHFFKNISKQVKEIQSTSKAST--TPXXXXXXXXXXXXXXXTELRKYLN 808
           WRP+ L  +T P  +K IS  VK+++S  K +   +                 EL  Y  
Sbjct: 651 WRPRLLSVSTLPVIYKKISDMVKQVESEIKKNNVESEEEIQQSRKKLIKSIKIELENYWE 710

Query: 809 SIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRIL 868
           S++     +H YP+ VLPPPR+M+P +L WKG SV  +IKL EEL++T  DW+MLGSRIL
Sbjct: 711 SVDPY---EHVYPITVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRIL 767

Query: 869 QYKCLFTY 876
           +YKC+F Y
Sbjct: 768 KYKCIFDY 775

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/807 (45%), Positives = 508/807 (62%), Gaps = 88/807 (10%)

Query: 139 TTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTGLFGQMLLVNQKNC 198
           +   KKVP HLLEKRRLGR              GIE+VD++ L  TG    ++++NQKN 
Sbjct: 147 SAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNY 206

Query: 199 SSDYLKKDDQVFALRERKTLRN----------------NTTVSTTANTPDVVDLKALNNG 242
           SSDY++KDDQ+FALRERK LR+                   V + ++TP+V         
Sbjct: 207 SSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEV--------- 257

Query: 243 SSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLY 302
           +++++ +E   K+DD IDF D TTTIVI PGS  +KIGFA DETPLV+P+CVA+P +   
Sbjct: 258 ATSTIPNEFTLKSDD-IDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHSGET 316

Query: 303 S-ENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEI 361
              N   L+ D+    ++ +  K +LQ SF+ERMR+YKR++Q +S+++V TFNE  KPEI
Sbjct: 317 PIGNAANLTRDQ---PDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEI 373

Query: 362 VEDKNDHGRIEWINNSDK-----IYFGEEAERCNKENFIIRYPF--NKGGSL-NXXXXXX 413
           +ED+ND  +I W    D      IY G+EA  C +E+++ R PF  ++G  L N      
Sbjct: 374 IEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRY 433

Query: 414 XXXXXXXXXVTRLFEYA----LTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILL 469
                    V+RL E+A    L KRD+  T+  I+  K +LVIPDLFEKSH+ET+ R+LL
Sbjct: 434 TSLAALLCDVSRLLEHAIDKLLKKRDKD-TEKDIKY-KAVLVIPDLFEKSHVETMIRLLL 491

Query: 470 KEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGD 529
            E+ F AVAI+QESLA CYG+GIST++C+VN+GAT T +ACVDEG V+ENS+I L+YGGD
Sbjct: 492 SELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGD 551

Query: 530 DITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGK 589
           DI++LF + LL +NFP+Q+ D+DS  G  +AE LKK   TF+DA++T QL+NF+KR+PG 
Sbjct: 552 DISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGL 611

Query: 590 VSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFN--LEDQLPVSRDLYTDSINDW 647
            +EK EFK FDEVILAPLALFYP IF  LK    KN  N  L+ QLP SRDL+T+  N+W
Sbjct: 612 PTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNW 671

Query: 648 RSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYE-----GLETTEVDGRENYVPLE 702
           +S+S++ C    LY+    E  ++  +L INS  E        G ETTE+    N   L+
Sbjct: 672 KSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTEL----NLTALD 727

Query: 703 KAIIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFP 762
           K++IQSITNA +S++  KM  FY+NI++VGG+SNIP  D +L DRIN+WRPK +   +FP
Sbjct: 728 KSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFP 787

Query: 763 HFFKNISKQVKEIQSTSKAST---------------------TPXXXXXXXXXXXXXXXT 801
           +F+  + K++K++++++K S+                      P                
Sbjct: 788 NFYNELVKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEY 847

Query: 802 E------------LRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKL 849
           E            L KYL++IE Q   +H  PV+V P P +MNP +L W+GA VLAQIKL
Sbjct: 848 ELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKL 907

Query: 850 IEELFVTNTDWDMLGSRILQYKCLFTY 876
           IEELFVTN DWD+ GSR+LQ+KC+FTY
Sbjct: 908 IEELFVTNIDWDVHGSRVLQHKCIFTY 934

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/770 (45%), Positives = 500/770 (64%), Gaps = 38/770 (4%)

Query: 126 KGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGIERVDNSHLQQTG 185
           +G  +    A  +  + KKVP+HLLEKRRLGR              GIE+ DN H+ QTG
Sbjct: 41  EGKVSKPETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTG 100

Query: 186 LFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALNNGSSA 245
           LF  + L+NQKN SSDYL+KDDQ+F++RERK+LR+       ++ P  +  +A  +    
Sbjct: 101 LFRPLPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAGED---- 156

Query: 246 SLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSEN 305
              D  LN ++D ID  +   TIVIHPGSR LKIG + D  PL VPSCVA+ + +  S+ 
Sbjct: 157 ---DLKLNGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRA--SQR 211

Query: 306 VR-ELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVED 364
           +  +   DK ED    +    Q+Q  F+ERMRYYKRKI PNSHE+V ++N +A+PE + +
Sbjct: 212 LEPQQRYDKDED---FMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPE 268

Query: 365 KNDHGRIEWINNSDK--IYFGEEAERCNKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXX 422
            ND  RIEWI ++ +  IY+GE AERC  ENF+IRYPF+  G+ N               
Sbjct: 269 HNDLHRIEWIKDAPEGTIYYGEGAERCLPENFVIRYPFS-NGAFNVECPDYSSLQELLND 327

Query: 423 VTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQE 482
           VT+L  +AL++    I+++Q    KVIL+IPDLFEK+++E + R+LL EM FQAVA++QE
Sbjct: 328 VTKLITFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQE 387

Query: 483 SLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLEN 542
           SLA CYGAG+S ++C+++IGA++T I+CVDEG V++NS I+L YGGDDITRLF   LL++
Sbjct: 388 SLATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQS 447

Query: 543 NFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKR---IPGKVSEKYEFKVF 599
           NFP+ D +L++  GW LAEQLKK + TF+DA++ VQL+NF KR   +PG  +EK+EFK+F
Sbjct: 448 NFPYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPG--AEKFEFKLF 505

Query: 600 DEVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGD 659
           +EV+++P+A FYP I   LK   S NK+ +  QLP SRD YT   ++ +S++Q     G 
Sbjct: 506 NEVMISPMAYFYPQILSFLKPATSYNKY-MAQQLPESRDPYTYKPDNPKSIAQESAFTGK 564

Query: 660 LYAGNTNELDIITKVLNINSSTE-------EYEGLETTEVDGRE--NYVPLEKAIIQSIT 710
           +Y     +LDII K++++N   E       E    +T + + R   NY PL+KAII+S+T
Sbjct: 565 VYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVT 624

Query: 711 NACVSM--DVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNI 768
            A V +  ++SK+  FY+N++V+GG+S +P LD +LTDRINIWRP+ L  +T P  +K +
Sbjct: 625 TASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKV 684

Query: 769 SKQVKEIQSTSKAST--TPXXXXXXXXXXXXXXXTELRKYLNSIESQGNGDHSYPVAVLP 826
           S+ VK++++  K +   +                 EL  Y  S++     +H YP+AVLP
Sbjct: 685 SEMVKQVENEIKKNNPESEEEIAQSRKKLIKSIKIELENYWESVDPY---EHVYPIAVLP 741

Query: 827 PPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876
           PPR+M+P +L WKG SV  +IKL EEL++T  DW+MLGSRIL+YKC+F Y
Sbjct: 742 PPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/683 (46%), Positives = 449/683 (65%), Gaps = 37/683 (5%)

Query: 114 DSKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXXXTGI 173
           + K + K E+ +K    D     P     KKVP HLLEKRRLGR              GI
Sbjct: 145 NKKLKSKEEAYKKYPKMDPKKVPPG----KKVPLHLLEKRRLGRIKAAEEFAKKLKEAGI 200

Query: 174 ERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPD- 232
           E+V++  +  TGLF  + L+NQKN SS YLK DDQ+F LR+ K+L+N +   T+  TPD 
Sbjct: 201 EKVESVTVPPTGLFQPLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDN 260

Query: 233 VVDLKA--LNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVV 290
           +V+  A  +NN S+            D ++ NDPT TI+IH GS  LKIG A DE P++V
Sbjct: 261 IVESVATGINNKSTG-----------DQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIV 309

Query: 291 PSCVAIPKNSLYSENVRELS-------------IDKIEDSERLVGMKAQLQQSFRERMRY 337
           P+CVAIPK   Y    R ++              D I  S+    +K +++ +F+ERM+Y
Sbjct: 310 PNCVAIPKQE-YEGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKY 368

Query: 338 YKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNS-DKIYFGEEAERCNKENFII 396
           YKR+IQPNS E+V++FN+ +KPEI+   ND  RI+WIN S +K Y+G  AERC   +F  
Sbjct: 369 YKRRIQPNSCEQVKSFNKISKPEILPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKT 428

Query: 397 RYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLF 456
           R PF+  GS N               VT L E++LT     +  +Q ++ KV+L+IPD F
Sbjct: 429 RKPFSNNGSFNIASTDYISLQDLLSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSF 488

Query: 457 EKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTV 516
            KSH+E    +LL  ++FQAVAI+QESLA CYGAG S  +C+VN+GA+QTT+ACVDEGTV
Sbjct: 489 GKSHVELFITLLLTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTV 548

Query: 517 LENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMT 576
           LENS++ L+YGG+DIT +F  FLL+N+FP+ + +L+S  GW LAE+LK+ Y TF+D ++T
Sbjct: 549 LENSMVSLNYGGNDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVT 608

Query: 577 VQLYNFVKRIPGKVS-EKYEFKVFDEVILAPLALFYPDIFQELK--KLDSKNKFNLEDQL 633
           VQL+NF+KR+PG  + EKY+FKVFD+V+LAPL LF+P I + +K  +  ++NKF L+ QL
Sbjct: 609 VQLFNFIKRLPGMDTIEKYDFKVFDDVMLAPLTLFFPKILKLMKEQQPQNRNKF-LQSQL 667

Query: 634 PVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVD 693
           P SRD+YT  INDWRS++Q +CL+  L++   NEL+++ + L +    E ++       +
Sbjct: 668 PDSRDIYTTKINDWRSITQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKN 727

Query: 694 GRENYVPLEKAIIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRP 753
            + NY PL+ AIIQSI NA  ++D+SKM+ FY+NI+VVGG S IP LDF+LTDRINIWRP
Sbjct: 728 DKLNYTPLDVAIIQSIMNASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRP 787

Query: 754 KALCNTTFPHFFKNISKQVKEIQ 776
           + L  T+FP+F+K +SK +K++Q
Sbjct: 788 RLLSLTSFPNFYKELSKDIKDLQ 810

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 61/76 (80%), Gaps = 1/76 (1%)

Query: 802 ELRKYLNSIESQGNG-DHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDW 860
           +L +YL ++E   NG DH  PV+V+P PRD++P ++ WKGASVLAQ+K+IEEL++TN DW
Sbjct: 899 KLEEYLETVEKAQNGNDHYLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADW 958

Query: 861 DMLGSRILQYKCLFTY 876
           D+ GSRILQYK +F Y
Sbjct: 959 DVHGSRILQYKSIFPY 974

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/798 (40%), Positives = 475/798 (59%), Gaps = 48/798 (6%)

Query: 110 IESTDSKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRXXXXXXXXXXXX 169
           I+ T+S  ++ ++ P K     S         +KKVP+HLLEKRRLGR            
Sbjct: 5   IDPTESPSKEPSKEPSKEPLLGSDGKISKDIPSKKVPQHLLEKRRLGRIKAAEEFAKKLK 64

Query: 170 XTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTAN 229
             GIER +N H+ Q      + ++NQKN SS+YLK DDQ+F +RERK LR       +++
Sbjct: 65  IIGIERQENEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSS 124

Query: 230 TPDVVDLKALNNGSSASLVDEVLNKN---DDDIDFNDPTTTIVIHPGSRYLKIGFAKDET 286
            P      A   G+ A   D + + N   DD++D      +I+IHPGS ++KIG   D  
Sbjct: 125 AP------AAGIGTPALDDDNMADSNAIEDDELD------SIIIHPGSSFIKIGPNYDIF 172

Query: 287 PLVVPSCVAIPKNSLYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNS 346
           P  VP+ VA+P +     + +E     I ++E    +K  +Q  F+ERMRYYKR+I PNS
Sbjct: 173 PQQVPNLVAVPTHGGTVPSPQE----DISNNEIFQQLKDDIQFDFKERMRYYKRRIMPNS 228

Query: 347 HERVRTFNEQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSL 406
            E+   FN ++ PE+V D ND GRIEWI +  K Y+G +A +C   +F +R PF   GS 
Sbjct: 229 TEQAAAFNAKSDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKLRSPF-LNGSF 287

Query: 407 NXXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYR 466
           N               V +L   +L      I + Q    +V+L++PDLF+K+ +E++  
Sbjct: 288 NLNEPNYNSFQEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVESMIH 347

Query: 467 ILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDY 526
           +LL E+ FQ++A++QESLA+CYGAG+S ++C+++IGA QT IACVD+G V++NS ++L+Y
Sbjct: 348 LLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNY 407

Query: 527 GGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRI 586
           GGDDITRLF   LL+N FP+ D +++  +GWTLAE LKK   TF+DA++ +QLY+F+KR 
Sbjct: 408 GGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAIQLYSFIKRD 467

Query: 587 PGK----VSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTD 642
           P       S KYE+K+FDEV+ AP+ +F+PDIF+ +K    K    +  Q P S+D+YT 
Sbjct: 468 PYARKYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQHKPNEYVIRQCPRSKDIYTL 527

Query: 643 SINDWRSVSQLQCLD--GDLYAGNTNELDIITKVLNIN-------------SSTEEYEGL 687
             ND +S++Q+ C+      Y+  + ++DI+ K+LN++              S EE +  
Sbjct: 528 KPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESAGSKEETQIN 587

Query: 688 ETTEVDGRENY----VPLEKAIIQSITNACVSM--DVSKMNQFYANIMVVGGTSNIPQLD 741
           +  E      Y    +PLEKAII+SITNA + +  ++SK+N  Y+NI++VGG+S IP LD
Sbjct: 588 DEIEDINLRQYNNLSMPLEKAIIESITNASMLLGDNMSKLNVLYSNILIVGGSSKIPALD 647

Query: 742 FVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSK---ASTTPXXXXXXXXXXXXX 798
           F+LTDRINIWRPK L  +      + I + +K  ++ +K     T P             
Sbjct: 648 FILTDRINIWRPKLLSISALSTLMEKIGEVIKSYETDNKLDLEPTDPQAAIAYKKKLSKL 707

Query: 799 XXTELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNT 858
              E+  Y +S+++  + D   P+ +LPPP DM+P +L WKG SV ++IKL+EEL +T  
Sbjct: 708 IKAEIEAYWDSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQ 767

Query: 859 DWDMLGSRILQYKCLFTY 876
           DW+MLG+RILQYKC+F Y
Sbjct: 768 DWNMLGNRILQYKCIFEY 785

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        KV+L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFY---EQMKLPSTSGGKVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + EKYE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTRL----ARETTTLVEKYELPDGRIIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P++
Sbjct: 253 VGQERFEAPECLFQPNL 269

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 19/176 (10%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           KV+L  P +    + E +  ++ +   F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KVLLTEPPMNPVKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN 566
            I  V E  VL +   +LD  G D+TR     L    + F     + T  +    Q+K+ 
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSF-----NRTADFETVRQIKEK 218

Query: 567 --YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
             Y ++ D N+  +L     R    + ++YE       KV  E   AP  LF PD+
Sbjct: 219 VCYVSY-DLNLDTKL----ARETTTLVQEYELPDGRIIKVGQERFEAPECLFQPDL 269

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 79/175 (45%), Gaps = 17/175 (9%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           K++L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KILLTEPPMNPLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF-QDLDLDSTHGWTLAEQLKK 565
            I  V E  VL +   +LD  G D+TR     L    + F +  D ++     + E+L  
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR--QIKEKL-- 219

Query: 566 NYATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
           +Y ++ D N+  +L     R    + E YE       KV  E   AP  LF PD+
Sbjct: 220 SYVSY-DLNLDTKL----ARETTVLVENYELPDGRVIKVGQERFEAPECLFQPDL 269

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 74/153 (48%), Gaps = 21/153 (13%)

Query: 430 ALTKRDESITQAQIQ----QCKVILVIPDLFEKSH------IETLYRILLKEMQFQAVAI 479
           AL K+ E I + Q++    +  V++ IP    K+       IE   +I  ++ +   + I
Sbjct: 80  ALEKQWEYIFEKQLKCDPTELPVLITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQI 139

Query: 480 MQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFL 539
           + ESL+   G G  T S +++I  + +++  + +G +++N ++K  YGGD     F  + 
Sbjct: 140 VNESLSISLGLGKKT-SLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGD-----FLDYQ 193

Query: 540 LENNFPFQDLDLD-----STHGWTLAEQLKKNY 567
           +   F   D DL+     S++ W  +    KN+
Sbjct: 194 IIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNF 226

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFF---EQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTALVESYELPDGRTIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGQERFEAPECLFQPGL 269

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFF---EQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTALVESYELPDGRTIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGQERFEAPECLFQPGL 269

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 461 IETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENS 520
           +E  + + L ++Q  A+ I+ E LA     G S+A  ++++GA  TT+  + +GTV+ + 
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKSSA-LVIDVGARGTTVTPIVDGTVVRSG 171

Query: 521 LIKLDYGGD 529
           ++K  +GGD
Sbjct: 172 VMKSRFGGD 180

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFF---EQMKLQSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTTLVESYELPDGRTIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGQERFEAPECLFQPGL 269

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFF---EQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTVLVESYELPDGRTIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGQERFEAPECLFQPGL 269

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFF---EQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTTLVESYELPDGRTIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGQERFEAPECLFQPGL 269

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        K++L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 33  LWDYAFY---EQMKLPDTSNGKILLTEPPMNPIKNREKMCEVMFEKYNFGGVYVAIQAVL 89

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 90  ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYA 148

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 149 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTTLVESYELPDGRVIK 198

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P++
Sbjct: 199 VGSERFEAPECLFQPNL 215

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 79/175 (45%), Gaps = 17/175 (9%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           KV+L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF-QDLDLDSTHGWTLAEQLKK 565
            I  V E  VL +   +LD  G D+TR     L    + F +  D ++     + E+L  
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR--QIKEKL-- 219

Query: 566 NYATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
           +Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P++
Sbjct: 220 SYVSY-DLDLDTKL----ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNL 269

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 78/175 (44%), Gaps = 17/175 (9%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           KV+L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 109

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF-QDLDLDSTHGWTLAEQLKK 565
            I  V E  VL +   +LD  G D+TR     L    + F +  D ++     + E+L  
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR--QIKEKL-- 165

Query: 566 NYATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
           +Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P +
Sbjct: 166 SYVSY-DLDLDTKL----ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSL 215

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 4/121 (3%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        KV+L  P L    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFY---EQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +++ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 F 546
           F
Sbjct: 203 F 203

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 4/121 (3%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        KV+L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFY---EQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 F 546
           F
Sbjct: 203 F 203

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 79/175 (45%), Gaps = 17/175 (9%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           K++L  P +    + E + +++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 107 KILLTEPPMNPLKNREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 165

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF-QDLDLDSTHGWTLAEQLKK 565
            I  V E  VL +   +LD  G D+TR     L    + F +  D ++     + E+L  
Sbjct: 166 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR--QIKEKL-- 221

Query: 566 NYATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
           +Y ++ D +   +L     R    + E YE       KV  E   AP  LF P++
Sbjct: 222 SYVSY-DLDFDTKL----ARETTTLVENYELPDGRIIKVGQERFEAPECLFQPNL 271

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 53/109 (48%), Gaps = 9/109 (8%)

Query: 425 RLFEYALTKRDESITQAQIQQCKVILVIPDL----FEKSHIETLYRILLKEMQFQAVAIM 480
           RL+ Y   K      +    +  +++ +P +     E   +E    +  ++++   + I+
Sbjct: 99  RLYRYIYEKE----LKVDPSELPLVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIV 154

Query: 481 QESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGD 529
            E L      G S +S ++++GAT  T+  + +GT+L NS++K  + GD
Sbjct: 155 VEPLGIMLSTGKS-SSLVIDVGATGCTVTPIIDGTILRNSIVKSRFAGD 202

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 19/176 (10%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           K++L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN 566
            I  V E  VL +   +LD  G D+TR     L    + F     + T  +    Q+K+ 
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEK 218

Query: 567 --YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
             Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P +
Sbjct: 219 LCYVSY-DLDLDTKL----ARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGL 269

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 83/194 (42%), Gaps = 16/194 (8%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        KV+L  P +    + E +  ++ ++  F  V +  +++ 
Sbjct: 87  LWDYAFY---EQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVGIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFE---DANMTVQLYNFVKRIPGKVSEKYEFKVFD 600
           F     + T  +    Q+K+   Y +++   D  +  +    V++   ++ +    KV  
Sbjct: 203 F-----NKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQY--ELPDGRVIKVGS 255

Query: 601 EVILAPLALFYPDI 614
           E   AP  LF P +
Sbjct: 256 ERFEAPECLFQPSL 269

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 429 YALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACY 488
           Y  + R     +A++    +++V    + +  +E + + + + +Q     ++  SLA+ Y
Sbjct: 91  YDSSSRKPGAFEAELSSIPLLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSY 150

Query: 489 GAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
                   CI++IG T T I  + + T LE    K+ YGG  I
Sbjct: 151 AMSSLQNCCIIDIGTTHTDIIPIIDYTPLEALSSKIAYGGQLI 193

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 19/176 (10%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           K++L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN 566
            I  V E  VL +   +LD  G D+TR     L    + F     + +  +    Q+K+ 
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEK 218

Query: 567 --YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
             Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P++
Sbjct: 219 LCYVSY-DLDLDTKL----ARETTTLVENYELPDGRIIKVGQERFEAPECLFQPNL 269

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 19/176 (10%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           KV+L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN 566
            I  V E  VL +   +LD  G D+TR     L    + F     + T  +    Q+K+ 
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAF-----NKTADFETVRQIKEK 218

Query: 567 --YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
             Y ++ D ++  +L +    +     E YE       KV  E   AP  LF P +
Sbjct: 219 LCYVSY-DLDLDTKLAHETTTL----VETYELPDGRVIKVGSERFEAPECLFQPSL 269

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 19/176 (10%)

Query: 447 KVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQT 506
           K++L  P +    + E +  ++ ++  F  V +  +++ A Y  G+S+   +V+ G   T
Sbjct: 105 KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVVDSGDGVT 163

Query: 507 TIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN 566
            I  V E  VL +   +LD  G D+TR     L    + F     + +  +    Q+K+ 
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEK 218

Query: 567 --YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614
             Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P +
Sbjct: 219 VCYVSY-DLDLDTKL----ARETTTLVENYELPDGRVIKVGQERFEAPECLFQPSL 269

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 22/197 (11%)

Query: 426 LFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLA 485
           L++YA     E +        KV+L  P +    + E +  ++ ++  F    +  +++ 
Sbjct: 87  LWDYAFF---EQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVL 143

Query: 486 ACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFP 545
           A Y  G+S+   +V+ G   T I  V E  VL +   +LD  G D+TR     L    + 
Sbjct: 144 ALYAQGLSSG-VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 546 FQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------K 597
           F     + T  +    Q+K+   Y ++ D ++  +L     R    + E YE       K
Sbjct: 203 F-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL----ARETTTLVESYELPDGRVIK 252

Query: 598 VFDEVILAPLALFYPDI 614
           V  E   AP  LF P +
Sbjct: 253 VGPERFEAPECLFQPSL 269

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 42/100 (42%)

Query: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499
           +AQ+    + L+    + +S  E L + + + M+     IM  SLA  Y  G      ++
Sbjct: 40  EAQVSNIPMFLITHYSWSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVI 99

Query: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFL 539
           +IG   T I  + + T LE        GGD I      FL
Sbjct: 100 DIGGAHTDIIPIVDYTPLEYLAYSAPVGGDAINAKLASFL 139

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           ET+  IL +   F A+ +   ++ + Y  G  T  C++  G   +    V +G  L +S+
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATG-QTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 522 IKLDYGGDDITRLFTLFL 539
            ++D GG DIT+    ++
Sbjct: 187 RRIDIGGRDITQELQFYI 204

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 442 QIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNI 501
           ++     +L+    + + HIE +   + + +Q  +   +  SLA+ Y       SCI++I
Sbjct: 105 ELSNIPFLLISHHSWSQFHIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDI 164

Query: 502 GATQTTIACVDEGTVLENSLIKLDYGG----DDITRLFT 536
           G T T I  V +   +++    + YGG    D ++++ T
Sbjct: 165 GETHTDIVPVIDYLQMDHIASSIKYGGQTINDSLSKILT 203

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 444 QQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGA 503
           ++  V + +P     +     + ++L +++   + ++ E LA     G STA  +V++GA
Sbjct: 90  EELPVCITVPPDLSATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLGRSTA-LVVDVGA 148

Query: 504 TQTTIACVDEGTVLENSLIKLDYGGD 529
           ++ T+  + +G+V++  +++  Y GD
Sbjct: 149 SKVTVTPIVDGSVVKTGILRSRYAGD 174

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 467 ILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDY 526
           +  ++  F AV I   S  + Y +G  T  C+++ G    +   + EG  L +S+ ++D 
Sbjct: 129 VFFEKFDFAAVYIANPSTLSLYASG-RTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDV 187

Query: 527 GGDDIT 532
           GG D+T
Sbjct: 188 GGRDVT 193

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 1/112 (0%)

Query: 435 DESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIST 494
           D+++    + +  +++  P L   ++ + +   L +   F AV I    + + Y +G  T
Sbjct: 99  DDTLYLENLNEHPILITEPPLNNMANRQKMCEALFEIFGFPAVYISVSPVLSLYASG-QT 157

Query: 495 ASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF 546
             C V+ G    T   V  G  L +S+ K+D GG DIT      +L+N   F
Sbjct: 158 TGCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLF 209

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E + ++L +     A+ +   ++ + Y +G  T  C+++ G    +   + +G  L  S+
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASG-RTTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 522 IKLDYGGDDITR 533
           +++D GG DIT+
Sbjct: 184 MRMDIGGRDITK 195

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E + ++L +     A+ I   ++ + Y +G  T  C+V+ G    +   + +G  L  S+
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 522 IKLDYGGDDIT 532
           +++D GG DIT
Sbjct: 184 MRMDIGGRDIT 194

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 134/316 (42%), Gaps = 61/316 (19%)

Query: 467 ILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDY 526
           +LL+ M F+A  +   + A  +  G  T   +V+IG   T+++ V +G  L  S ++   
Sbjct: 127 VLLEGMDFEACYLTPTATAVSFAMGRPTC-LVVDIGHDITSVSPVIDGMTLSKSSMRSFI 185

Query: 527 GGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRI 586
            G  +  L    L     P + L L         E +K+++    D  +   L NFV   
Sbjct: 186 AGGLLNELIRTSLK----PREILPLFQVAK-KRPEFVKRSF----DYEIHPSLLNFV--- 233

Query: 587 PGKVSEKYEFKVFDEVIL--APLAL--FYPDIFQELKK-----------LDSKNKFNLED 631
               +E+  F+ F E +L  AP +L  F  ++ Q  K+            DS+ +FN+ +
Sbjct: 234 ----NERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSETRFNIAE 289

Query: 632 QL------------PVSRDLYTDSI-NDW------RSVSQLQCLDGDLYAGNTNELDIIT 672
           QL            P+S+D   ++  ND+      +  +  +  +G + A    + + +T
Sbjct: 290 QLFRPETAKFPEDWPISKDGVVETWHNDYVPLKRNKPGANSKEKEGTIDATPVPDENSVT 349

Query: 673 KVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSKMNQFYANIMVVG 732
              ++N      +G  + E D  E    +   +   I ++ +S DV        N+++ G
Sbjct: 350 PSEHLND-----QGKRSLEDDTPEAKNEI-SGLADLIHSSIMSTDVDLRTTLAHNVVITG 403

Query: 733 GTSNIPQLDFVLTDRI 748
           G+S+IP     LTDRI
Sbjct: 404 GSSSIPG----LTDRI 415

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (52%), Gaps = 12/99 (12%)

Query: 439 TQAQIQQCKVILVI--------PDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGA 490
           TQ ++   ++ LVI        PD+   S +E  Y +   +++     I+ E LA     
Sbjct: 93  TQLKVSPEELPLVITMPATNGKPDM---SILERYYELAFDKLKVPVFQIVIEPLAIALSM 149

Query: 491 GISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGD 529
           G S+A  ++++GA+   +  + +G V++N++++  +GGD
Sbjct: 150 GKSSA-FVIDMGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 96/239 (40%), Gaps = 25/239 (10%)

Query: 390 NKENFIIRYPFNKGGSLNXXXXXXXXXXXXXXXVTRLFEYALTKRDESITQAQIQQCKVI 449
           NKE +I    + +  +L+               +  L++Y L  + E     Q+Q+  V+
Sbjct: 54  NKETYIGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEI---EQLQEHPVV 110

Query: 450 LVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIA 509
           L       K   E +  +L ++    A+   ++ + + YG G  T  C V+ G     I 
Sbjct: 111 LTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLG-RTTGCSVSCGHRGIGIT 169

Query: 510 CVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYAT 569
            V +G ++  S    + GG  +T    L LL +N P  +   +  +G  L   +K+    
Sbjct: 170 TVIDGMIVGGSSQISNTGGSAVTNTM-LDLLRHNHPKLE---NGQNGIELIRSIKERCCV 225

Query: 570 F-EDANMTVQLYNFVK--------RIP-GKV----SEKYEFKVFDEVILAPLALFYPDI 614
             +D    ++ Y  +         R+P G +    SE++E     E+I  P A  Y +I
Sbjct: 226 LSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIGSERFEAP---EIIFNPQAYGYSEI 281

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 461 IETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENS 520
           ++  + +  +      + I+ E LA     G S +S +VN+GA+   +  + +GTV++++
Sbjct: 124 LKKYFELAFETFNVPVLQIIIEPLAVALSLGKS-SSLVVNLGASGCNVTPIVDGTVIKHA 182

Query: 521 LIKLDYGGD 529
           ++K  YGGD
Sbjct: 183 VMKSKYGGD 191

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 38.1 bits (87), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E + +++ +     A+ +   ++ + Y +G  T  C+V+ G    +   + +G  L  S+
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASG-RTTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 522 IKLDYGGDDIT 532
           +++D GG DIT
Sbjct: 184 MRMDIGGGDIT 194

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 38.1 bits (87), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 453 PDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVD 512
           PD+   + +E  Y +   ++      I+ E LA     G S+A  +++IGA+   +  + 
Sbjct: 115 PDM---AILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSA-FVIDIGASGCNVTPII 170

Query: 513 EGTVLENSLIKLDYGGD 529
           +G V++N++++  +GGD
Sbjct: 171 DGIVVKNAVVRSKFGGD 187

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 442 QIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNI 501
            I++  +++    L    + E +  IL +     A+ +   ++ A Y  G  T  C+++ 
Sbjct: 101 HIEEHPILITEAPLNSSKNREHMCEILFESFNIPAIHVENPAVLALYSGG-RTTGCVIDC 159

Query: 502 GATQTTIACVDEGTVLENSLIKLDYGGDDIT 532
           G    +   + EG  L  S+ ++D GG +IT
Sbjct: 160 GEGYCSAVPIYEGFALTPSIRRIDIGGREIT 190

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E + ++L +     A+ +   ++ + Y +G  T  C+V+ G    +   + +G  L  S+
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 522 IKLDYGGDDIT 532
           +++D GG DIT
Sbjct: 184 MRMDIGGADIT 194

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 433 KRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGI 492
           K D      ++    ++L+    +    IE + + + + ++  +  ++  SLAA +    
Sbjct: 104 KNDPDAFDRELSNVPLLLISHYKWSAQQIEKINQHVFEILKLNSFLMLPTSLAATHAMAA 163

Query: 493 STASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDI-TRLFTLFLLENNFPFQDLDL 551
              S +++IG T T I  + + + L +    +  GG+DI T L ++    ++   +DL L
Sbjct: 164 LQNSIVIDIGKTHTDILPIVDYSQLTHFSSTIPIGGNDINTHLKSILPSLSDDQIEDLKL 223

Query: 552 DSTHGWTLAEQLKKNYATFEDAN 574
            + +   L  + KKNYA    A+
Sbjct: 224 SNIYE-VLNAEAKKNYADLHQAD 245

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 448 VILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTT 507
           VI V PDL   +  + L  + L++++     ++ E LA     G +T S +V+IGA++ T
Sbjct: 94  VITVPPDLSAGTRSKYL-ELALEKLKVPVFQMVVEPLAISLSLGRNT-SLVVDIGASKIT 151

Query: 508 IACVDEGTVLENSLIKLDYGGD 529
           +  + +G+V++ ++++  + GD
Sbjct: 152 VTPIIDGSVVKPAVLRSKFAGD 173

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 461 IETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENS 520
           +E  Y +   +++     I+ E LA     G S+A  ++++GA+   +  + +G V++N+
Sbjct: 120 LERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSA-FVIDMGASGCNVTPIIDGIVVKNA 178

Query: 521 LIKLDYGGD 529
           +++  +GGD
Sbjct: 179 VVRSKFGGD 187

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 458 KSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVL 517
           K + E +   L +     A+ I   ++ + Y +G  T  C+V  G    +   + EG  L
Sbjct: 120 KPNREKMCETLFESFNIPALYIANPAVLSLYASG-RTTGCVVEAGDGYCSSVPIYEGFAL 178

Query: 518 ENSLIKLDYGGDDITRLFTLFL 539
             S+ ++D GG DIT+   L L
Sbjct: 179 TPSIRRIDIGGRDITKHLQLQL 200

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 42/91 (46%)

Query: 441 AQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVN 500
           A++    V +V    + +  +E++ + L + ++     ++  +L++ Y  G     C+++
Sbjct: 104 AELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVID 163

Query: 501 IGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
           IG   T I  V +   L      + YGG+ I
Sbjct: 164 IGTAHTDIIPVVDYAPLVPLTSTIPYGGNTI 194

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 448 VILVIPDL---FEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGAT 504
           +++ IP +    +   +E  + ++ +  +F    I+ E LA     G S+   ++++G++
Sbjct: 108 LVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLGKSSG-LVIDMGSS 166

Query: 505 QTTIACVDEGTVLENSLIKLDYGG 528
              +  + +GTV++N+++   YGG
Sbjct: 167 GCRVTPIIDGTVIKNAVLSSKYGG 190

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 448 VILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTT 507
           V  V PDL +    + L  + L  ++     ++ E LA     G +TA  +V++GA ++T
Sbjct: 91  VATVAPDLPDAVRAQYL-EMALGRLKIPVFQLVVEPLAVALSLGRNTA-LVVDVGAAKST 148

Query: 508 IACVDEGTVLENSLIKLDYGGD 529
           +  + +GTV++ ++ +  + GD
Sbjct: 149 VTPIIDGTVVQTAVARSKFAGD 170

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 452 IPDLFEKSH------IETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQ 505
           IP L   +H      +E++   + ++++   + ++  SL A Y        CI++IG   
Sbjct: 108 IPLLLLNNHKWSQFQMESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNH 167

Query: 506 TTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENN 543
           T I  + + T + +    L+YGG  I  +    L E N
Sbjct: 168 TDIVPIVDYTTINHLSNTLNYGGSYINTILQKLLPELN 205

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 45/92 (48%)

Query: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499
           +A++    ++L+    + +S +ET+ + + + ++   +  +  SLAA Y        CI+
Sbjct: 103 EAELSNIPLLLITHHSWSQSDLETITQYIFESLEINNLIQLPASLAATYSMISLQNCCII 162

Query: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
           ++G   T I  + +   L++ +  L  GG  I
Sbjct: 163 DVGTYHTDIIPIVDYAQLDHLVSSLPVGGQSI 194

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 14/78 (17%)

Query: 455 LFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEG 514
           LFE  +I +LY             +   S+ + Y +G +T  C+V+ G    +   + EG
Sbjct: 130 LFETFNIPSLY-------------VANPSVLSLYASG-NTTGCVVDCGDGYCSSTPIYEG 175

Query: 515 TVLENSLIKLDYGGDDIT 532
            VL  S+ K++ GG DIT
Sbjct: 176 FVLPASIRKMEVGGRDIT 193

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 12/99 (12%)

Query: 439 TQAQIQQCKVILVI--------PDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGA 490
           TQ ++   ++ LVI        PD+   S +   Y +   ++      I+ E LA     
Sbjct: 93  TQLKVSPNELPLVITMPATNGKPDM---SILRRYYELAFDKLNVPVFQIVIEPLAIALSM 149

Query: 491 GISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGD 529
           G S+A  ++++GA+   +  + +G V++N++++  +GGD
Sbjct: 150 GKSSA-FVIDMGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 131/317 (41%), Gaps = 48/317 (15%)

Query: 467 ILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDY 526
           ILL+ M+F+A  +   S A  +  G    S IV+IG    ++  V +G  L  S     +
Sbjct: 139 ILLEGMEFEACYLTATSTAVSFATG-RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHF 197

Query: 527 GGDDITRLFT----------LFLLENNFP-FQDLDLDSTHGWTLAEQLKKNYAT----FE 571
            G  + +L T          LF +E   P F+      +  +++A+ L  +YA     F+
Sbjct: 198 AGRFLNKLLTDYLKPREIIPLFEVEQRKPEFKR----RSFSYSVADSLY-DYANSRGFFQ 252

Query: 572 DANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFNLED 631
           +   T+     V   P    +  +       I +P        + E+ + +S +++   +
Sbjct: 253 ECKETIFQ---VATTPIAQEKNNQATSTGRTIESP--------WNEVIEFESNDRYQFAE 301

Query: 632 QL--PVSRDLYTD-------SINDWRSVSQLQCLDGDLYAGNTNELDII--TKVLNINSS 680
           QL  P+   +  D        +  WR+   +      + +GN  E +    +  L+ N++
Sbjct: 302 QLINPLKESVPDDWPVNVAGVVETWRN-DYVPMKRNKVGSGNNKEKEGTKESTPLDSNTA 360

Query: 681 TEEYEGLETTEVDGRENYVPLEK----AIIQSITNACVSMDVSKMNQFYANIMVVGGTSN 736
           T   E   TT  +G+     +++     I+  I+++  S DV        N+++ GG+S 
Sbjct: 361 TPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISSCDVDIRASLAHNLVITGGSST 420

Query: 737 IPQLDFVLTDRINIWRP 753
           IP L   + + +N+  P
Sbjct: 421 IPGLSDRILNELNMKFP 437

>AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR106W
           (ARP10)
          Length = 305

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 444 QQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGA 503
           Q+ K++++   L +    + L ++LL  ++  +V  + + L AC  AG+S A  +V++G 
Sbjct: 58  QRLKIVVLENILLDIPRKKRLCQVLLNRLRVNSVVFLPDVLMACVSAGVSNA-LVVDVGW 116

Query: 504 TQTTIACVDEGTVLE 518
            QT +  V +  +L+
Sbjct: 117 EQTAVVPVVDMRILD 131

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 451 VIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIAC 510
           ++ D      +E  + +   +     + ++ E LA     G S+A  +V++G++   +  
Sbjct: 107 IMKDAVALRVMERYFDLAFNKFNVPVLQVIIEPLAIALSMGKSSA-LVVDLGSSSCNVTP 165

Query: 511 VDEGTVLENSLIKLDYGGD 529
           V +GTV +NS++K  Y GD
Sbjct: 166 VIDGTVAKNSVLKSKYAGD 184

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 458 KSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVL 517
           +S+ E +  +  +     A+ +    + + Y +G  T  C+V+ G    +   V EG  L
Sbjct: 118 ESNKEKMLEVFFETFNIPAICVSIPGVLSLYASG-RTTGCVVDCGEGYCSSVPVCEGYTL 176

Query: 518 ENSLIKLDYGGDDITR 533
            +S+ +++ GG D+T+
Sbjct: 177 ASSIKRINLGGIDVTK 192

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 448 VILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTT 507
           V  V PDL   +    L  + L  ++     ++ E LA     G +TA  IV++GA + T
Sbjct: 47  VATVAPDLPAAARARYL-EMALGRLKIPVFQLVVEPLAVALSLGRNTA-LIVDLGAAKAT 104

Query: 508 IACVDEGTVLENSLIKLDYGGD 529
           +  V +GTV++ ++ +  + GD
Sbjct: 105 VTPVIDGTVVQAAIGRSRFAGD 126

>KLLA0F03036g Chr6 complement(283504..284439) [936 bp, 311 aa] {ON}
           highly similar to uniprot|P15703 Saccharomyces
           cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
           protein of the cell wall involved in cell wall
           maintenance
          Length = 311

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 727 NIMVVGGTSN-IPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST 783
           N++V GG++  I   DFV+ +  + W+ + + N ++  FF +I + ++ IQ T+K ST
Sbjct: 167 NVLVDGGSATAIQAADFVMANAFSYWQGQTMDNASYS-FFDDIMQALQTIQ-TTKGST 222

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 456 FEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGT 515
            EK   E  Y++  ++ +   + ++   LA  +  G  +A  +V+IGA    +  + +GT
Sbjct: 132 LEKQIKEEYYKLAFEKFRIPILYLIPSPLAIAFSLGKKSA-LVVDIGAKTCQVTPILDGT 190

Query: 516 VLENSLIKLDYGGD 529
           +++++++K  + GD
Sbjct: 191 IIKDAVMKSKFAGD 204

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E +  +L +     A+ +  +++ + Y +G  T  C+V+ G        V +G  + +S+
Sbjct: 148 EKMCELLFESFNVPALYVSVQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSVPSSI 206

Query: 522 IKLDYGGDDITRLFTLFL 539
            ++D  G DIT    L L
Sbjct: 207 RRIDIAGRDITEFLQLLL 224

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E + + + +EM+     ++  +L+  Y  G      +++IGAT T I  + +   L+   
Sbjct: 118 ELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGATHTDIVPIVDYVPLDYMA 177

Query: 522 IKLDYGGDDI-TRLFTLF 538
                GGDDI  +L TL 
Sbjct: 178 YSAPIGGDDINAKLATLL 195

>Skud_12.351 Chr12 (622291..623343) [1053 bp, 350 aa] {ON} YLR270W
           (REAL)
          Length = 350

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 21/77 (27%)

Query: 321 VGMKAQLQQSF---RERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNS 377
           + +K   QQSF   RE    YKR +QP                 +E+  ++GR++W+NN 
Sbjct: 122 IHIKKYEQQSFHLVRETPEMYKRIVQP----------------YIEEMCNNGRLKWVNNI 165

Query: 378 DKIYFGEEAERCNKENF 394
             +Y G E+ER   ++F
Sbjct: 166 --LYEGAESERVVYKDF 180

>NCAS0E04170 Chr5 complement(823119..824063) [945 bp, 314 aa] {ON}
           Anc_5.8 YGR282C
          Length = 314

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 7/60 (11%)

Query: 727 NIMVVGGTSNIPQL---DFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST 783
           N++V G   N P +   DFV+ +  + W+ + + N+++  FF +I + ++ IQST K ST
Sbjct: 169 NVLVAG--YNAPAIQASDFVMANAFSYWQGQTMANSSY-SFFDDIMQALQTIQST-KGST 224

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/98 (17%), Positives = 47/98 (47%)

Query: 434 RDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIS 493
           +++   +A++    ++L+    + +S +E + + + + ++   +  +  SLAA Y     
Sbjct: 97  KNQDAFEAELSNIPLLLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISL 156

Query: 494 TASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
              CI+++G   T +  + +   L++ +  +  GG  I
Sbjct: 157 QNCCIIDVGTYHTDVIPIVDYAQLDHLVSSIPMGGQSI 194

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 435 DESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIST 494
           ++ +  + +Q   V++    L  K + E +  +L +     AV +  +++ + Y +G  T
Sbjct: 96  EKGLQLSSLQDHPVLVTEAPLNPKKNREQMCELLFETFSVPAVYVSIQAVLSLYASG-RT 154

Query: 495 ASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFL 539
             C+++ G   +    V +G  L +++ ++D  G DI+ L  + +
Sbjct: 155 TGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLI 199

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 467 ILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDY 526
           +L +    QA+ +   ++ + Y +G   + C+++ G   +    V +G  L++++ ++D 
Sbjct: 127 LLFESFGVQALYVANPAVLSLYASG-KISGCVLDCGDGYSCSVPVYQGYTLKSAIKRIDL 185

Query: 527 GGDDITRLFTLFL 539
           GG D+T    L L
Sbjct: 186 GGRDLTEQLQLQL 198

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E +  +L +     AV +  +++ + Y +G  T  C+++ G        V +G  L +S+
Sbjct: 122 EAMCEMLFETFNVPAVYVSIQAVLSLYASG-RTTGCVLDCGDGCCHSVPVFDGFSLPSSI 180

Query: 522 IKLDYGGDDITRLFTLFL 539
            ++D  G D+T    L L
Sbjct: 181 RRIDVAGRDVTEFLQLLL 198

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 462 ETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           E +  +L +     A+ +  +++ + Y +G  T  C+V+ G        V +G  + +S+
Sbjct: 120 ERMCELLFESFNVPALYVSIQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSIPSSI 178

Query: 522 IKLDYGGDDITRLFTLFL 539
            ++D  G DIT    L L
Sbjct: 179 RRIDIAGRDITEFLQLLL 196

>Suva_7.579 Chr7 complement(1012777..1013718) [942 bp, 313 aa] {ON}
           YGR282C (REAL)
          Length = 313

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 727 NIMVVGGTSNIPQL-DFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST 783
           N++V G  S + +  DFV+ +  + W+ + + N ++  FF +I + ++ IQST K ST
Sbjct: 170 NVLVAGYNSGVIEASDFVMANAFSYWQGQTMQNASYS-FFDDIMQALQTIQST-KGST 225

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 315 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 360

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 331 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 376

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 824 VLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCL 873
           + PP R  +     W G S+LA +   ++++++  ++D  G  I+ +KC 
Sbjct: 331 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 376

>TBLA0C07120 Chr3 complement(1730198..1731136) [939 bp, 312 aa] {ON}
           Anc_5.8 YGR282C
          Length = 312

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 9/86 (10%)

Query: 701 LEKAIIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQL---DFVLTDRINIWRPKALC 757
           L K I  S  N+  S  V  ++ +  N++V G   N P +   DFV+ +  + W+ + + 
Sbjct: 144 LVKTINDSDGNSYGSKQVGTVDSW--NVLVAG--YNAPAIQASDFVMANAFSYWQGQTMQ 199

Query: 758 NTTFPHFFKNISKQVKEIQSTSKAST 783
           N+++  FF +I + ++ IQST K ST
Sbjct: 200 NSSYS-FFDDIMQALQTIQST-KGST 223

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 436 ESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQF-----QAVAIMQESLAACYGA 490
           ES+ Q    +  +++ +P  F K     L  +   +M F       V  + E LA     
Sbjct: 89  ESVLQCTANEVPLVVTMP-AFSKPERARLVMMRYMDMAFYRFNVPVVQFVIEPLAIALSM 147

Query: 491 GISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGG 528
           G S+A  +++IG    T+  V +G V+    ++  YGG
Sbjct: 148 GKSSA-LVIDIGTNGCTVTPVYDGVVVRTGCVRSKYGG 184

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 469 LKEMQFQ-----AVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIK 523
           + EM F+     AV +  +++ A Y AG  T  C+++ G        V +G  L +++ +
Sbjct: 125 MCEMLFETFGSPAVYVSIQAVLALY-AGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQR 183

Query: 524 LDYGGDDITRLFTLFL 539
           +D  G DIT    L L
Sbjct: 184 IDVAGRDITEFLQLLL 199

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/98 (18%), Positives = 47/98 (47%)

Query: 434 RDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIS 493
           +++   +A++    ++L+    + +S +E + + + + ++   +  +  SLAA Y     
Sbjct: 97  KNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISL 156

Query: 494 TASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
              CI+++G   T I  + +   L++ +  +  GG  I
Sbjct: 157 QNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSI 194

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/98 (18%), Positives = 47/98 (47%)

Query: 434 RDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGIS 493
           +++   +A++    ++L+    + +S +E + + + + ++   +  +  SLAA Y     
Sbjct: 97  KNQDAFEAELSNIPLLLITHHSWSQSDLERITQYVFESLEINNLIQLPASLAATYSMISL 156

Query: 494 TASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDI 531
              CI+++G   T I  + +   L++ +  +  GG  I
Sbjct: 157 QNCCIIDVGTYHTDIIPIVDYAQLDHLVSSIPIGGQSI 194

>YLR270W Chr12 (681186..682238) [1053 bp, 350 aa] {ON}
           DCS1Non-essential hydrolase involved in mRNA decapping;
           activates Xrn1p; may function in a feedback mechanism to
           regulate deadenylation, contains pyrophosphatase
           activity and a HIT (histidine triad) motif; interacts
           with neutral trehalase Nth1p; required for growth on
           glycerol medium
          Length = 350

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 21/77 (27%)

Query: 321 VGMKAQLQQSF---RERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNS 377
           + +K   QQ+F   RE    YKR +QP                 +E+  ++GR++W+NN 
Sbjct: 122 IHIKKYEQQNFHLVRETPEMYKRIVQP----------------YIEEMCNNGRLKWVNNI 165

Query: 378 DKIYFGEEAERCNKENF 394
             +Y G E+ER   ++F
Sbjct: 166 --LYEGAESERVVYKDF 180

>Suva_10.367 Chr10 (642604..643656) [1053 bp, 350 aa] {ON} YLR270W
           (REAL)
          Length = 350

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 21/77 (27%)

Query: 321 VGMKAQLQQSF---RERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNS 377
           + +K   QQ+F   RE    YKR +QP                 +E+  ++GR++W+NN 
Sbjct: 122 IHIKKYEQQNFHLVRETPEMYKRIVQP----------------YIEEMCNNGRLKWVNNI 165

Query: 378 DKIYFGEEAERCNKENF 394
             +Y G E+ER   ++F
Sbjct: 166 --LYEGAESERVVYKDF 180

>Smik_12.345 Chr12 (619425..620477) [1053 bp, 350 aa] {ON} YLR270W
           (REAL)
          Length = 350

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 21/77 (27%)

Query: 321 VGMKAQLQQSF---RERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINNS 377
           + +K   QQ+F   RE    YKR +QP                 +E+  ++GR++W+NN 
Sbjct: 122 IHIKKYEQQNFHLVRETPEMYKRIVQP----------------YIEEMCNNGRLKWVNNI 165

Query: 378 DKIYFGEEAERCNKENF 394
             +Y G E+ER   ++F
Sbjct: 166 --LYEGAESERVVYKDF 180

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 461 IETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENS 520
           +   + +  ++++   + I+ E LA       S+A  +++IGA +  I  V +GTV+++ 
Sbjct: 119 VHKYFELAFEKLRVPTLQIVVEPLAIALSMSKSSA-LVIDIGARECKITPVIDGTVVKSG 177

Query: 521 LIKLDYGGD 529
           ++K  + GD
Sbjct: 178 VMKSKFAGD 186

>KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {ON}
           Anc_7.266 YER077C
          Length = 626

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 551 LDSTHGWTLA-EQLKK-------NYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEV 602
           L S H   L  E  KK       N +T E   + ++L+NF+ R  G+ S +++FK++   
Sbjct: 429 LKSAHTLVLCYEAFKKQSLKSRINSSTIETEKLLIELHNFIIRTEGQQSTQFDFKIY--- 485

Query: 603 ILAPLALFYPDIFQELKKLDSKN 625
              P+   +  +F+ LK LD  N
Sbjct: 486 ---PMK-SWKYVFRILKNLDVDN 504

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 464 LYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSL 521
           L  +LL  +   +V  + + L AC   G++ A  +V+IG   T +A + +  +LE  +
Sbjct: 78  LCHVLLDRLMVSSVVFLPDILMACVAGGVTDA-IVVDIGWENTVVAPIMDMRILEQHM 134

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 179 SHLQQTGLFGQMLLVNQKNCSSDY-LKKDDQVFALRERKTLRNNTTVSTTANTPDVVDL- 236
           +H +    F +M+LV      SD+  +KD   F    +   + +    T  + P  V L 
Sbjct: 42  AHRRMAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLP 101

Query: 237 --KALNNGSSASLVDEVLNKNDDDIDFN 262
             K +  GS+ + +D +LN  +DD+  N
Sbjct: 102 RLKGITTGSTPNFLDAILNVAEDDVSSN 129

>Kpol_1060.6 s1060 (11822..12766) [945 bp, 314 aa] {ON}
           (11822..12766) [945 nt, 315 aa]
          Length = 314

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 687 LETTEVDGRENYV-PLEKAIIQSITNACVSMDVSKMNQFYANIMVVG-GTSNIPQLDFVL 744
           L  +E+  R N +  L K I  S  N+  S  V  ++ +  N++V G  T  I   DFV+
Sbjct: 129 LTPSELASRINEIRDLVKNINDSQGNSYSSKQVGTVDSW--NVLVDGYSTPAITASDFVM 186

Query: 745 TDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST 783
            +  + W+ + + N+++  FF +I + ++ IQ T+K ST
Sbjct: 187 ANAFSYWQGQTMQNSSY-SFFDDIMQALQVIQ-TAKGST 223

>NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 717 DVSKMNQFYANIMVVGGTSNIPQLDFVLTDRI 748
           D+SK+   + NI+++GGTS+I      LT R+
Sbjct: 327 DISKLRTMWENIVIIGGTSSIQGFKEALTSRL 358

>KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {ON}
           Anc_8.704 YPL174C
          Length = 844

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 508 IACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNY 567
           ++ + +  +LE+S+ KL+   DD+ + +   +LEN+      DL ST    LAEQL K+Y
Sbjct: 181 VSSLKKIKLLESSVNKLERLLDDLLKQYEEVVLENS------DL-STKNLNLAEQLDKSY 233

Query: 568 ATFEDANMTV 577
              E+   T+
Sbjct: 234 KELEETKRTI 243

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,264,507
Number of extensions: 4270288
Number of successful extensions: 14790
Number of sequences better than 10.0: 164
Number of HSP's gapped: 15219
Number of HSP's successfully gapped: 166
Length of query: 876
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 758
Effective length of database: 39,950,811
Effective search space: 30282714738
Effective search space used: 30282714738
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)