Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_541.168.843ON52852826350.0
YML116W (ATR1)8.843ON54252415920.0
TBLA0D032708.843ON55052515700.0
Smik_13.188.843ON54550915690.0
Skud_13.258.843ON53749915680.0
TDEL0B005508.843ON53749015450.0
Suva_13.278.843ON55348815420.0
TPHA0C047908.843ON55651915420.0
NDAI0E002808.843ON54952915380.0
CAGL0B02343g8.843ON53751315230.0
KLTH0C03806g8.843ON52550715210.0
NDAI0K004008.843ON55350915230.0
SAKL0D01386g8.843ON52150515180.0
TBLA0D03280singletonON58050015140.0
NCAS0B002908.843ON54250615070.0
CAGL0M03003g8.843ON55852215030.0
Kwal_27.102458.843ON51547914920.0
KNAG0J002608.843ON55051314860.0
Suva_13.4678.843ON54351714840.0
Smik_13.4928.843ON54351914780.0
NCAS0A02540singletonON53950314750.0
NCAS0C004008.843ON51748614710.0
YMR279C8.843ON54052514610.0
Skud_13.4518.843ON53949414600.0
KAFR0B03930singletonON55550614370.0
KNAG0G034308.843ON54252714350.0
KAFR0B039408.843ON54751214120.0
KAFR0A028408.843ON52050413860.0
TBLA0C01160singletonON60052413051e-174
TDEL0G04950singletonON5125179191e-117
Smik_15.560na 1ON5165109181e-117
YOR378Wna 1ON5154758941e-114
Skud_15.545na 1ON5164758911e-113
Suva_8.435na 1ON5155288901e-113
KLTH0C10560gna 1ON5154748741e-111
Kwal_23.6547na 1ON5114898471e-107
KLLA0B00352gna 1ON4984888431e-106
KNAG0D00130na 1ON5655115622e-64
KAFR0C04860na 1ON5345305593e-64
NCAS0A05720na 1ON5635445263e-59
CAGL0L02519gna 1ON5295105079e-57
NDAI0K02730singletonON6045554574e-49
SAKL0C06116gsingletonON1851904101e-46
Suva_10.11singletonON5404882019e-16
Smik_6.24na 2ON5445152001e-15
KLLA0C18931gna 3ON5535171992e-15
SAKL0F00440gsingletonON5445181955e-15
Skud_6.16na 2ON5494861893e-14
TDEL0F039908.272ON6313951752e-12
ZYRO0C01430g8.272ON5905001698e-12
Kpol_543.448.272ON6434041662e-11
AGR076C8.272ON6864011662e-11
Kwal_34.15746na 3ON5184871643e-11
SAKL0H16808g8.272ON6574701502e-09
TDEL0D06610singletonON4974401464e-09
TBLA0F030408.272ON9063911431e-08
KLTH0H16214gsingletonON5515241393e-08
ZYRO0A00330gsingletonON5763811393e-08
KLLA0A04631g8.272ON5793531384e-08
YPR198W (SGE1)singletonON5431861351e-07
TDEL0A024902.473ON5542261341e-07
Kwal_56.237548.272ON5894471341e-07
Smik_11.368singletonON5804441313e-07
KLLA0D19941gsingletonON6113491313e-07
Skud_16.503singletonON5431911295e-07
KLTH0C10120gsingletonON6512091296e-07
KLLA0F13684g2.473ON5713371261e-06
YKR105C (VBA5)singletonON5824391261e-06
TDEL0G03260singletonON6122241261e-06
KLTH0C10142gsingletonON5731321252e-06
Kpol_467.242.473ON3702281232e-06
Skud_18.3singletonON5904371242e-06
Smik_17.11singletonON5441741224e-06
Smik_13.2722.473ON5611611224e-06
NCAS0G029902.242ON5812331215e-06
NDAI0D010202.242ON5922041215e-06
KLTH0G13464g8.272ON5934501215e-06
Skud_13.2442.473ON5621771171e-05
SAKL0E02992g2.473ON5701241171e-05
KLTH0G09372g2.242ON5512461162e-05
Smik_2.434na 4ON4743851152e-05
YMR088C (VBA1)2.473ON5621771153e-05
NCAS0A078102.473ON5681881153e-05
NCAS0C03460na 5ON6302391153e-05
TPHA0A017508.272ON6364671153e-05
Ecym_73992.473ON5632151143e-05
Ecym_42988.272ON6783821144e-05
KAFR0J009302.242ON5662391135e-05
SAKL0A08228gsingletonON5691641135e-05
Kwal_26.6669singletonON5904461135e-05
Smik_16.81na 5ON6251711135e-05
KLTH0D16962gsingletonON5711321118e-05
Skud_2.423na 4ON5604631101e-04
Suva_13.2652.473ON5611601101e-04
CAGL0B02079gna 5ON6241781101e-04
YBR293W (VBA2)na 4ON4743611091e-04
Kwal_23.48242.242ON5532001091e-04
Skud_7.560na 5ON6422221082e-04
SAKL0E08756g2.242ON5651441054e-04
NDAI0H022002.473ON5711791045e-04
KLTH0B00132gsingletonON5681981037e-04
Kpol_513.33singletonON6263471037e-04
YGR224W (AZR1)na 5ON6131711020.001
TDEL0C00120singletonON5693801010.001
SAKL0B12716gsingletonON6321291010.001
ZYRO0E10230gsingletonON5581831000.002
Suva_4.553na 4ON5624671000.002
CAGL0J01375g2.473ON5641601000.002
KLTH0B10054gsingletonON503117990.002
KLTH0E00462gsingletonON503117990.002
KLLA0F03311g2.242ON542234980.003
ZYRO0G03234g2.473ON562300980.003
KNAG0E025602.473ON578103970.004
TPHA0G031502.473ON600159970.004
NDAI0B037702.242ON571224960.005
TBLA0G025502.242ON613145960.005
Kwal_27.12832singletonON508117940.008
Smik_18.10singletonON531114940.008
SAKL0E04246gna 6ON565267940.009
KLTH0D05434g2.473ON576236940.009
KLLA0F17776gna 6ON553446930.011
NCAS0H012306.155ON489145920.014
KLTH0G19668gsingletonON508113920.014
Kwal_26.9616singletonON562465920.015
Kwal_14.782na 7ON491116900.025
Kwal_14.728singletonON568196900.026
SAKL0F00198gsingletonON537129890.034
SAKL0C02178gsingletonON565233870.060
NDAI0D016805.284ON516188850.10
Kwal_26.77552.473ON559353850.10
TDEL0G04740singletonON601177840.14
Smik_8.1175.284ON514249830.17
SAKL0C12122gna 8ON611401830.18
SAKL0D04510gna 9ON53156820.23
TDEL0A03210singletonON584154810.31
TBLA0B00840singletonON63760810.32
ZYRO0G00352gsingletonON494116790.52
KNAG0J02980singletonON636501790.56
Skud_8.1075.284ON522176780.70
Skud_18.6singletonON610339780.73
Kpol_1051.155.284ON501185770.91
TBLA0F016207.33ON61559770.96
Smik_11.370singletonON44050761.1
KAFR0C00100singletonON473165761.2
TBLA0D030001.155ON51692761.2
TBLA0A03500singletonON57360761.2
TBLA0A033905.394ON57497761.2
TBLA0A03470singletonON57860761.2
KLTH0D00506gsingletonON616399761.3
TPHA0B037705.284ON520180751.6
Skud_15.4748.783ON522206751.6
NCAS0E03210singletonON559125751.6
Suva_4.2singletonON570139751.6
KAFR0J013202.295ON47994742.1
KNAG0B049005.284ON516187742.1
Suva_10.14na 10ON531117742.1
TBLA0A03460singletonON56860742.1
Kwal_55.215385.408ON294113732.2
ZYRO0G07414gsingletonON70798742.2
YHR048W (YHK8)5.284ON514216732.8
Skud_3.172na 11ON521163732.8
NCAS0A065805.284ON528181732.8
TBLA0E01970singletonON57869732.8
SAKL0D04070g3.245ON667155732.9
CAGL0J11022g5.329ON21976713.2
AFR333WsingletonON500130723.6
TBLA0A01250singletonON50397723.6
Smik_12.5na 10ON531133723.7
SAKL0G10758g5.284ON533159723.7
ZYRO0G15422gsingletonON542130723.7
SAKL0G19844gsingletonON57269723.7
AER339C8.723ON573202723.7
NDAI0K03000na 12ON592125723.8
YAL067C (SEO1)singletonON593127723.8
TPHA0G014308.723ON637226723.8
NCAS0A145207.411ON67040723.9
AAR192Cna 9ON500113714.8
YOR306C (MCH5)8.783ON521203714.8
SAKL0B02112gna 13ON527127714.8
YFL011W (HXT10)na 14ON54699714.9
AEL057C1.451ON557148714.9
TBLA0A01240singletonON56997714.9
TBLA0A035105.396ON570171714.9
ZYRO0D13310gsingletonON616172715.0
Smik_15.4558.723ON659183715.1
KNAG0I009908.303ON153582715.6
TBLA0C022503.441ON175165715.6
ADL095Wna 15ON495131706.3
Smik_6.68na 14ON54699706.4
TBLA0A03700singletonON57260706.5
SAKL0E06864gna 16ON573149706.5
NDAI0D05020singletonON57396706.5
NDAI0E038007.44ON62167706.6
Suva_4.2723.242ON27835696.6
YNL327W (EGT2)3.11ON1041107707.1
KLLA0B01177g5.551ON414168697.8
Kwal_56.24191singletonOFF9442647.9
Suva_15.2365.284ON514176698.3
Smik_15.4888.783ON522182698.3
YLL055W (YCT1)na 10ON531133698.4
AGL026Wna 13ON546127698.4
TBLA0A03430singletonON56460698.5
Smik_8.1705.394ON57596698.5
Suva_15.2875.394ON576109698.5
Skud_8.1535.394ON57676698.5
YHR092C (HXT4)5.394ON57696698.5
CAGL0I03872g7.309ON762101699.0
YDR022C (CIS1)3.250ON196117679.1
AGR202W8.562ON227227699.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kpol_541.16
         (1587 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...  1019   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   617   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   609   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   608   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   608   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   599   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   598   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   598   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      597   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   591   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   590   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               591   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   589   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   587   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      585   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   583   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   579   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   577   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   576   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   573   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   572   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      571   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   567   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   566   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   558   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   557   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   548   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   538   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   507   e-174
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   358   e-117
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   358   e-117
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   348   e-114
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   347   e-113
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   347   e-113
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   341   e-111
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   330   e-107
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   329   e-106
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   221   2e-64
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     219   3e-64
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            207   3e-59
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   199   9e-57
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   180   4e-49
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   162   1e-46
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    82   9e-16
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    82   1e-15
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    81   2e-15
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    80   5e-15
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    77   3e-14
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    72   2e-12
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    70   8e-12
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    69   2e-11
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    69   2e-11
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    68   3e-11
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    62   2e-09
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    61   4e-09
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    60   1e-08
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    58   3e-08
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    58   3e-08
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    58   4e-08
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    57   1e-07
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    56   1e-07
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    56   1e-07
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    55   3e-07
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    55   3e-07
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    54   5e-07
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    54   6e-07
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    53   1e-06
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    53   1e-06
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               53   1e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    53   2e-06
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    52   2e-06
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    52   2e-06
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    52   4e-06
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    52   4e-06
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    51   5e-06
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    51   5e-06
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    51   5e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    50   1e-05
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    50   1e-05
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    49   2e-05
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    49   2e-05
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    49   3e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    49   3e-05
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    49   3e-05
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    49   3e-05
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    49   3e-05
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    49   4e-05
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    48   5e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    48   5e-05
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    48   5e-05
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    48   5e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    47   8e-05
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    47   1e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    47   1e-04
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    47   1e-04
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    47   1e-04
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    47   1e-04
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    46   2e-04
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    45   4e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    45   5e-04
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    44   7e-04
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    44   7e-04
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    44   0.001
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         44   0.001
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    44   0.001
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    43   0.002
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    43   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    43   0.002
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    43   0.002
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    43   0.002
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    42   0.003
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    42   0.003
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    42   0.004
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    42   0.004
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    42   0.005
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    42   0.005
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    41   0.008
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    41   0.008
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    41   0.009
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    41   0.009
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    40   0.011
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     40   0.014
KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weak...    40   0.014
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    40   0.015
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    39   0.025
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    39   0.026
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    39   0.034
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    38   0.060
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    37   0.10 
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    37   0.10 
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    37   0.14 
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    37   0.17 
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    37   0.18 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    36   0.23 
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}               36   0.31 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    36   0.32 
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    35   0.52 
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              35   0.56 
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    35   0.70 
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    35   0.73 
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    34   0.91 
TBLA0F01620 Chr6 complement(404095..405942) [1848 bp, 615 aa] {O...    34   0.96 
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    34   1.1  
KAFR0C00100 Chr3 (7573..8994) [1422 bp, 473 aa] {ON}                   34   1.2  
TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {O...    34   1.2  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    34   1.2  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    34   1.2  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     34   1.2  
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    34   1.3  
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               33   1.6  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    33   1.6  
NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {O...    33   1.6  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       33   1.6  
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    33   2.1  
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               33   2.1  
Suva_10.14 Chr10 (25745..27340) [1596 bp, 531 aa] {ON} YLL055W (...    33   2.1  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     33   2.1  
Kwal_55.21538 s55 complement(878539..879423) [885 bp, 294 aa] {O...    33   2.2  
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    33   2.2  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    33   2.8  
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    33   2.8  
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    33   2.8  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    33   2.8  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   2.9  
CAGL0J11022g Chr10 (1075366..1076025) [660 bp, 219 aa] {ON} high...    32   3.2  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    32   3.6  
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               32   3.6  
Smik_12.5 Chr12 (12023..13618) [1596 bp, 531 aa] {ON} YLL055W (R...    32   3.7  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    32   3.7  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    32   3.7  
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    32   3.7  
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    32   3.7  
NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON}              32   3.8  
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    32   3.8  
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    32   3.8  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...    32   3.9  
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    32   4.8  
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    32   4.8  
SAKL0B02112g Chr2 complement(202102..203685) [1584 bp, 527 aa] {...    32   4.8  
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...    32   4.9  
AEL057C Chr5 complement(528384..530057) [1674 bp, 557 aa] {ON} S...    32   4.9  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    32   4.9  
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...    32   4.9  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    32   5.0  
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    32   5.1  
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....    32   5.6  
TBLA0C02250 Chr3 (528050..533305) [5256 bp, 1751 aa] {ON} Anc_3....    32   5.6  
ADL095W Chr4 (515206..516693) [1488 bp, 495 aa] {ON} Non-synteni...    32   6.3  
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...    32   6.4  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               32   6.5  
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    32   6.5  
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    32   6.5  
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44      32   6.6  
Suva_4.272 Chr4 (482764..482811,482874..483662) [837 bp, 278 aa]...    31   6.6  
YNL327W Chr14 (24048..27173) [3126 bp, 1041 aa] {ON}  EGT2Glycos...    32   7.1  
KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar ...    31   7.8  
Kwal_56.24191 s56 complement(897583..897867) [285 bp, 94 aa] {OF...    29   7.9  
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    31   8.3  
Smik_15.488 Chr15 complement(839667..841235) [1569 bp, 522 aa] {...    31   8.3  
YLL055W Chr12 (30109..31704) [1596 bp, 531 aa] {ON}  YCT1High-af...    31   8.4  
AGL026W Chr7 (664329..665969) [1641 bp, 546 aa] {ON} Non-synteni...    31   8.4  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    31   8.5  
Smik_8.170 Chr8 complement(263829..265556) [1728 bp, 575 aa] {ON...    31   8.5  
Suva_15.287 Chr15 complement(489708..491438) [1731 bp, 576 aa] {...    31   8.5  
Skud_8.153 Chr8 complement(261078..262808) [1731 bp, 576 aa] {ON...    31   8.5  
YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}  ...    31   8.5  
CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some s...    31   9.0  
YDR022C Chr4 complement(488072..488662) [591 bp, 196 aa] {ON}  C...    30   9.1  
AGR202W Chr7 (1132104..1138922) [6819 bp, 2272 aa] {ON} Syntenic...    31   9.8  

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
            complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 1019 bits (2635), Expect = 0.0
 Identities = 511/528 (96%), Positives = 511/528 (96%)
 Frame = +1

Query: 1    MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 180
            MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS
Sbjct: 1    MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60

Query: 181  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 360
            CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL
Sbjct: 61   CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 120

Query: 361  KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 540
            KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT
Sbjct: 121  KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 180

Query: 541  LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 720
            LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN
Sbjct: 181  LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 240

Query: 721  NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIY 900
            NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWN                 FGIY
Sbjct: 241  NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIY 300

Query: 901  ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY 1080
            ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY
Sbjct: 301  ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY 360

Query: 1081 FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII 1260
            FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII
Sbjct: 361  FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII 420

Query: 1261 LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD 1440
            LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD
Sbjct: 421  LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD 480

Query: 1441 LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ 1584
            LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ
Sbjct: 481  LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ 528

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
            efflux pump of the major facilitator superfamily,
            required for resistance to aminotriazole and
            4-nitroquinoline-N-oxide
          Length = 542

 Score =  617 bits (1592), Expect = 0.0
 Identities = 310/524 (59%), Positives = 382/524 (72%), Gaps = 2/524 (0%)
 Frame = +1

Query: 4    DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 183
            +T+L  K     + I E    +  + + DE   M   N   +NP+YF    QEY FIF+C
Sbjct: 19   ETELPVKKSSRDNNIGESLTATAFTQSEDE---MVDSNQKWQNPNYFKYAWQEYLFIFTC 75

Query: 184  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 363
            M+SQLLN AGTTQTLSIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLK
Sbjct: 76   MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLK 135

Query: 364  KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 543
            KML++GYV+++IWSLI G++ YS S  FFII+RAFQGLGI+ VLPNVLG+IG IY  GT 
Sbjct: 136  KMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTF 195

Query: 544  KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 723
            +KN+VIS VGAM+PIGATLG LF+GL+ TE    WPWAFYAY++AAFIN  +S Y+IP+ 
Sbjct: 196  RKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST 255

Query: 724  IPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 903
            IPTN++  SMDWIGS  GV+GLIL NFVWNQAP  GWN                 F IYE
Sbjct: 256  IPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYE 315

Query: 904  LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 1083
            +R+A+ PLLP  +I++R +I I+ A+ FGWGSFGI+TFYYF F LN+R Y+ LWAGG+YF
Sbjct: 316  IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375

Query: 1084 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 1263
            +F+I G I A+  GF +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL
Sbjct: 376  MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435

Query: 1264 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 1443
              GMDLSFPASSII SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   N +G  L
Sbjct: 436  SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495

Query: 1444 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR--KEKDC 1569
            L+GYRGA Y GI  + +A +I+GLYMVE+     + R   E DC
Sbjct: 496  LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDC 539

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
            Anc_8.843 YMR279C
          Length = 550

 Score =  609 bits (1570), Expect = 0.0
 Identities = 304/525 (57%), Positives = 387/525 (73%), Gaps = 7/525 (1%)
 Frame = +1

Query: 22   KNIEVSSYIAE---ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLS 192
            KNI+  S +     + + +D +D NDES       SS +NPDYF +  QE+ FIFS M+ 
Sbjct: 33   KNIDSRSSLNSSLTQVLSTDTAD-NDES-------SSYQNPDYFKNKYQEFGFIFSGMIG 84

Query: 193  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 372
            QLL+ AG TQTLSIMNVL ++L S+ S + WL++SFPL  GSFILVSGRLGDIYGLKK+L
Sbjct: 85   QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144

Query: 373  ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 552
            + GY+I  +WS+I GLS Y+H+  FFI ARAFQGLG++  LPN++GLIG IY+PG  +KN
Sbjct: 145  LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204

Query: 553  MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 732
            M+ISI+GAMSP GATLGGLF+GL     + +WPW+FYA+ L +F+N  IS+Y IPN+IPT
Sbjct: 205  MIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264

Query: 733  NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY 912
            N++ L MDW+GS  GV GLI+ NFV+NQAP  GW                  F +YE++Y
Sbjct: 265  NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324

Query: 913  AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 1092
            A+ PL+P  I  NR ++MIL ++  GWGSFGIWTFYYFSF LNLR+YSPLWAG SYFIFV
Sbjct: 325  AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384

Query: 1093 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 1272
            ISG+  AI CG  +KKI+P+VL   SM+GF  G IIF+ TPV+QT+FRN+LG M +LPLG
Sbjct: 385  ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444

Query: 1273 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 1452
            MD SFPASSIILSD+LP Q+QGMAGSLVNTVINYS S+ LG+AGTVE   N +G DLL G
Sbjct: 445  MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504

Query: 1453 YRGALYFGIACSGVAVLIAGLYMVETIFD----SYKDRKEKDCEN 1575
            YR A+YF I  +G+AV ++G YM+E ++     S ++ K+ D E+
Sbjct: 505  YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIES 549

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (REAL)
          Length = 545

 Score =  608 bits (1569), Expect = 0.0
 Identities = 304/509 (59%), Positives = 379/509 (74%), Gaps = 2/509 (0%)
 Frame = +1

Query: 49   AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTL 228
            +EET+R      N E   +E  N   +NP YF    QEY FIF+CM+SQLLN AGTTQTL
Sbjct: 36   SEETLRGTAF-TNLEDEMVEC-NQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTL 93

Query: 229  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 408
            SIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLKKML++GYV+++IWSL
Sbjct: 94   SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153

Query: 409  ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 588
            I G++ YS S  FFII RAFQGLGI+ VLPNVLG+IG IY  GT +KN+VIS VGAM+PI
Sbjct: 154  ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213

Query: 589  GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGS 768
            GATLG LF+GL+ TE+   WPWAFYA+++A+ IN  +S Y+IPNNIPTN++  SMDWIGS
Sbjct: 214  GATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGS 273

Query: 769  FTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIR 948
              GV+GLIL NFVWNQAP  GW+                 F IYE+ +A++PLLP  +I+
Sbjct: 274  VLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIK 333

Query: 949  NRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGF 1128
            +  +I I+ A+ FGWGSFGI+TFYYF F LN+R+Y+ LWAGG+YF+F+I G I A+  GF
Sbjct: 334  DYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGF 393

Query: 1129 LMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIIL 1308
             +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL  GMDLSFPASSII 
Sbjct: 394  TIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIF 453

Query: 1309 SDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACS 1488
            SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   + +G  LL+GYRGA Y GI  +
Sbjct: 454  SDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLA 513

Query: 1489 GVAVLIAGLYMVETIFDSYKDR--KEKDC 1569
             +A +I+GLYMVE+  + +K +   E DC
Sbjct: 514  SLACMISGLYMVESFINDHKAKAATENDC 542

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (REAL)
          Length = 537

 Score =  608 bits (1568), Expect = 0.0
 Identities = 294/499 (58%), Positives = 374/499 (74%)
 Frame = +1

Query: 52   EETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLS 231
            EET+    + + D    M +     +NP+YF ++  EY FIF+CM+SQLLN AGTTQTLS
Sbjct: 37   EETV----TISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLS 92

Query: 232  IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 411
            IMN++     S+++ + WL+ASFPLVSGSFIL+SGRLGDIYGLKKML +GYV+++IWSLI
Sbjct: 93   IMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLI 152

Query: 412  TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 591
             GL+ YS S  FFII+RAFQGLGI+ VLPNVLG+IG IY  GT +KN+VIS+VGAM+P+G
Sbjct: 153  CGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVG 212

Query: 592  ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSF 771
            ATLG LF+GL+ T++   WPWAFYAYT+ + IN  +S YSIPNNIPTN+   SMDWIGS 
Sbjct: 213  ATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSA 272

Query: 772  TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 951
             GV+GL+L NFVWNQAP  GW+                 F IYE R+A++PLLP  ++++
Sbjct: 273  LGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKD 332

Query: 952  RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 1131
            R +I I+ A+ FGWGSFGI+TFYYF F LN+R+YS +WAGG+YF+F+I G I A+  G  
Sbjct: 333  RHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIY 392

Query: 1132 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 1311
            +KK+ P+V L  SM+ FN+G I+ SVTPVH+TYFR  LGTMIIL  GMD SFPASSII S
Sbjct: 393  IKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFS 452

Query: 1312 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSG 1491
            DNLP ++QGMAGSLVNTV+NYS SL LG+  TVE H + +G  +L+GYRGA Y GI  + 
Sbjct: 453  DNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLAS 512

Query: 1492 VAVLIAGLYMVETIFDSYK 1548
            +A +I+GLYMVE I   +K
Sbjct: 513  LACIISGLYMVERIIKDHK 531

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
            YMR279C
          Length = 537

 Score =  599 bits (1545), Expect = 0.0
 Identities = 289/490 (58%), Positives = 362/490 (73%)
 Frame = +1

Query: 103  MELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV 282
            +E   S  ++P+YF     E  F+ SCM+ QLLN AG+T TLS M VL R+L SS +   
Sbjct: 44   VEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSS 103

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            WL+ASFPLVSGSFIL+SGRLGDIYGLKKML+LGY+ L IWSLI GLS +SH+  FFI +R
Sbjct: 104  WLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163

Query: 463  AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 642
            AFQGLGIS VLPN+LG++G IYKPGT +KN+VIS++G  +PIGAT GGLF+G+V    + 
Sbjct: 164  AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223

Query: 643  SWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAP 822
             WPWAFYAYT+AAF+ T ISY+ IPN+IP NVN+ +MDWIGS  GV GL+LFNFVWNQ+ 
Sbjct: 224  DWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQST 283

Query: 823  ADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSF 1002
              GW                  F I+E++YA+ PLLP E+  +R +IMIL ++  GWGSF
Sbjct: 284  VVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSF 343

Query: 1003 GIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGF 1182
            GIW FYYF FVL LRNYSP+WAGG++F+  I G I A++ GF +K++ PAVLL FSM+ F
Sbjct: 344  GIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAF 403

Query: 1183 NLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNT 1362
              G II SVTPVH+TYFR+ LG M+IL  GMDLSFPA+SIILSD L  Q+QGMAGSLVNT
Sbjct: 404  TCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNT 463

Query: 1363 VINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDS 1542
            V+NYS SLFLGI GT+E+  NK+G  LL G+R ALYF I    + +LI+G+++++     
Sbjct: 464  VVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMR 523

Query: 1543 YKDRKEKDCE 1572
             K RKE + E
Sbjct: 524  SKSRKENELE 533

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (REAL)
          Length = 553

 Score =  598 bits (1542), Expect = 0.0
 Identities = 287/488 (58%), Positives = 367/488 (75%)
 Frame = +1

Query: 85   NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 264
            N E   M+ K    +NP+YF    QEY FIF+CM+SQLLN +GTTQTLSIMN+L     S
Sbjct: 55   NSEDEVMKTKQK-WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS 113

Query: 265  SDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGI 444
              + + WL+ASFPLVSGSFIL+SGR+GDI+GLK ML++GYV+++IWSLI GL+ YS S  
Sbjct: 114  DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173

Query: 445  FFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLV 624
            FFI++RAFQGLGI+ VLPNVLG+IG +Y  GT +KN+VIS +GAM+PIGATLG  F+GL+
Sbjct: 174  FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233

Query: 625  ATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNF 804
             T +   WPWAFYAYT+ A IN  +S Y+IPNNIPTNV+R SMDWIGS  GV+GL+L N 
Sbjct: 234  GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNL 293

Query: 805  VWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMT 984
            VWNQAP  GWN                 FG+YE+ +A++PLLP  ++++R +I I+ ++ 
Sbjct: 294  VWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLF 353

Query: 985  FGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLT 1164
            FGWGSFGI+TFYYF F LN+R+Y+PLWAGGSYF+F+I G I A+  GF +K++ P+V L 
Sbjct: 354  FGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLF 413

Query: 1165 FSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMA 1344
            F+MV FN+G I+ SVTPVH+TYFR  +GTMIIL  GMDLSFPASSII SD LP ++QGMA
Sbjct: 414  FAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMA 473

Query: 1345 GSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMV 1524
            GSLVNTV+NYS SL LG+  TVE   + +G  +L+GYRGA Y GI  + +A +I+GLYMV
Sbjct: 474  GSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533

Query: 1525 ETIFDSYK 1548
            E     ++
Sbjct: 534  ECYIKDHR 541

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] {ON}
            Anc_8.843 YMR279C
          Length = 556

 Score =  598 bits (1542), Expect = 0.0
 Identities = 283/519 (54%), Positives = 371/519 (71%), Gaps = 2/519 (0%)
 Frame = +1

Query: 4    DTDLKKKNIEVSSYI--AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIF 177
            D+D     +  S  I  +E+ + +D         S E  + S + P YF+S   E+AFIF
Sbjct: 23   DSDSDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIF 82

Query: 178  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYG 357
            +C++ QLLN AGTTQ++SIMN++     S  S + WL ASFPLVSGSFILV GR GDIYG
Sbjct: 83   TCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYG 142

Query: 358  LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 537
            LKKML+LGY IL IWS+I GL+ Y+HS  FFI+A+AFQGLG+S +LPN++GL+G IY+PG
Sbjct: 143  LKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPG 202

Query: 538  TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
            ++KKN+ IS +GAM+P+GAT GGLFSG+V  + + +WPW FYA+ + +F+     Y+ +P
Sbjct: 203  SMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVP 262

Query: 718  NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 897
            +N+PTN N L MDWIGS  GV+GL+LF+FVWNQAP DGW+                 F I
Sbjct: 263  DNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFI 322

Query: 898  YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 1077
            YE+ YAE PLLP  I  NR +IMIL A+  GWG+FGIW+FYYFSF LNLR++SP+W GG+
Sbjct: 323  YEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGA 382

Query: 1078 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 1257
            YF F++SG   A   GFL+K IRP+++L  S+ GF +G +IF+VTP  QTY+RN  G M+
Sbjct: 383  YFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMML 442

Query: 1258 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 1437
            +LPLGMDLSFPASSIILSD LP ++QGMAGSLVNT++NYS S  LG+A TVE+  N +G 
Sbjct: 443  LLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGD 502

Query: 1438 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 1554
            DLL+GYR A Y G+    + + IA LYM ET +  YK++
Sbjct: 503  DLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEK 541

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  597 bits (1538), Expect = 0.0
 Identities = 291/529 (55%), Positives = 382/529 (72%), Gaps = 18/529 (3%)
 Frame = +1

Query: 22   KNIEVSSYIAEET---IRSDCSD---------ANDESPSMELKNSSL------RNPDYFN 147
            KN+E    I + T   I  +CS          + DE PS E +++++      +NPDYF 
Sbjct: 11   KNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQ 70

Query: 148  STTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFIL 327
            +  QEY FIFSCM+SQLLN A T QTLSIMN++T    S    + WL+ASFPLVSGSFIL
Sbjct: 71   NKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFIL 130

Query: 328  VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 507
            +SGR+GDIYGLKK LI GY+  +IWSLI+G + YSH+ IFFII+RAFQGLGI+ +LPNV+
Sbjct: 131  ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190

Query: 508  GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFI 687
            G++G IYKP T +KN+VIS++GA +PIGA +G LF+GL+ TE+   WPWAFYA+ +A+ I
Sbjct: 191  GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAI 250

Query: 688  NTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXX 867
            N  IS YSIPNNIPTN++  +MDWIGS   V+GLIL NFVWNQ P  GW           
Sbjct: 251  NLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLII 310

Query: 868  XXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLR 1047
                   F  YE++YA++P+LP E+ +NR +IMIL A+  GWGSFGI++FYYFSF+LNLR
Sbjct: 311  SIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLR 370

Query: 1048 NYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQT 1227
            +YS LWAG +YF+F I GT+ A+  G  +K+I  +V+L FSM+ FN+G I+ SVTPV QT
Sbjct: 371  HYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQT 430

Query: 1228 YFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGT 1407
            YFR  LGTMIIL  GMD+SFPA++IILSD L  Q+QGMAGSL NT++NYS SL LG+  T
Sbjct: 431  YFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTT 490

Query: 1408 VEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 1554
            VE+  NK+G ++L+GYR A Y G+  +G+ ++I+G+YM E ++   K+R
Sbjct: 491  VERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
            similar to uniprot|P13090 Saccharomyces cerevisiae
            YML116w ATR1 Aminotriazole resistance protein or
            uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  591 bits (1523), Expect = 0.0
 Identities = 285/513 (55%), Positives = 373/513 (72%), Gaps = 4/513 (0%)
 Frame = +1

Query: 34   VSSYIAEETIRSDCSDANDESPSMELK---NSSLRNPDYFNSTTQEYAFIFSCMLSQLLN 204
            +SS  +  + + D +D  DE          N   +NP+YF+ST +EY F+ SC +SQLLN
Sbjct: 17   LSSSSSGSSFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLN 76

Query: 205  LAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGY 384
             AG  QT  IMN++   L S +  + WL+A+FPL+SGSFIL+SGR+GDIYGLKK L++GY
Sbjct: 77   QAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGY 136

Query: 385  VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
            + L++WSLI GL+ Y+HS  FFI++RAFQGLGISL+LPN+LG++G IY  G+ +KNMVIS
Sbjct: 137  LFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVIS 196

Query: 565  IVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNR 744
            ++G M+PIGATLG +FSGL+ TE    WPWAFY+Y + A IN  +S + IPN IPTNV+ 
Sbjct: 197  LIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG 256

Query: 745  LSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAE-N 921
              MDWIGS  GV+GLI+ NFVWNQAP DGW+                 F IYEL +   N
Sbjct: 257  HKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGN 316

Query: 922  PLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISG 1101
            PLLP E++++ + I++L A+ FGWGSFGI++FYYF+F LNLR+Y+PLWAGG+YF+F+I G
Sbjct: 317  PLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWG 376

Query: 1102 TITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDL 1281
             + A+  GF +KK+ P+++L  SMV FN G II SVTP+HQTYFRN LG MIIL  GMDL
Sbjct: 377  IVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDL 436

Query: 1282 SFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRG 1461
            SFPASSI+LSD LP Q+QGMAGSLVNT++NYS S  LG+AG VEQH N +G D+L+GYRG
Sbjct: 437  SFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRG 496

Query: 1462 ALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE 1560
            A Y GI  + +A +I+G  M+  I    K+ K+
Sbjct: 497  AFYLGIGLASMACIISGALMLSEIIQGRKNEKD 529

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar to
            uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
            Multidrug efflux pump of the major facilitator
            superfamily required for resistance to aminotriazole and
            4-nitroquinoline-N-oxide
          Length = 525

 Score =  590 bits (1521), Expect = 0.0
 Identities = 288/507 (56%), Positives = 373/507 (73%), Gaps = 4/507 (0%)
 Frame = +1

Query: 46   IAEETIRSDCS----DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAG 213
            ++++   SD S    D +++S  +    S L+NPDYF+   +EY F+ S MLSQLLN A 
Sbjct: 8    VSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAA 67

Query: 214  TTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVIL 393
              Q   + ++L+  L +  S + WL+ASFPLVSGSFILVSG++GDIYGLKK L+ GY ++
Sbjct: 68   ALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVV 127

Query: 394  VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVG 573
            VIWSLI GLS Y+H+  FFI+AR+FQGLGI+ VLPNV G++G IYKP T  KNMV S++G
Sbjct: 128  VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIG 187

Query: 574  AMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 753
            A +PIGATLG LFSGL+ TESE +W W FYAYT+ A +N  I++Y IP+NIPTNV++  M
Sbjct: 188  ACAPIGATLGCLFSGLIGTESE-AWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKM 246

Query: 754  DWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLP 933
            DW+GSF GV GLI+FNFVWNQAP DGW+                 F I+E R+A+ PLLP
Sbjct: 247  DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLP 306

Query: 934  SEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 1113
              ++ NR+L+MIL ++  GWGSFGIWT+YY +FVLNLR+Y+PLWAGGSYF+F I GTI A
Sbjct: 307  RAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAA 366

Query: 1114 ISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPA 1293
               G  + K  PA++L  S++ F++GCI+ SVTPV QTYFR  LGTM+IL  GMDLSFPA
Sbjct: 367  FLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPA 426

Query: 1294 SSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYF 1473
            SSIILSD LP+Q+QGMAGSLVNT+INYS SL LG++GT E+  NK+GTDLL+GYR ALY 
Sbjct: 427  SSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYV 486

Query: 1474 GIACSGVAVLIAGLYMVETIFDSYKDR 1554
            GI  + V + ++G Y +E  +   ++R
Sbjct: 487  GIGLASVGIFVSGAYAIEDWWTRRRER 513

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  591 bits (1523), Expect = 0.0
 Identities = 281/509 (55%), Positives = 367/509 (72%)
 Frame = +1

Query: 52   EETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLS 231
            ++ I SD +  +  S S++  NSS +NPDYF+S+ +EY F+ +CM++ LLN AG +Q LS
Sbjct: 41   DDEIGSDSTTTS--SSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLS 98

Query: 232  IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 411
             MNV++   HSS   + WL+ASFPLVSGSFIL+SGRLGDIYGLK+M+I G++ ++IWSLI
Sbjct: 99   AMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLI 158

Query: 412  TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 591
             G + Y+HS  FFI+ARAFQGLGIS +LPNV+GL+G IYK GTL+KN+VIS++G M+P G
Sbjct: 159  CGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTG 218

Query: 592  ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSF 771
            +  G L+ GL+ TE+   WPW FYAY +AA +   + YY++P+NIPTNVN  +MDWIGS 
Sbjct: 219  SCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSV 278

Query: 772  TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 951
             GV+GLILFNFVWNQ P  GW                  F +YE++YA+ PLLP  + +N
Sbjct: 279  LGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQN 338

Query: 952  RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 1131
              ++ ILT +  GWGSFGIWTFYYF+F LNLR YSP+W+GG++F+F+I GT+ A +    
Sbjct: 339  GHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALT 398

Query: 1132 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 1311
            +KK+ PA+LL FS +GF  G II SVTPVHQTY+RN  G  IIL  GMDL FPASSIILS
Sbjct: 399  IKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILS 458

Query: 1312 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSG 1491
            D LP Q+QGMA SLVNT++NYS SL LG+  TVE+  NK+G DLL+GYR ALYFG+  +G
Sbjct: 459  DYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAG 518

Query: 1492 VAVLIAGLYMVETIFDSYKDRKEKDCENC 1578
            +   IA L +   I+     +  KD + C
Sbjct: 519  LGACIAFLNVCHDIWSKRNAKDPKDLQRC 547

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
            uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  589 bits (1518), Expect = 0.0
 Identities = 295/505 (58%), Positives = 373/505 (73%), Gaps = 1/505 (0%)
 Frame = +1

Query: 16   KKKNIEVSSYIAEETIRSDCSDANDESPSMELKN-SSLRNPDYFNSTTQEYAFIFSCMLS 192
            K+ N  VSS   E   +S  +        ++ K   S+++P YF++  +EY FIF+ M+S
Sbjct: 4    KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63

Query: 193  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 372
            QLLN AGTTQTLS++N+L++   SS S + WL+ASFPLVSGSFILVSG++GDIYGLKK L
Sbjct: 64   QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123

Query: 373  ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 552
            ++GYV+ +IWSLI GL+ Y+ S  FFII+RAFQGLGI+ +LPN++G++G IY  GT +KN
Sbjct: 124  LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183

Query: 553  MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 732
            MVIS++GA +PIGAT+G LFSGL+ T SE  W W FYAYT+ A IN  +S + IPN IPT
Sbjct: 184  MVISLIGACAPIGATMGVLFSGLIGTLSE-RWAWTFYAYTITAAINMGLSIWVIPNTIPT 242

Query: 733  NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY 912
            NV   SMDWIGS  G+LG+ILFNFVWNQ P  GW+                 F +YE +Y
Sbjct: 243  NVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKY 302

Query: 913  AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 1092
            A +PL+P   + N +L+M L A+ FGWGSFGIWTFYYF FVLNLR Y+PLWAGGSYF+F+
Sbjct: 303  ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFL 362

Query: 1093 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 1272
            I G I AIS G+ +K+I P+++L  SM+ F+ GCI+ SVTPV QTYFR ILG MIIL  G
Sbjct: 363  IWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFG 422

Query: 1273 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 1452
            MDLSFPASSIILSD LP ++QGMAGSLV+T+INYS S+ LGIAGTVE   NKNG DLL+G
Sbjct: 423  MDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKG 482

Query: 1453 YRGALYFGIACSGVAVLIAGLYMVE 1527
            YR ALY GI  + + V I+ L+M+E
Sbjct: 483  YRAALYLGIGLASLGVFISALFMLE 507

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  587 bits (1514), Expect = 0.0
 Identities = 278/500 (55%), Positives = 369/500 (73%)
 Frame = +1

Query: 25   NIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLN 204
            N  ++  I   +  S+ SD N E+   E K   + +P YF + T EY FI SCM+SQ ++
Sbjct: 56   NTSMNEVIGSISSVSNDSDINSENLQSENK---VLSPKYFKNRTHEYLFIISCMVSQFMS 112

Query: 205  LAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGY 384
             AG TQ LSIMN+L  +L++  S + WL+ASF L  GSFILVSGRLGDIYGLKK+L+ GY
Sbjct: 113  QAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGY 172

Query: 385  VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
             IL IWSLI G S YSH+  FFI +RAFQGLG++ VLPN LGLIG+IY+PG++KKNM+I 
Sbjct: 173  AILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIG 232

Query: 565  IVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNR 744
             +GAMSPIGATLGGLF+G++ T+    WPW+FY++ + +F N  +S+YSIPNNIPTN+  
Sbjct: 233  TLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYN 292

Query: 745  LSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENP 924
            LSMDWIG+  G+ GL++ NFV+NQAP  GW                  F +YE++YA+ P
Sbjct: 293  LSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTP 352

Query: 925  LLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGT 1104
            L+P  I  NR ++MIL A+  GWG+FG WTFYYFSFVLN+R Y+  WAGGSYFIF++SG 
Sbjct: 353  LIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGC 412

Query: 1105 ITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLS 1284
              A  CGF+MKK+ P+V+L  SM+GF  GC++ +VTP+HQ+YF+NILG M +LP+G+DLS
Sbjct: 413  AIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLS 472

Query: 1285 FPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGA 1464
            FPA+SIILSD LP Q+QGMAGSLV T+ NYS S+ LG+AG+VE + N NG ++L+GYR A
Sbjct: 473  FPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNA 532

Query: 1465 LYFGIACSGVAVLIAGLYMV 1524
            + F  A +G+ ++++G+YMV
Sbjct: 533  MIFADALAGLGIIVSGIYMV 552

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  585 bits (1507), Expect = 0.0
 Identities = 283/506 (55%), Positives = 366/506 (72%)
 Frame = +1

Query: 31   EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLA 210
            E +S I    I     D   ++ + +L++S  +NPDYF +  QEY FIFSCM+SQLLN A
Sbjct: 25   EETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQA 84

Query: 211  GTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVI 390
             T QTLSIMN++T   +S    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK L+ GY+ 
Sbjct: 85   ATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIF 144

Query: 391  LVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV 570
             +IWS+I+GL+ YSHS  FFI++RAFQGL I+ +LPNV+G++G IYKP + +KN+VIS++
Sbjct: 145  FIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMI 204

Query: 571  GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS 750
            GA +PIGA  G LF+GL+ TE    WPWAFYA+ +A+  N  IS YSIPN++PTNV+  +
Sbjct: 205  GASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFA 264

Query: 751  MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 930
            MDWIGS   V+GLIL NFVWNQ P  GW                  F  YE++YAE+PLL
Sbjct: 265  MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLL 324

Query: 931  PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 1110
            P E+ +NR +IMIL A+  GWGSFGI++FYYFSF+LNLR+YS LWAG +YF+F I GT+ 
Sbjct: 325  PVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVA 384

Query: 1111 AISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFP 1290
            A+  G  +KKI  A +L  SMV FN+G I+ SVTPV QTYFR  LGTMIIL  GMD+SFP
Sbjct: 385  AVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 444

Query: 1291 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALY 1470
            A++IILSD L  Q+QGMAGSL NT++NYS SL LG+  TVE+  NK+G DLL+GYRGA Y
Sbjct: 445  AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEY 504

Query: 1471 FGIACSGVAVLIAGLYMVETIFDSYK 1548
             GI  +G+ ++I  +Y+ E ++   K
Sbjct: 505  LGIGLAGLGIIITAIYLGEILWGKRK 530

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] {ON}
            similar to uniprot|Q03263 Saccharomyces cerevisiae
            YMR279c or uniprot|P13090 Saccharomyces cerevisiae
            YML116w ATR1
          Length = 558

 Score =  583 bits (1503), Expect = 0.0
 Identities = 284/522 (54%), Positives = 370/522 (70%), Gaps = 13/522 (2%)
 Frame = +1

Query: 52   EETIRSDCSDANDESPSMELK------------NSSLRNPDYFNSTTQEYAFIFSCMLSQ 195
            EE   SD   +N +  S+  K            +S  +NP+YF +  +E  FI SCM++Q
Sbjct: 37   EECSSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQ 96

Query: 196  LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLI 375
            LLN AG TQ+LS MNVL     S+ S + WL+ASFPLVSGSFIL+SGRLGDIYGLKK L 
Sbjct: 97   LLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALS 156

Query: 376  LGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 555
            +GY+I+ +WS+I GL+ Y++S  FFI+ R+FQGLGI+ +LPN++GL+G IYK GTL+KN+
Sbjct: 157  VGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNI 216

Query: 556  VISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTN 735
            VIS +G M+P GA LG LF GL+ TE    WPW FYA+ +A+F+N  ++ YSIPNN+PTN
Sbjct: 217  VISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTN 276

Query: 736  VNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 915
            +N L+MDWIGS  GV GL+L N VWNQAP  GW                  F +YE++YA
Sbjct: 277  LNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYA 336

Query: 916  ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 1095
             +PLLP  ++ N++++MIL A+ FGWGSFGIWT+YY++F LNLR Y+PLWAGG++F+FVI
Sbjct: 337  TSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVI 396

Query: 1096 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 1275
             GT+ A      +KK+ PAVLL FSMV F+ G I+ SVTPVHQTY+R  +G  IIL  GM
Sbjct: 397  WGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGM 456

Query: 1276 DLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGY 1455
            DLSFPASSIILSD LP Q+QGMAGSLVNTV+NYS SL LG+  TVEQ  N +G DLL+GY
Sbjct: 457  DLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGY 516

Query: 1456 RGALYFGIACSGVAVLIAGLYMV-ETIFDSYKDRKEKDCENC 1578
            R ALY  I  +   V ++ +++V + I   ++ R E +CE+C
Sbjct: 517  RSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC 558

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
            (ATR1) - predicted protein is very hydrophobic, has many
            membrane-spanning regions, several potential
            glycosylation sites, potential ATP-binding site [contig
            38] FULL
          Length = 515

 Score =  579 bits (1492), Expect = 0.0
 Identities = 281/479 (58%), Positives = 360/479 (75%)
 Frame = +1

Query: 118  SSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVAS 297
            S L+NPDYF+   +EY F+ S MLSQLLN A TTQT  + +VL++ L++  S + WL+AS
Sbjct: 36   SRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMAS 95

Query: 298  FPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL 477
            FPLVSGSFILVSG++GDIYGLKK L+ GYV++VIWSLI GLS Y+H+  FF++AR+FQGL
Sbjct: 96   FPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGL 155

Query: 478  GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWA 657
            GI+ VLPNV+G++G IYKP T  KN+V S++GA +PIGATLG +FSGL+   ++  W W 
Sbjct: 156  GIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTD-LWGWT 214

Query: 658  FYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWN 837
            FYAY + A +N  ++ + IPNNIPTNVN   MDWIGS  GV GLILFNFVWNQAP  GW 
Sbjct: 215  FYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWG 274

Query: 838  XXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTF 1017
                             F  YE+R+A+ PLLP  ++ NR+L+MIL+++ FGWGSFGIWTF
Sbjct: 275  SAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTF 334

Query: 1018 YYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCI 1197
            YY SF+LNLR+YSPLWAGG+YF+F I G + ++  G+ + K  PAV+L  SMV F+ GCI
Sbjct: 335  YYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCI 394

Query: 1198 IFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYS 1377
            + +VTPVHQTYFR  LG MIIL  GMDLSFPA+SIILSD LP+Q+QGMAGSLV+T+I+YS
Sbjct: 395  MLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYS 454

Query: 1378 NSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 1554
             SL LGI+GT E   NKNG DLL+GY+ ALY GI  + + V+I+G +M+E  + S + R
Sbjct: 455  MSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
            YMR279C
          Length = 550

 Score =  577 bits (1486), Expect = 0.0
 Identities = 283/513 (55%), Positives = 362/513 (70%)
 Frame = +1

Query: 25   NIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLN 204
            N+E     + E+    CS++          ++  +NP YF +  QEYAFI +CML+QLLN
Sbjct: 34   NVEEKKNCSTESEAEWCSESEFTD-----NDTPWQNPTYFANRWQEYAFISTCMLAQLLN 88

Query: 205  LAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGY 384
             AG  Q  + MN+L    +SS   + WL+ASFPLVSGSFILVSGR+GDIYGLKK LI GY
Sbjct: 89   QAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGY 148

Query: 385  VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
            ++++IWSLI G + Y+H+  FFI+ RAFQGLGI+ +LPNV+GLIG IYK  TL+KN VIS
Sbjct: 149  LVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVIS 208

Query: 565  IVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNR 744
             VG  +PIGA LGG++SGL+A E+   WPW FYAY +   IN  ++ YSIP+ +PTN++ 
Sbjct: 209  FVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHG 268

Query: 745  LSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENP 924
              MDW GS  GV+G+ILFNFVWNQ P DGWN                 F IYE+++A++P
Sbjct: 269  FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSP 328

Query: 925  LLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGT 1104
            LLP E+I+NR + MIL A+  GWGSFGIWTFYY++F LNLR+YS +WAGG++F+FVI GT
Sbjct: 329  LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGT 388

Query: 1105 ITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLS 1284
            I A      +K++ P+VLL FSM GF +GCI+ SVTPVHQ+Y++  LG  IIL  GMDLS
Sbjct: 389  IAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLS 448

Query: 1285 FPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGA 1464
            FPASSIILSD LP+Q+QGMAGSLVNT++NYS SL LG+  T E   NKNGTD L+GYR A
Sbjct: 449  FPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAA 508

Query: 1465 LYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
            LY GI      +L+A  Y+ E ++   K R EK
Sbjct: 509  LYVGIGLGACGMLVAFCYLFEVLWIGRKKRLEK 541

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
            YMR279C (REAL)
          Length = 543

 Score =  576 bits (1484), Expect = 0.0
 Identities = 277/517 (53%), Positives = 367/517 (70%), Gaps = 1/517 (0%)
 Frame = +1

Query: 13   LKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIFSCML 189
            + K +++    +   +   D +     + S ++ N S  ++P YF+S  +E  FI +CML
Sbjct: 19   IDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCML 78

Query: 190  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
            +QLLN AG T  L+IMNVL++  +S    + WL+ASFPLV+GSFIL+SGRLGDIYGLKKM
Sbjct: 79   AQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKM 138

Query: 370  LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
            L++GYV +++WSLI GLS YS++  FFI  RAFQGLGI+ +LPNV+GL+G +YK G+ +K
Sbjct: 139  LMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRK 198

Query: 550  NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 729
            N+VIS +GA +P G   GGLF GL+  E    WPW FYA+ +A F+N  +++YSIPNNIP
Sbjct: 199  NLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIP 258

Query: 730  TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELR 909
            TNV+  SMDW GS   V+GLILFNFVWNQAP  GW                  F +YE++
Sbjct: 259  TNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVK 318

Query: 910  YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF 1089
            YA+ PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+YF+F
Sbjct: 319  YAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVF 378

Query: 1090 VISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 1269
            VI GTI A      +K++ PA LL F++V F++G I+FSV PV Q++++   G   IL  
Sbjct: 379  VIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCF 438

Query: 1270 GMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR 1449
            GMDLSFPASSIILSD LP ++QGMAGSLVNTVINYS SL LG+  TVE   NKNG DLL+
Sbjct: 439  GMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLK 498

Query: 1450 GYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE 1560
            GYRGA+Y G+  + + VLI+  YM+ET +++ +DR++
Sbjct: 499  GYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
            YMR279C (REAL)
          Length = 543

 Score =  573 bits (1478), Expect = 0.0
 Identities = 278/519 (53%), Positives = 372/519 (71%), Gaps = 1/519 (0%)
 Frame = +1

Query: 19   KKNIEVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIFSCMLSQ 195
            K  ++V   +   T   + +     + S ++ N S  ++P YF+S  +E  FI +CML+Q
Sbjct: 21   KTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQ 80

Query: 196  LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLI 375
            LLN AG T  L IMNVL++  +S  + + WL+ASFPL +GSFIL+SGRLGDIYGLKKML+
Sbjct: 81   LLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLL 140

Query: 376  LGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 555
            +GYVI++IWS+I+GLS YS+S  FFI  RAFQGLGI+ +LPN++GL+G +YK G+L+KN+
Sbjct: 141  IGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNL 200

Query: 556  VISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTN 735
            VIS++GA +P G   GG+F GL+ TE    WPW FYA+++A FI+  +++YSIPNN+PTN
Sbjct: 201  VISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTN 260

Query: 736  VNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 915
            V+ LSMDW GS   VLGLILFNFVWNQAP  GW                  F +YE++YA
Sbjct: 261  VHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYA 320

Query: 916  ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 1095
            E PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+YF+FVI
Sbjct: 321  EVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVI 380

Query: 1096 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 1275
             G+I A    F +K++ PA+LL F+++ F+ G I+FSV PV Q+Y++       IL  GM
Sbjct: 381  FGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGM 440

Query: 1276 DLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGY 1455
            DLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL LG+  TVE+  NK+G +LL+GY
Sbjct: 441  DLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGY 500

Query: 1456 RGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 1572
            R A+Y GI  + + +LI+  YM+E  ++ +K+ ++K  E
Sbjct: 501  RAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLE 539

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  572 bits (1475), Expect = 0.0
 Identities = 274/503 (54%), Positives = 363/503 (72%), Gaps = 2/503 (0%)
 Frame = +1

Query: 52   EETIRSDCSDA--NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 225
            E+ + S+ +D+  +D+SP         +NP+YF+S  +EY FIF+CM++ LLN AG TQ 
Sbjct: 32   EKEVYSNSTDSVLDDDSP--------WQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQV 83

Query: 226  LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 405
            LS MNV++   HS    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK +I GY+ ++IWS
Sbjct: 84   LSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWS 143

Query: 406  LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 585
            L+ G + ++H+  FFI+ RAFQGLGIS +LPNV+GLIG IYK GTL+KN+VIS++G  +P
Sbjct: 144  LLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAP 203

Query: 586  IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIG 765
             GA +G L+ GL+ TE+   WPW FYAY L   +N  ++ YS+PN IPTNV+  +MDWIG
Sbjct: 204  TGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIG 263

Query: 766  SFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEII 945
            S  GV+GLILFNFVWNQ P  GW+                 F +YEL+Y  +PLLP E+ 
Sbjct: 264  SIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVT 323

Query: 946  RNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCG 1125
            +N Q++ IL+ +  GWG+FGIWTFYYF+F LNLR+YSP+W GG+YF+F+I GTI A+   
Sbjct: 324  KNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVA 383

Query: 1126 FLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 1305
            F +KK+ PA+LL FS +GF +G ++ SVTP+HQ Y+R  LG  IIL  GMDLSFPASSII
Sbjct: 384  FTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSII 443

Query: 1306 LSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIAC 1485
            LSD+LP Q+QGMAGSLVNTVINY+ SL LG+  TVE+  NK+G DLL+GYR ALY  +  
Sbjct: 444  LSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGL 503

Query: 1486 SGVAVLIAGLYMVETIFDSYKDR 1554
             G+   IA + +  T++   +DR
Sbjct: 504  GGLGSCIAFINLCYTLWMKRRDR 526

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  571 bits (1471), Expect = 0.0
 Identities = 271/486 (55%), Positives = 354/486 (72%), Gaps = 1/486 (0%)
 Frame = +1

Query: 109  LKNSS-LRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVW 285
            L+NS+  +N  YF S  +EY FIF+CM + LLN AG TQ LS MNV++   HS    + W
Sbjct: 22   LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81

Query: 286  LVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARA 465
            L+ASFPLVSGSFIL+SGR+GDIYGLKK +I GY+ ++IW+L+ G + Y+HS  FFI+ RA
Sbjct: 82   LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141

Query: 466  FQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGS 645
            FQGLGIS +LPN++GL+G IYK GTL+KN+VIS++G  +P GA +G L+ GL+ATES   
Sbjct: 142  FQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQ 201

Query: 646  WPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPA 825
            WPW FYAY LAAF+N  ++ YS+P N+PTNV+  +MDW+G+  GV+GLILFNFVWNQ P 
Sbjct: 202  WPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPV 261

Query: 826  DGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFG 1005
            +GW                  F IYEL++  +PLLP E+ +N Q++ IL  +  GWGSFG
Sbjct: 262  NGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321

Query: 1006 IWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFN 1185
            IWTFYY++F LNLRNYSPLWAG ++F+F+I G+I A   GF + ++ PAVLL FS +GF 
Sbjct: 322  IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381

Query: 1186 LGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV 1365
            +G ++ SVTP+HQTY+R  +G  IIL  GMDLSFPASSIILSD+LP Q+QGMAGSLVNT+
Sbjct: 382  MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441

Query: 1366 INYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSY 1545
            INYS SL LG+  TVE+  NK G +LLRGYR ALY  +   G+   +A L +    +D +
Sbjct: 442  INYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNL---CYDLW 498

Query: 1546 KDRKEK 1563
            + RK +
Sbjct: 499  RKRKSR 504

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
            Putative boron transporter involved in boron efflux and
            resistance; overexpression mutant but not null mutant
            displays boron tolerance phenotype; identified as a
            heat-induced gene in a high-throughout screen; YMR279C is
            not an essential gene; paralog of the efflux pump ATR1
          Length = 540

 Score =  567 bits (1461), Expect = 0.0
 Identities = 272/525 (51%), Positives = 374/525 (71%), Gaps = 2/525 (0%)
 Frame = +1

Query: 4    DTDLKKK-NIEVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIF 177
            D+++ +K  ++    +   T   + +     + S ++ N S  ++P YF+S  +E  FI 
Sbjct: 15   DSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIA 74

Query: 178  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYG 357
            +CML+QLLN AG T  L IMNVL++  +S  + + WL+ASFPL +GSFIL+SGRLGDIYG
Sbjct: 75   TCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYG 134

Query: 358  LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 537
            LKKMLI+GYVI+++WS+I+GLS YS+S  FFI +RAFQG+GI+ +LPN++GL+G +YK G
Sbjct: 135  LKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVG 194

Query: 538  TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
            + +KN+VIS +GA +P G   GGLF GL+ TE    WPW FYA+ +A F++  +++YSIP
Sbjct: 195  SFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIP 254

Query: 718  NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 897
            NN+PTN++ LSMDW GS   ++GLILFNFVWNQAP  GW+                 F +
Sbjct: 255  NNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFV 314

Query: 898  YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 1077
            YE +YAE PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+
Sbjct: 315  YESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 374

Query: 1078 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 1257
            YF+FVI G++ A    F +K++ PA+LL FS++ F+ G I+FSV PV Q+Y++       
Sbjct: 375  YFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQA 434

Query: 1258 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 1437
            IL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL LG+ GTVE   NK+G 
Sbjct: 435  ILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGN 494

Query: 1438 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 1572
            DLL+GYR A+Y G+  + + V+I+  YM+E +++ ++  +++  E
Sbjct: 495  DLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
            YMR279C (REAL)
          Length = 539

 Score =  566 bits (1460), Expect = 0.0
 Identities = 272/494 (55%), Positives = 359/494 (72%), Gaps = 1/494 (0%)
 Frame = +1

Query: 94   SPSMELKNSS-LRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSD 270
            S S ++ N S  ++P YF+S  +E  FI +CML+QLLN AG T  L IMNVL++   S  
Sbjct: 45   SKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSES 104

Query: 271  SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
            + + WL+ASFPL +GSFIL+SGRLGDIYGLKKML++GYVI+++WS+I+GLS YS++  FF
Sbjct: 105  NNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFF 164

Query: 451  IIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
            I  RAFQG+GI+ +LPN++GL+G +YK G+L+KN+VIS++GA  P GA  GG+F GL+ T
Sbjct: 165  ITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVT 224

Query: 631  ESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVW 810
            E    WPW FYA+ +A FI+  +++YSIPNN+PTNV+ LSMDW GS   V+GLILFNFVW
Sbjct: 225  EDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVW 284

Query: 811  NQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFG 990
            N+AP  GW+                 F +YE++YAE PLLP  + +NR +IMIL A+  G
Sbjct: 285  NEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVG 344

Query: 991  WGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFS 1170
            WGSFGIWTFYY SF LNLR+YSP+W GG+YF+F I GTI A    F +K++ PA+LL F+
Sbjct: 345  WGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFA 404

Query: 1171 MVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGS 1350
            ++ F+ G I+FSV PV Q+Y++       +L  GMDLSFPASSIILSD LP Q+QGMAGS
Sbjct: 405  LMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGS 464

Query: 1351 LVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVET 1530
            LVNTVINYS SL LG+  TVE   NK+G ++L GYR A+Y GI  + + VLI+  YM+ET
Sbjct: 465  LVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLET 524

Query: 1531 IFDSYKDRKEKDCE 1572
            +++  K  + K  E
Sbjct: 525  VWNERKKCQRKSLE 538

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  558 bits (1437), Expect = 0.0
 Identities = 276/506 (54%), Positives = 356/506 (70%), Gaps = 3/506 (0%)
 Frame = +1

Query: 25   NIEVSSYIAEETIRSDCSDANDESPSMEL---KNSSLRNPDYFNSTTQEYAFIFSCMLSQ 195
            N + S+ ++E+T  S  S     SP  E     N+  +NP YF+S  +EY FI +CMLS 
Sbjct: 35   NYDSSTSVSEKT--SAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSN 92

Query: 196  LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLI 375
            LLN AG TQ  S MNV+    ++  S K WL+ASFPLVSGSFILVSGR+GDIYGLK+ +I
Sbjct: 93   LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMI 152

Query: 376  LGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 555
             G ++++IWSLI G + YS S  FFII RAFQGLGI+ VLPNV+GL+G IYK G+L+KN+
Sbjct: 153  GGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNI 212

Query: 556  VISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTN 735
            VIS +G  +P GA  G  ++GL+AT++E  WPW FYAY  A  +N  ++ YSIP+ +P N
Sbjct: 213  VISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN 272

Query: 736  VNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 915
            V+  SMDW GS  GV+GLILFNFVWN+AP  GW                  F IYE+++A
Sbjct: 273  VHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFA 332

Query: 916  ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 1095
            ++PLLP  +  N  +IMIL+AM  GWGSFGIWTFYY++F+LNLR Y+PL AG S+ +F++
Sbjct: 333  KSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFIL 392

Query: 1096 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 1275
             GTI A +  F +K++ P+VLL  SMV F +G I+ S+TPVHQTY++   G  IIL  GM
Sbjct: 393  WGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGM 452

Query: 1276 DLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGY 1455
            DLSFPASSIILSD LP ++QGMAGSLVNT++NYS SL LG+  T E   NKNGTDLL+GY
Sbjct: 453  DLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGY 512

Query: 1456 RGALYFGIACSGVAVLIAGLYMVETI 1533
            R ALY GI    V V+IA L++ E++
Sbjct: 513  RAALYVGIGLGVVGVIIAALFLFESL 538

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
            Anc_8.843 YMR279C
          Length = 542

 Score =  557 bits (1435), Expect = 0.0
 Identities = 273/527 (51%), Positives = 370/527 (70%), Gaps = 8/527 (1%)
 Frame = +1

Query: 16   KKKNI-----EVSS-YIAEETIRSDCSDANDESPSMELKNSSLRNPD--YFNSTTQEYAF 171
            KKKN      EVSS +  E T        N+ S  +   + + +  D  YF +  QEY F
Sbjct: 12   KKKNHKNAIDEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIF 71

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            + +CM+SQLLN A   QTLS+MN+LT+  HS+   + WL+ASFPLVSGSFIL+SGR+GDI
Sbjct: 72   VGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDI 131

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
            YGLK  L+ G +  +IW+LI+G + Y+HS  FFI++R+FQGLG++ +LPNV+G +G IYK
Sbjct: 132  YGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYK 191

Query: 532  PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYS 711
            P T +KN+VIS++GA +P+GA +G  F+GL+ T++   WPW+FYA  +A+ +    + YS
Sbjct: 192  PNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYS 251

Query: 712  IPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXF 891
            IPN+IPTNV+  SMDWIGS   V+GLIL NFVWNQ P DGW                  F
Sbjct: 252  IPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLF 311

Query: 892  GIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAG 1071
             IYE+ YA +PLLP  I +NR ++MIL A+  GWGSFGI++FYYF+F+LNLR+YS +WAG
Sbjct: 312  FIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAG 371

Query: 1072 GSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGT 1251
            G+YF+F I G + ++  G  ++KI  +++L FSM+ F++G I+ SVTPV QTYFR  LGT
Sbjct: 372  GTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGT 431

Query: 1252 MIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKN 1431
            MIIL  GMD+SFPA++IILSD+LPNQ+QGMAGSL NT++NYS SL LG+  TVE   N+N
Sbjct: 432  MIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQN 491

Query: 1432 GTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 1572
            G DLL+GYR A Y GI  + +AV+++ +YM E ++   K+R E   E
Sbjct: 492  GKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSE 538

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
            Anc_8.843 YMR279C
          Length = 547

 Score =  548 bits (1412), Expect = 0.0
 Identities = 263/512 (51%), Positives = 350/512 (68%)
 Frame = +1

Query: 31   EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLA 210
            + S  +  ++++ D     D+  S    NS  ++P YF S+ QEY FI +CML+ LLN A
Sbjct: 30   QTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQA 89

Query: 211  GTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVI 390
            G TQTLS MNVL   L+S  + K WL+ASF L SGSFILVSGR+GDIYGLK   I G +I
Sbjct: 90   GQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNII 149

Query: 391  LVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV 570
              IWS++ G+S Y+ +  FFII RAFQGLG++ VLPNV+GL+G IY  G+++KN+VIS +
Sbjct: 150  FCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFI 209

Query: 571  GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS 750
            G M+P+G T GG++ GL+   ++  WPW F+A  +A FIN  +  YSIPN++PTN+  L 
Sbjct: 210  GCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLK 269

Query: 751  MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 930
            MDWIGS  GV+GLIL NFVWNQAP  GW+                 F IYEL+ AE+PLL
Sbjct: 270  MDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLL 329

Query: 931  PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 1110
            P E+ +NR ++ I+ ++  GWG+FGIWTFYY++F LNLR++SPLWAG ++F+F+I G++T
Sbjct: 330  PPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLT 389

Query: 1111 AISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFP 1290
            AI+  F + K+ P+VL   S +GF  G IIFSVT   QTY+RN LG  IIL LGMDLSFP
Sbjct: 390  AITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFP 449

Query: 1291 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALY 1470
             SSIILSD LP Q+QGM+GSLVNT+ NY+ SL LG+  T E   N  G D+L+GYR ALY
Sbjct: 450  GSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALY 509

Query: 1471 FGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 1566
              I    +    +  YM E ++  Y+ R++ +
Sbjct: 510  VAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
            Anc_8.843 YMR279C
          Length = 520

 Score =  538 bits (1386), Expect = 0.0
 Identities = 269/504 (53%), Positives = 352/504 (69%), Gaps = 3/504 (0%)
 Frame = +1

Query: 52   EETIRSDCS---DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQ 222
            +E I+SD S    +N++   +  + S  ++P YF ++ QEY F+ SCM +QLLN A T Q
Sbjct: 10   KEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQ 69

Query: 223  TLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIW 402
            TLSIMNVL+   +SS S + WLVASFPLV+GSFIL+SGR+GDIYGLKK LI GY+ L+IW
Sbjct: 70   TLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129

Query: 403  SLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMS 582
            SLI G + YS S  F IIARAFQGLGI+  LPNV+G IG IY  G+L+KNMVIS++ A +
Sbjct: 130  SLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189

Query: 583  PIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWI 762
            P+GA +GG F+GL+ TES   WPW+FYA+ +A   N  IS YSIP+NIPTNVN   MDWI
Sbjct: 190  PVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWI 249

Query: 763  GSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEI 942
            GS   V GLILFNF WNQ P  GW+                 F  YE+ +A +PL+  EI
Sbjct: 250  GSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREI 309

Query: 943  IRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISC 1122
              +R +I+ +  +  GWGS+GIW+FYYFSFVLNLR+YSP+WAGGSYFIF I G + +   
Sbjct: 310  THSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFV 369

Query: 1123 GFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSI 1302
            G  +KKI   V+L FSMV F +G  + SV PV Q+YF+  L  M IL +G+D SFPA++I
Sbjct: 370  GISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATI 429

Query: 1303 ILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIA 1482
            ILSD LP ++QGMAGSL  T++NYS SL LG+  TVE+  NK+G D+L+GYR A Y GI 
Sbjct: 430  ILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIG 489

Query: 1483 CSGVAVLIAGLYMVETIFDSYKDR 1554
             SG+ +L+A + +++ +   Y+++
Sbjct: 490  LSGLGLLLACILVIDKLVAKYRNK 513

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  507 bits (1305), Expect = e-174
 Identities = 246/524 (46%), Positives = 347/524 (66%)
 Frame = +1

Query: 4    DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 183
            DT  K +N+   + +   +  S  S    ++     ++ +LR PD F +  QE+ F+   
Sbjct: 70   DTMPKDQNLVCQNIMQFASFESSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVG 129

Query: 184  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 363
            ++ Q L+  G TQ LS MN+L  +LH++   + WL+A+FPL  G  IL+SGRLGDI+GLK
Sbjct: 130  VIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLK 189

Query: 364  KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 543
            K+L+LGY+I  IW+LI G S Y+HS   FI++R FQGLG++  LPN+  LIG+IYKP   
Sbjct: 190  KVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCF 249

Query: 544  KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 723
            KKNM+  I+GAMSPIGATLGG+F+GL    +  +WPW+FY++ + AF+N  I+++ IPN+
Sbjct: 250  KKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPND 309

Query: 724  IPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 903
            I  N   L MDWIGS  G+ GL++ NFV+NQ P DGW+                 F IYE
Sbjct: 310  IEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYE 369

Query: 904  LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 1083
            L  A  PL+P  I  N +LI+IL  +  GWG F IWTFYYF+F LNLR+YSPLWA  S F
Sbjct: 370  LTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNF 429

Query: 1084 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 1263
            + +ISGTI  I C   +++++P +LL FSM+GF  G I+F+VTP+HQT+FRN+ G+M + 
Sbjct: 430  VLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLF 489

Query: 1264 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 1443
            PLGM  SFP++S++ ++ LP  ++ MAGSLVN  INY+ S+ +G+AG+   + N +G DL
Sbjct: 490  PLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDL 549

Query: 1444 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCEN 1575
            L G+R A Y  I  SG +V ++GLYM+ +I   + DR +K  EN
Sbjct: 550  LHGFRAASYLAIGLSGFSVFLSGLYMIGSI---WTDRNQKMKEN 590

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  358 bits (919), Expect = e-117
 Identities = 189/517 (36%), Positives = 297/517 (57%), Gaps = 3/517 (0%)
 Frame = +1

Query: 13   LKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLS 192
            + KK+ +   Y+            N ES        S      F+   +EYAF+F+ +++
Sbjct: 1    MNKKHDKEDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMA 60

Query: 193  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 372
            Q  N AG T  L ++NVL+   H       +L+ S+P+V GSF+L+ GRLG+++G K+ L
Sbjct: 61   QAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETL 115

Query: 373  ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL--K 546
            + GY+IL++ SL+ GLS YS S IF++I RAFQG+G++L+LPN        Y+      +
Sbjct: 116  LGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHR 175

Query: 547  KNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 726
            K ++ +I+G  +  GA LG   SG+  T SE +W WA+Y YT+AA +   +SYYS+P+NI
Sbjct: 176  KTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI 235

Query: 727  PTNVNRLSMDWIGSFTG-VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 903
             T  N+  ++ +G F+    GL++ N   N A     N                 F ++E
Sbjct: 236  -TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFE 294

Query: 904  LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 1083
            L+++E+P+   E+  N  + ++L ++ FGWG++GIW+ Y+F F+LNLRNYSPL AG +Y 
Sbjct: 295  LKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYL 354

Query: 1084 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 1263
              VI G +  I    L+K+  P + L FS +GF    II SVTP+HQ+YFR+ LG+MI L
Sbjct: 355  TLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFL 414

Query: 1264 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 1443
             LG+D SFP+S+IIL + LP+++  M   L N + NY+ S + GI  +  +  + +  +L
Sbjct: 415  ALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALR--SLSSIEL 472

Query: 1444 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 1554
            ++ YR   YF I  S + +  AG+ +       Y+ +
Sbjct: 473  IKYYRYVYYFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
            (REAL)
          Length = 516

 Score =  358 bits (918), Expect = e-117
 Identities = 198/510 (38%), Positives = 293/510 (57%), Gaps = 7/510 (1%)
 Frame = +1

Query: 55   ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 234
            ET++ D    +DE    E K  SL           E AF+     +QL+  AG  Q+L+ 
Sbjct: 17   ETLKKDDEVLSDEFDVQEEKPESL---------LWESAFVGVLCSAQLMTQAGLGQSLAP 67

Query: 235  MNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 411
            ++++     +++  ++ W  +++ L  G+FIL++GRLGDI+G KK  +LG+    +WSL+
Sbjct: 68   LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127

Query: 412  TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 591
             G S YS+  IFF   RAFQG+G + +LPN + ++G  YKPG  +KNMV S+ GA +P G
Sbjct: 128  AGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGG 185

Query: 592  ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS------M 753
              LG +FS ++   +   WPWA++   +A F+     YY IP+    N +  S      +
Sbjct: 186  FVLGAVFSSMLGQLAW--WPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERI 243

Query: 754  DWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLP 933
            D+ GS TGV+GLILFNF WNQ P  GW                  F   E R A  PLLP
Sbjct: 244  DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AAFPLLP 302

Query: 934  SEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 1113
               + +     +L+ +  GW SFGIW FY + F+ + R  +PL +   +    ISG   A
Sbjct: 303  FAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 361

Query: 1114 ISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPA 1293
            +  GFL+    P+ ++ F+M  F +G I+ +  PVHQTY+     ++I++P GMD+SFPA
Sbjct: 362  LMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 421

Query: 1294 SSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYF 1473
            ++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E + N  G ++L+GYR + Y 
Sbjct: 422  ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYL 481

Query: 1474 GIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
            GI  SG  + +A  Y V T   S K   EK
Sbjct: 482  GIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
            paralog of ATR1, but not required for boron tolerance;
            member of the DHA2 family of drug:H+ antiporters; YOR378W
            is not an essential gene
          Length = 515

 Score =  348 bits (894), Expect = e-114
 Identities = 186/475 (39%), Positives = 280/475 (58%), Gaps = 7/475 (1%)
 Frame = +1

Query: 160  EYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSG 336
            E AF+     +QL+  AG  Q+L+ ++++     ++++ ++ W  +++ L  G+FIL++G
Sbjct: 42   ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 337  RLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLI 516
            RLGDI+G KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++
Sbjct: 102  RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 517  GMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
            G  YKPG  +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+   
Sbjct: 161  GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW--WPWAYWIMGIACFVLAV 217

Query: 697  ISYYSIPNNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXX 858
              Y+ IP+    + +  S      +D+ GS TGV+GLILFNF WNQ P  GW        
Sbjct: 218  AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 859  XXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 1038
                      F   E R A  PLLP   + +     +L+ +  GW SFGIW FY + F+ 
Sbjct: 278  LIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 335

Query: 1039 NLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPV 1218
            + R  +PL +   +    ISG   A++ GFL+    P+ ++ F+M  F +G I+ +  PV
Sbjct: 336  DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 1219 HQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGI 1398
            HQTY+     ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGI
Sbjct: 396  HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 1399 AGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
            AGT+E   N  G   L+GYR + Y GI  SG+ + +A  Y   T   S K   EK
Sbjct: 456  AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEK 510

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
            (REAL)
          Length = 516

 Score =  347 bits (891), Expect = e-113
 Identities = 184/475 (38%), Positives = 280/475 (58%), Gaps = 7/475 (1%)
 Frame = +1

Query: 160  EYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSG 336
            E AF+     +QL+  AG  Q+L+ ++++ +   +++  ++ W  +++ L  G+FIL++G
Sbjct: 43   ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 337  RLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLI 516
            RLGDI+G KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++
Sbjct: 103  RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 517  GMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
            G  YK G  +KNMV S+ GA +P G  LG +FS L+   +   WPWA++   +A F    
Sbjct: 162  GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQLAW--WPWAYWIMGIACFFLAI 218

Query: 697  ISYYSIPNNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXX 858
              Y+ IP+    + +  S      +D+ GS TGV+GLILFNF WNQ P  GW        
Sbjct: 219  AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 859  XXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 1038
                      F   E R A  PLLP   + +     +L+ +  GW SFGIW FY + F+ 
Sbjct: 279  LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 1039 NLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPV 1218
            + R  +PL +   +    +SG   A++ G+L+ +  P+ ++ F+M  F  G I+ +  PV
Sbjct: 337  DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 1219 HQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGI 1398
            HQTY+     ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGI
Sbjct: 397  HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 1399 AGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
            AGT+E + N  G   L+GYR + Y GI  SG+ + +A +Y   T   S K   EK
Sbjct: 457  AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEK 511

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
            (REAL)
          Length = 515

 Score =  347 bits (890), Expect = e-113
 Identities = 198/528 (37%), Positives = 299/528 (56%), Gaps = 13/528 (2%)
 Frame = +1

Query: 19   KKNIEVSSYIAEETIRSDCS------DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 180
            +KN+E S+    ET ++D        +  DE+P                S   E AF+  
Sbjct: 9    QKNLETSA----ETTKTDDEVLLNQFELQDETPG---------------SLVWEAAFVGV 49

Query: 181  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYG 357
               +QL+  AG  Q+++ ++++     +++  ++ W  +S+ L  G+FIL++GRLGDI+G
Sbjct: 50   LCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFG 109

Query: 358  LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 537
             +K  ILG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YKPG
Sbjct: 110  HRKFFILGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG 168

Query: 538  TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
              +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     Y+ IP
Sbjct: 169  K-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW--WPWAYWIMGIACFLLAVAGYFVIP 225

Query: 718  N-NIPT----NVNRLS-MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXX 879
            +  +P+    + N L  +D+ GS TGV+GLILFNF WNQ P  GW               
Sbjct: 226  HVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVF 285

Query: 880  XXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSP 1059
               F   E R A  PLLP   + +     +L  +  GW SFGIW FY + F+   R  SP
Sbjct: 286  LGVFVFIESR-AAYPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSP 343

Query: 1060 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 1239
            L +   +    ISG   A++ GFL+     + ++ F+M  F +G I+ +  PVHQTY+  
Sbjct: 344  LLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQ 403

Query: 1240 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH 1419
               ++I++P GMD+SFPA++I+LS+++P++HQG+A SLVNTV+NYS S+ LGIAGT+E  
Sbjct: 404  TFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQ 463

Query: 1420 CNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
             N  G + L+GYR + Y GI  SG+ + +A +Y   T   S K   EK
Sbjct: 464  VNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEK 511

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar to
            uniprot|Q08902 Saccharomyces cerevisiae YOR378W
            Hypothetical ORF
          Length = 515

 Score =  341 bits (874), Expect = e-111
 Identities = 184/474 (38%), Positives = 278/474 (58%), Gaps = 6/474 (1%)
 Frame = +1

Query: 160  EYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSG 336
            E AF+     +QL+  AG  Q+++ ++++     + +  ++ W  A++ L  G+FIL++G
Sbjct: 45   EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 337  RLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLI 516
            RLGD+YG KK  I+G+    +WSL+ G S YS+  IFF   RAFQG+G +L+LPN + ++
Sbjct: 105  RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGIGPALLLPNAIAIL 163

Query: 517  GMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
            G  Y PG  +K M++S+ GA +P G  LG +FS +    +   WPWA++A  +  F    
Sbjct: 164  GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIFGQLTW--WPWAYWAMGIVCFFLAV 220

Query: 697  ISYYSIPN----NIPTNVNRLS-MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXX 861
                 IP      + T+V+    +D  GS TGV+GL+L NF WNQ P  GW         
Sbjct: 221  AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 862  XXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLN 1041
                     F   E R A +PLLP   + +     +L  +  GW SFGIW +Y++ F+  
Sbjct: 281  IVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 1042 LRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVH 1221
            LR +SPL     +    ISG   A++ GF++ ++R ++++ F+M  F +G I+ +  PV 
Sbjct: 339  LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 1222 QTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIA 1401
            Q Y+     ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVN V+NYS S+ LG+A
Sbjct: 399  QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 1402 GTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 1563
            GTVE   N  G +LL+GYRGA Y GI  SG  +LIA +Y   T   S K   EK
Sbjct: 459  GTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W -
            Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  330 bits (847), Expect = e-107
 Identities = 179/489 (36%), Positives = 280/489 (57%), Gaps = 6/489 (1%)
 Frame = +1

Query: 85   NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 264
            N+E  S++L  S +  P    S  +E  F+     +QL+  AG  Q+++ + ++      
Sbjct: 17   NEEGESLQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73

Query: 265  SDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 441
            S+  ++ W  A++ L  G+FIL++GRLGD++G KK+ ++G++   +WSL+ G S YS+  
Sbjct: 74   SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ- 132

Query: 442  IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 621
            IFF   RA QG+G + +LPN + ++G  Y PG  +K MV SI GA +P G  LG +FS +
Sbjct: 133  IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSI 191

Query: 622  VATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS-----MDWIGSFTGVLG 786
             +  +   WPWA++A   A  +        IP   P  ++  +     +D  G+ TG+LG
Sbjct: 192  FSQLAW--WPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILG 249

Query: 787  LILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIM 966
            L L NF WNQ P  GW                  F + E R A  PLLP   + +  L  
Sbjct: 250  LALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAAL-STDLAY 307

Query: 967  ILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR 1146
            +L  +  GW SFGIW FY++ F+ + R+ SPL     +    ISG   A++ G+++  + 
Sbjct: 308  VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367

Query: 1147 PAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 1326
               ++  +M+ F +G ++ +  P++QTY+     ++II+P GMD+SFPA++I++S+ +P+
Sbjct: 368  ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427

Query: 1327 QHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLI 1506
            +HQG+A SLVNTV+NYS SL LG AGT+E   N  G + L GYRGA Y GI  SG+ VL+
Sbjct: 428  EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLV 487

Query: 1507 AGLYMVETI 1533
            A +Y   T+
Sbjct: 488  AIVYAWSTL 496

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
            similar to uniprot|Q08902 Saccharomyces cerevisiae
            YOR378W
          Length = 498

 Score =  329 bits (843), Expect = e-106
 Identities = 178/488 (36%), Positives = 282/488 (57%), Gaps = 6/488 (1%)
 Frame = +1

Query: 79   DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQL 258
            ++++E  S+ L+NS     ++ +   + +A +  C  +QL+  AG  Q++  + ++    
Sbjct: 7    NSHEEQDSLLLQNSR----EWTSLLKEGFAIMVLCS-AQLMTQAGLAQSIVPLQIIGDSF 61

Query: 259  HSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH 435
               +  ++ W  ++F L  G+FIL++GRLGD +G KK  ++G++   +WS++ G S YS+
Sbjct: 62   GIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN 121

Query: 436  SGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFS 615
              IFF   RAFQG+G +  LPN + +I   Y+PG  K+NM+ S+ GA +P G  +G +FS
Sbjct: 122  Q-IFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFS 179

Query: 616  GLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS-----MDWIGSFTGV 780
             L++  +   WPWA++   +  F+     Y  IP++ P + +        +D  GS TGV
Sbjct: 180  SLLSEFAW--WPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237

Query: 781  LGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQL 960
            +GLILFNF WNQ P  GW                  FG  E R A++PLLP   + +   
Sbjct: 238  VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSS-DT 295

Query: 961  IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKK 1140
            I ++  +  GW SFGIW +Y +  + NLR+  PL +   +    ISG   A+S  FL+ +
Sbjct: 296  IFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTR 355

Query: 1141 IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNL 1320
              P+ ++  +M+ F +G I+ +  PV QTY+     ++I++P GMD+SFPA++IILS  +
Sbjct: 356  TSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAM 415

Query: 1321 PNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAV 1500
            P  HQG+A SLVNT+INYS S+ LG AGT+E   +    DLL+GYRGA Y GI  +G+ +
Sbjct: 416  PASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGL 475

Query: 1501 LIAGLYMV 1524
             +A  Y +
Sbjct: 476  GVAISYAI 483

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
            YOR378W
          Length = 565

 Score =  221 bits (562), Expect = 2e-64
 Identities = 146/511 (28%), Positives = 246/511 (48%), Gaps = 14/511 (2%)
 Frame = +1

Query: 76   SDANDESPSMELKNSSLRNPDYF--NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLT 249
            SD N  +P+ E  +      +     S   E  F+     SQ+L LAG  Q +  M+V+ 
Sbjct: 48   SDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIV 107

Query: 250  ---RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGL 420
               +  H SDS   W    +    GSF+L++G++GD+ G K M ++GY  L +WSL+TG 
Sbjct: 108  EWFKLTHPSDS--GWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGF 165

Query: 421  SGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL 600
            S Y  S  FF   RA QG+G +    + L ++G  Y P   +KN + S  GA    G  L
Sbjct: 166  SRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRKNFIFSFFGACGSFGVVL 224

Query: 601  GGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI---PTNVNRLSMDWIGSF 771
            G +FS L    +   W WA+++  +A  +   +S + IP ++       N    D++G+F
Sbjct: 225  GMVFSALFTQLAH--WSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNVFYFDYLGAF 282

Query: 772  TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 951
              V GL+LF+  WNQAP  G+                    +Y     ++PLLP   I +
Sbjct: 283  LFVTGLVLFSVAWNQAPTYGFG-RTYVYVLLIVSVVILALAMYVETKVDDPLLPWTHI-S 340

Query: 952  RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 1131
               + +L A+ F + SF +W  Y F F L  +  + L A        +SG   A+    L
Sbjct: 341  ANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALL 400

Query: 1132 MK-KIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIIL 1308
            +   ++  + +  S++ F +  I+ +     QTY+  +  T I++  G+D+SFP+++++L
Sbjct: 401  LNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLL 460

Query: 1309 SDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH-----CNKNGTDLLRGYRGALYF 1473
            S+ +P++ +G+  SLV  V+NY+ +L    A +V ++         G    +      Y 
Sbjct: 461  SNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYV 520

Query: 1474 GIACSGVAVLIAGLYMVETIFDSYKDRKEKD 1566
            GI  +G+  L+A ++ V T +     +K +D
Sbjct: 521  GIGTAGLGTLVA-IFGVITEYPKVAGKKGED 550

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  219 bits (559), Expect = 3e-64
 Identities = 160/530 (30%), Positives = 259/530 (48%), Gaps = 21/530 (3%)
 Frame = +1

Query: 34   VSSYIAEETIRSDCSDANDESPSMELK-----NSSLRNPDY--FNSTTQEYAFIFSCMLS 192
            +S + +EET+ S  S      P+  +K     N  L   D    N   +E   +      
Sbjct: 1    MSFHESEETLTS--SKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSG 58

Query: 193  QLLNLAGTTQTLSIMNVL--TRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLK 363
            Q ++L G  Q +  M  +  T  L    +L++ W  A++   + +F++++G+LGDI G K
Sbjct: 59   QFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHK 118

Query: 364  KMLILGYVILVIWSLITGLSGYSHSG-IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 540
             M I GY  L +WSL+TG S Y+ +  +FF   R  QG+G + + P  L L+G  Y P  
Sbjct: 119  NMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP-C 177

Query: 541  LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 720
             +KN V S  GA  P G   G +FS L    +  +W W +++  +   I T +SY  IP 
Sbjct: 178  KRKNYVFSFYGACGPFGIVAGSVFSALFTQLT--TWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 721  NIPTNVNR---LSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXF 891
            +      R    S D++G F G+ G+ILF+ VWNQAP   +                   
Sbjct: 236  DNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMA 295

Query: 892  GIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAG 1071
             I + R  ++PL+P + + +  +I  L  + FG+  F IW FY + F L  +N S L A 
Sbjct: 296  LIIDSR-VKDPLIPWKSMCSN-VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAA 353

Query: 1072 GSYFIFVISGTITA-ISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILG 1248
              +    ISG   A  S   L KK+   + L  ++  F +  I+ S   + +TY+ N   
Sbjct: 354  AKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFV 413

Query: 1249 TMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAG-TVEQHCN 1425
              +I+ +G+D++FP+++++LS+ + N+ QG+A +L  T +NY  +L  G+A   +   C+
Sbjct: 414  ATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCD 473

Query: 1426 KNGTDLLRGYRGALYFGIACSG-VAVLIAGLYMVETIFDS----YKDRKE 1560
                D L    G     +  +G VA+  AG+ +V  IF S    YK+R +
Sbjct: 474  ----DCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMD 519

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  207 bits (526), Expect = 3e-59
 Identities = 153/544 (28%), Positives = 259/544 (47%), Gaps = 22/544 (4%)
 Frame = +1

Query: 4    DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 183
            +TD    +   +S +  +  +  CS+        +L++    NP    S  +E  FI   
Sbjct: 22   NTDHYLPSNSTASSLHSQRTKEQCSNLQPAQAQDQLESM---NPPPGPSRLRECMFIVII 78

Query: 184  MLSQLLNLAGTTQTLSIMNVLTR--QLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIY 354
              SQ ++LA  +Q +  M+ +T   QL +  SL+  W  A+F +  G+FI+ +G+L D+ 
Sbjct: 79   ASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLI 138

Query: 355  GLKKMLILGYVILVIWSLITGLSGYSHSG--IFFIIARAFQGLGISLVLPNVLGLIGMIY 528
            G K + I GY    +WSL+ G+S Y+  G   FF   R  QG+G + + P+ L L+G  Y
Sbjct: 139  GSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYY 198

Query: 529  KPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 708
             P + KKN+V S+ G   P+G  +GG+FS +    +   W W +++  + +   T IS +
Sbjct: 199  PP-SCKKNIVFSLYGFCVPLGVVVGGVFSAIFTQLAH--WSWNYWSMAIVSAFFTLISCF 255

Query: 709  SIPNN--IPTNVNRLSMDW--------IGSFTGVLGLILFNFVWNQAPADGWNXXXXXXX 858
             IP +  I +   +    W        +G+F  V  L+LF   WNQA    +        
Sbjct: 256  YIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVT 315

Query: 859  XXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 1038
                        I E  Y ++P++P+  I + Q I  L  + F + SF IW FY + +  
Sbjct: 316  LIVSLVCFVAMVIVEF-YVDDPIIPARKI-HPQTIKALLVVFFSYLSFTIWLFYLWKYFT 373

Query: 1039 NLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA-VLLTFSMVGFNLGCIIFSVTP 1215
             +RN + L     +    I+G I A+    L+    P  + L      F L  I+F    
Sbjct: 374  VVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLS 433

Query: 1216 VHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLG 1395
              ++Y+     T+II+ +G+D+SFP+++++LS+ +P + +G++ +LV T +NY   +   
Sbjct: 434  RTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPP 493

Query: 1396 IAGT-VEQHCNK-----NGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRK 1557
            IA T +   C+K     +    ++    A   GI  SG+AV++ GLY   T +       
Sbjct: 494  IAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV-GLYGTVTEYSWETHSY 552

Query: 1558 EKDC 1569
             K C
Sbjct: 553  SKRC 556

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] {ON}
            similar to uniprot|Q08902 Saccharomyces cerevisiae
            YOR378w
          Length = 529

 Score =  199 bits (507), Expect = 9e-57
 Identities = 146/510 (28%), Positives = 247/510 (48%), Gaps = 13/510 (2%)
 Frame = +1

Query: 67   SDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVL 246
            S  SD    +  +   ++S+R P    +  +E   +   + SQL+ L G  Q + I   L
Sbjct: 10   STSSDTEYSAEKLTEVDTSIRLP---KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYL 66

Query: 247  TRQLH---SSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITG 417
              +     +   L  W  AS+ L S   +L++G+LGD+ G K+M++ G++ L IWSLITG
Sbjct: 67   RERYRIEPAKGGLVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITG 126

Query: 418  LSGYSHSG-IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 594
             S Y      F+  ARA QG+G   ++PN L ++G  Y    LKK ++ SI G M+  G 
Sbjct: 127  FSYYDRGNQAFYYTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGF 186

Query: 595  TLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSI-PNNIPTNVNRLSM----DW 759
             +G  FS L A  ++  W W ++A      + T  +   I P+NI    N   +    D+
Sbjct: 187  VIGTTFSSLFAQLTK--WAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDY 244

Query: 760  IGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSE 939
            +G+ TGV GL+LF+  + QA A GW+                     + R  ++PL+P +
Sbjct: 245  LGAITGVSGLVLFDVAFTQASALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQ 303

Query: 940  IIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF---IFVISGTIT 1110
             +R   +++IL  + FG+ SF IW  +++ F   + N SPL          I  I   I 
Sbjct: 304  HLR-ADVVVILICVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIF 362

Query: 1111 AISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFP 1290
             ++C  L   I+   ++  SMV F +  I+ +    + TY+     + II P  +D++ P
Sbjct: 363  TVTC--LQLNIKAPTMMVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVP 420

Query: 1291 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLL-RGYRGAL 1467
             ++++ SD++  + QG+A SL+ TVI+Y+ S+       V  +    G D    G+  +L
Sbjct: 421  TATLLFSDSVRKESQGIAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSL 480

Query: 1468 YFGIACSGVAVLIAGLYMVETIFDSYKDRK 1557
            +    C    ++++G+ +V  +     D K
Sbjct: 481  HSNFIC---GIVLSGIGLVTAVIAGLIDYK 507

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  180 bits (457), Expect = 4e-49
 Identities = 145/555 (26%), Positives = 261/555 (47%), Gaps = 67/555 (12%)
 Frame = +1

Query: 55   ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 234
            ET++   S     S  + L+   L++P   NS   +  FIF    SQ + LA  +Q +  
Sbjct: 40   ETVQDQQSHKVTHSSLIRLQK--LQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQ 95

Query: 235  MNVLTR--QLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 405
            M+ L+   ++  + +L++ W+ ASF +  G+FI+++G+L DI   + + I GYV   +W+
Sbjct: 96   MDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWT 155

Query: 406  LITGLSGYSHSGIFFI-IARAFQGLGISLVLPNVLGLIGMIY-------------KPGT- 540
            LITG + Y    + F+ I R  QG+G +L+ P+ L L+   Y              P T 
Sbjct: 156  LITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTS 215

Query: 541  --------------------------------LKKNMVISIVGAMSPIGATLGGLFSGLV 624
                                              K++  S+ GA +P+G  +GG+FS + 
Sbjct: 216  APSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF 275

Query: 625  ATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP-----TNVNRL----SMDWIGSFTG 777
               +  +WPW +++ ++   + + +SY+ +   IP     +N N L    + D++G   G
Sbjct: 276  TQLA--TWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 778  VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQ 957
            +  LILF   W+QA    +                    I+E  Y  NP++P   I +  
Sbjct: 334  ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEY-YFNNPIIPIRQI-HPG 391

Query: 958  LIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA-ISCGFLM 1134
             I  L  + F + SF  W FY +     +++ SP+     +    ++G I+A  S   ++
Sbjct: 392  TIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIV 451

Query: 1135 KKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSD 1314
            K++   + L      F L  I+     +  +Y+     ++I + +G+D+SFP+++++L++
Sbjct: 452  KRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTN 511

Query: 1315 NLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH-CNKNGTD------LLRGYRGALYF 1473
             +P + QG+  +LV +V+NY  ++   IA T+ Q+ C    +D       L+G   A   
Sbjct: 512  GIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAV 571

Query: 1474 GIACSGVAVLIAGLY 1518
            G+ CSG+AVLI G+Y
Sbjct: 572  GVGCSGIAVLI-GIY 585

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  162 bits (410), Expect = 1e-46
 Identities = 88/190 (46%), Positives = 118/190 (62%)
 Frame = +1

Query: 184 MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 363
           M+SQLLN  GTTQTL ++NVL+R   SS + +  LVAS PLVSGSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 364 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 543
             L+ GY  +++WS I GL+ Y+ S  FF+IARAFQGLG++ VLPNV+G +  +Y  G++
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 544 KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 723
           +KNMV                                  YAYT+A  +N  +  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 724 IPTNVNRLSM 753
           IPTNV   +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 38.1 bits (87), Expect = 0.024
 Identities = 43/149 (28%), Positives = 63/149 (42%)
 Frame = +1

Query: 1000 FGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVG 1179
            FG  T   +SF+  L  Y+     GS   FVI+     +   F++    P V+ T S V 
Sbjct: 65   FGYATVIVWSFICGLTRYA-----GSVQFFVIARAFQGLGLAFVL----PNVMGTVSNV- 114

Query: 1180 FNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVN 1359
            +  G I  ++          +    + + L M L   A    L  N+P   +G A     
Sbjct: 115  YIAGSIRKNM----------VYAYTVAVSLNMALCVWA----LPWNIPTNVRGQA----- 155

Query: 1360 TVINYSNSLFLGIAGTVEQHCNKNGTDLL 1446
             ++ YS  + LGIAGTVE   +K G D L
Sbjct: 156  -MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (REAL)
          Length = 540

 Score = 82.0 bits (201), Expect = 9e-16
 Identities = 111/488 (22%), Positives = 191/488 (39%), Gaps = 41/488 (8%)
 Frame = +1

Query: 166  AFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLG 345
            A IF      LLN+A     +S+++ L ++   S +   W + S+ +    FI   GRLG
Sbjct: 32   ALIFLGCTFDLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLG 88

Query: 346  DIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMI 525
            DI G   +  +      I SL+  +     +   F + RA QG+  + ++P    LI M+
Sbjct: 89   DIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPML 145

Query: 526  YKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISY 705
                 ++K   I   G  S IG  LG +  G  A    G +   FY      F+ + +++
Sbjct: 146  APEEEVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKIG-YKGIFYLTFAVMFLISIVAF 202

Query: 706  Y--------SIPNNIPTNVNRL-SMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXX 858
            +        S P       NR+ S+D+IGS   V G IL   V      + WN       
Sbjct: 203  FFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILI-VVGLTEGGESWNRPATYVT 261

Query: 859  XXXXXXXXXXF-----------------GIYELRYAENP--LLPSEIIRNRQLIMILTAM 981
                      F                 GI   RY E    L+P +++  +  I I+ A 
Sbjct: 262  LVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKVQLLIPVDVLFMKNFIPIVLAF 321

Query: 982  TFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLL 1161
                       +    +       SPL+AG      +I   I    C F   K++P V +
Sbjct: 322  ALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGV 381

Query: 1162 TFSMVGFNL---GCIIFSVTPVH----QTYFRNILGTMIILPLGMDLSFPASSIILSDNL 1320
               ++GF+L   G II  +T +H      +++    +  ++  G+ + +P +  I     
Sbjct: 382  ---VLGFSLALAGSII--LTQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGA 436

Query: 1321 PNQHQGMAGSLVNTV----INYSNSLFLGIAGTVEQHCNKNGTD--LLRGYRGALYFGIA 1482
            P++ +G+A  +  T     I  + S+   + G ++    K+G       G++   YF +A
Sbjct: 437  PDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVA 496

Query: 1483 CSGVAVLI 1506
               +  L+
Sbjct: 497  VGALGFLV 504

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 81.6 bits (200), Expect = 1e-15
 Identities = 109/515 (21%), Positives = 193/515 (37%), Gaps = 37/515 (7%)
 Frame = +1

Query: 82   ANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLH 261
            AN      E++N   ++P   N        IF      LLN+A     +S+++ L ++ +
Sbjct: 7    ANLTKALQEIRNKCQKSPYQLNVNV---GLIFLGCTFDLLNVASM---ISLIDDLAKKYN 60

Query: 262  SSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 441
             S +   W + S+ +    FI   GRLGDI G   +  +      I SL+  +     + 
Sbjct: 61   ISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFPA- 119

Query: 442  IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL--GGLFS 615
              F + RA QG+  + ++P    LI ++     ++K   I   G  S IG  L  GG F+
Sbjct: 120  --FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFA 177

Query: 616  GLVATESEGSWPWAFYAYTLAAFINTFISYY-----SIPNNIPTNVNRLSMDWIGSFTGV 780
                    G +   F   +L + I  F +Y        P  I    +  S+D+IGS   V
Sbjct: 178  A-TKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFV 236

Query: 781  LGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAE-------------- 918
             G IL   V      + WN                 F ++   YA+              
Sbjct: 237  AGSILI-VVGLTEGGESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSK 295

Query: 919  -----NPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 1083
                   L+P +++  +  I I+ A            +    +       SPL AG    
Sbjct: 296  YFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLV 355

Query: 1084 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNL---GCIIFSVTPV--HQTYFRNILG 1248
              +I   +    C F   K++P V +    +GF+L   G II     +     +++    
Sbjct: 356  PLIICMVVGNALCAFESTKLKPRVGVA---LGFSLALAGSIILIQLHLIKDNVFWKIFFS 412

Query: 1249 TMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLGIAGTVEQ 1416
            +  ++  G+ + +P +  I     P+Q +G+A  +  T     I  + S+   + G + +
Sbjct: 413  SQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINE 472

Query: 1417 HCNKNGT--DLLRGYRGALYFGIACSGVAVLIAGL 1515
               K     +   G++   YF +A   +  L+  +
Sbjct: 473  MKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAI 507

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
            uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
            efflux permease KNQ1
          Length = 553

 Score = 81.3 bits (199), Expect = 2e-15
 Identities = 111/517 (21%), Positives = 208/517 (40%), Gaps = 36/517 (6%)
 Frame = +1

Query: 142  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
            F+  T ++      +++  L+LA     + ++  +  + + S +   W + S+ +    F
Sbjct: 15   FHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGF 74

Query: 322  ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
            I   GR+GDI G   M+ +  VI  I+SL   L     + I F + RAFQG+  + ++P 
Sbjct: 75   IAFFGRVGDIVGNGIMMCVFSVIFGIFSL---LCAVVPNFIAFTVFRAFQGMAGAGIVPC 131

Query: 502  VLGLIGMIYKPGTLKK--NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYA-YT 672
               L+  +++   L++  +++ S++ AM+ +G  +GG F G  A   +  + + F A   
Sbjct: 132  AYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAF-GETALGYKSFFYFLFAASLA 190

Query: 673  LAAFINTFISYYSIPNNIPTNVNRL----SMDWIGSFTGVLGLILFNFVWNQAPADGWNX 840
             AA I   I Y  +  N  +   +      +D IG    + G IL      Q   + WN 
Sbjct: 191  TAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGLTQG-GESWND 249

Query: 841  XXXXXXXXXXXXXXXXFGIYELRYA--------------------ENPLLPSEIIRNRQL 960
                            F ++ L YA                     N L+P  ++ +   
Sbjct: 250  PTAYVPLAVSIVLLIIFFMWNLGYAVVLKLIKPISTHKGYAYMESVNLLIPKNLMFSHNF 309

Query: 961  IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF------VISGTITAI-S 1119
            I +L A  F +  F +  +        + NYS    G S  +       +ISG + A  +
Sbjct: 310  IPVLLATFFLFCGFMVVMYV-------IANYSATVEGNSMIVASIKIIPMISGLVLANGT 362

Query: 1120 CGFLMKKIRPA-VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGT-MIILPLGMDLSFPA 1293
              +     +P   L+  S +    G     +  V    F  +         LG    F  
Sbjct: 363  VAYKQDLFKPKNALVVGSFISILGGAFFVPIKYVDDNLFWKLFFMGGFFTGLGGAFFFCY 422

Query: 1294 SSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYF 1473
               +   + P+Q++ +AG +V T   + N + L I  ++  +   +  DL   ++ A Y 
Sbjct: 423  MITMAIGDAPDQYKALAGGIVQTSGQFGNEVSLSIVISLLGNQTTDKADLRDRFQNASYI 482

Query: 1474 GIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ 1584
             I  + ++ L++ L++V+   +S  D +EK    C +
Sbjct: 483  VITAATISTLVS-LFLVKGPLESSGD-EEKQLSECSE 517

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
            conserved hypothetical protein
          Length = 544

 Score = 79.7 bits (195), Expect = 5e-15
 Identities = 109/518 (21%), Positives = 196/518 (37%), Gaps = 47/518 (9%)
 Frame = +1

Query: 115  NSSLRNPDYFNSTTQEYAF-----IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLK 279
            N+ ++  D   S  Q  +F     +   M+S   +L   T  LS    +        +  
Sbjct: 3    NTIIKTRDSIRSNFQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTA 62

Query: 280  VWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIA 459
             W + ++ +    FI   GR+GDI G   + +    +  I SLI  +   ++ G F +  
Sbjct: 63   SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAV--VNNFGTFAVF- 119

Query: 460  RAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP--IGATLGGLFSGLVATE 633
            RA QG+  + ++P+   LI  +     ++    I   G  +   IG  +GG F     T 
Sbjct: 120  RALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAF-----TL 174

Query: 634  SEGSWPWAFYAYTLAAFINTFISYYSI---PNNIPTN---------VNRLSMDWIGSFTG 777
            +   +   FY       + + ISY+SI    N  P            + LS+D+IGSF  
Sbjct: 175  TRIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMF 234

Query: 778  VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY---------AENP-- 924
            +   IL   V      + W                  F I+ + Y         A NP  
Sbjct: 235  ISSTILI-VVGLTEGGESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKV 293

Query: 925  ---------LLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 1077
                     L+P +++  +  I I  A+   +G      +    +   +   SPL A   
Sbjct: 294  YNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVK 353

Query: 1078 YFIFVISGTITAISCGFLMKKIRP--AVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGT 1251
                V+S  I  +        I P  AV+L F ++      +I         Y++    +
Sbjct: 354  LLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCS 413

Query: 1252 MIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLGIAGTVEQH 1419
              ++  G  + FP S  IL    P++++G+A  ++ T     +  + S+   I G + + 
Sbjct: 414  QSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINEL 473

Query: 1420 CNKNGTDLL--RGYRGALYFGIACSGVAVLIAGLYMVE 1527
              K+G+  +    ++   YF +A S V ++    ++ E
Sbjct: 474  SGKSGSAGIYKTRFQNCTYFTLASSVVGLISTAFFVKE 511

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 77.4 bits (189), Expect = 3e-14
 Identities = 104/486 (21%), Positives = 180/486 (37%), Gaps = 38/486 (7%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            IF      LLN+A     +S+++ L +  + S +   W + S+ +    FI   GRLGDI
Sbjct: 34   IFLGCTFDLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDI 90

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
             G   +  +      + SL+  +     +   F + RA QG+  + ++P    LI ++  
Sbjct: 91   IGNSVLFTISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAP 147

Query: 532  PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES---EGSWPWAFYAYTLAAFINTFIS 702
               ++K   I   G  S IG  LG +  G  AT      G +   F   TL + I  F +
Sbjct: 148  KEKVQKYFSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFT 205

Query: 703  Y-----YSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXX 867
            Y        P     + +  S+D+IGS   V G IL   V      + WN          
Sbjct: 206  YGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILI-VVGLTEGGESWNRPVTYVTLVI 264

Query: 868  XXXXXXXFGIYELRYAE-------------------NPLLPSEIIRNRQLIMILTAMTFG 990
                   F ++   Y +                     L+P +++  +  I I+ A    
Sbjct: 265  GIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALN 324

Query: 991  WGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFS 1170
                    +    +       SPL AG      +I   I    C F   K+RP V +   
Sbjct: 325  NACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVA-- 382

Query: 1171 MVGFNL----GCIIFSVTPVHQTYFRNI-LGTMIILPLGMDLSFPASSIILSDNLPNQHQ 1335
             +GF L      I+  +  V +  F  I      ++  G+ + +P +  I     P++ +
Sbjct: 383  -IGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESR 441

Query: 1336 GMAGSLVNTV----INYSNSLFLGIAGTVEQHCNKNGT--DLLRGYRGALYFGIACSGVA 1497
            G+A  +  T     I  + S+   + G + +   K+        G++   YF +A   + 
Sbjct: 442  GIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALG 501

Query: 1498 VLIAGL 1515
             L+  +
Sbjct: 502  FLVTAI 507

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
            YDR119W
          Length = 631

 Score = 72.0 bits (175), Expect = 2e-12
 Identities = 91/395 (23%), Positives = 165/395 (41%), Gaps = 19/395 (4%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            W+  S+ L S +F  + G++ DI+G K +L+   V  +I  L+ GL   S S  + +IAR
Sbjct: 150  WIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLVIAR 206

Query: 463  AFQGLG----ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
               G+G     S+    +  L+ +       ++ M   I      +G   GG+  G   +
Sbjct: 207  FVAGVGGGGLTSMSSITITDLVPL------RERAMYQGICNVFYGLGTACGGIVGGWF-S 259

Query: 631  ESEGSWPWAFYAYTLAAFIN--TFISYYSIPN-----NIPTNVNR--LSMDWIGSFTGVL 783
            +++G W  AF      + I+    I +  +P+     N   ++ R  L++DW+G+ T V+
Sbjct: 260  DNKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLVI 319

Query: 784  GLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQL 960
             L+LF    +    +  +                  F   ELR A +P+LP   +  R +
Sbjct: 320  FLVLFLLTASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSV 379

Query: 961  IMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 1131
            +    +  F   +    ++Y   YFS VLN+   SP   G        S    ++  G+ 
Sbjct: 380  LGSSLSNWFCMMATMTTSYYLPIYFSGVLNM---SPTDVGKRLMPNFFSVAFGSLGAGYY 436

Query: 1132 MKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 1305
            MKK R      L F  V       I  + P   T+ + IL  +++  +G  +    + + 
Sbjct: 437  MKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQYIL--LLVPGVGTSVLITVALLA 494

Query: 1306 LSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
            +   +P++HQ    S+     +   +L + I G +
Sbjct: 495  MIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
            weakly similar to uniprot|Q04602 Saccharomyces cerevisiae
            YDR119W Uncharacterized transporter
          Length = 590

 Score = 69.7 bits (169), Expect = 8e-12
 Identities = 108/500 (21%), Positives = 201/500 (40%), Gaps = 31/500 (6%)
 Frame = +1

Query: 4    DTDLKKKNIEVSSYIAEETIR----------SDCSDANDESPSMELKNSSLRNPDYFNST 153
            D  L+  + ++  ++AEE             +D    ++E  S +   SS   PD     
Sbjct: 22   DDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDNEDDSRDGVASSPVPPDKLLVI 81

Query: 154  TQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVS 333
            T       S  L   L  A  T   +IM  +  + +    +  W+  ++ L S +F  + 
Sbjct: 82   T------LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS-WIATAYLLSSATFQPLY 134

Query: 334  GRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG-------ISLV 492
            G+L DI+G K +L+L  ++ ++  L+ GL+  S  G+  + AR   G+G        S+ 
Sbjct: 135  GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP-SFWGL--VGARFISGIGGGGVTSMCSIT 191

Query: 493  LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYT 672
            + +++ L     +   L + M     G  +  G  +GG FS     +  G W  AF    
Sbjct: 192  ISDIVPL-----RDRALYQGMCNFFFGLGTACGGVVGGWFS-----DHGGGWRMAFLIQV 241

Query: 673  -LAAFINTFISYY------SIPNNIPTNVNR--LSMDWIGSFTGVLGLILFNFVWNQAPA 825
             L+A  +  I+ +      S   N P ++    LS+DWIG+   V+ L LF    +    
Sbjct: 242  PLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTASLGGK 301

Query: 826  D-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSF 1002
            +  +N                 F   EL  A++P+LP   +RNR ++    +  F   + 
Sbjct: 302  EIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAM 361

Query: 1003 GIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSM 1173
               ++Y   Y+S VLN+   +P   G        S  + ++  G+ MK+      LT   
Sbjct: 362  MTTSYYLPIYYSGVLNM---NPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGF 418

Query: 1174 VGFN-LGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGS 1350
               + LG +  ++       +R  +  ++I   G  +    + + +   +P+ H     S
Sbjct: 419  CTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTS 477

Query: 1351 LVNTVINYSNSLFLGIAGTV 1410
            +     +  ++L + I G +
Sbjct: 478  ISYAFRSTGSTLGVSIGGAI 497

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..98923)
            [1932 nt, 644 aa]
          Length = 643

 Score = 68.6 bits (166), Expect = 2e-11
 Identities = 94/404 (23%), Positives = 161/404 (39%), Gaps = 28/404 (6%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            W+  ++ L S +F  + G++ DI+G K +LI   +   + SLI GL   S S  + +  R
Sbjct: 160  WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGL---SPSFEWLVAGR 216

Query: 463  AFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 621
               G+G        S+   +++ L       G         I      +G  LGG+  G 
Sbjct: 217  FIAGIGGGGITSMSSITTSDIVPLRNRALYQG---------ICNFYFGLGTALGGVVGGW 267

Query: 622  VATESEGSWPWAFYAYTLAAFINT--FISYYSIP------------NNIPTNVNRLS-MD 756
             +  S G W  +F      AF +T   I +  +P            N   T   RLS +D
Sbjct: 268  FSDRSVG-WRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVD 326

Query: 757  WIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLP 933
            WIG+ T VL L  F    +    +  +                  FG  EL+ A++P+LP
Sbjct: 327  WIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILP 386

Query: 934  SEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGT 1104
               +++R ++    +  F   +    ++Y   YF+ VLN++   P   G        S  
Sbjct: 387  LRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRIIPNFFSTA 443

Query: 1105 ITAISCGFLMKKIRPAVLLTFSM-VGFNLGCI-IFSVTPVHQTYFRNILGTMIILPLGMD 1278
              ++  G+ MKK         S  V  ++GC+ I  + P    + +  L  M I  LG  
Sbjct: 444  FGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTL--MFIPGLGAS 501

Query: 1279 LSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
            +    + + +   +P+ HQ +  S+     +   +L + I G +
Sbjct: 502  VLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI 545

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 68.6 bits (166), Expect = 2e-11
 Identities = 88/401 (21%), Positives = 154/401 (38%), Gaps = 25/401 (6%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            W+  ++ L S +F  + G+L DI+G + +L+   ++  + +LI G+   S +    ++ R
Sbjct: 179  WIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGM---SKNLWVLVLGR 235

Query: 463  AFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 621
               G+G        S+   +++ L       G         I      +G   GGL  GL
Sbjct: 236  FVAGIGGGGLTSMCSITTTDIVPLRSRALYQG---------ICNVFFGLGTACGGLVGGL 286

Query: 622  VATESEGSWPWAFYAYTLAAFINT--FISYYSIP-----------NNIPTNVNRLSMDWI 762
             A  + G W  AF        ++T     + ++P            +IP       +DW 
Sbjct: 287  FADRAVG-WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWT 345

Query: 763  GSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEI 942
            G+ T V+ L  F  V       G +                 F  +EL  A +P+LP   
Sbjct: 346  GTVTLVVFLFCFTLV---CSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRF 402

Query: 943  IRNRQLIMILTAMTF---GWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 1113
            + NR ++    +  F   G  + G +   Y++ VLN+    P   G        S    +
Sbjct: 403  LENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPTDIGKRIVPSFFSTAFGS 459

Query: 1114 ISCGFLMKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSF 1287
            +  G+ MK+       LL F +VG      I  VTP   T+ +  L   +I   G  +  
Sbjct: 460  LGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCL--YMIPGFGSAVLL 517

Query: 1288 PASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
              + + L   +P +HQ    S+     +  ++L + I G +
Sbjct: 518  TVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAI 558

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
            (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 67.8 bits (164), Expect = 3e-11
 Identities = 99/487 (20%), Positives = 188/487 (38%), Gaps = 43/487 (8%)
 Frame = +1

Query: 175  FSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIY 354
            F C    LLN+AG    +  +    +  ++  S   W + S+ +    FI   GRLGDI 
Sbjct: 35   FGCTFD-LLNVAGVISVIEDLGETYKLGYTGAS---WALTSYAITFAGFIAFMGRLGDIV 90

Query: 355  GLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKP 534
            G   +  +   +  ++SL   L         F + RA QG+  + ++P    LI ++ +P
Sbjct: 91   GNSVLFTISCFLFTLFSL---LCAVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEP 147

Query: 535  GTLKKNMVISIVGAMSPIGATL--GGLF-------SGLVATESEG----SWPWAFYAYTL 675
              ++K   I   G  S IG  L  GG F       +G+      G    S   +FY Y +
Sbjct: 148  QDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRI 207

Query: 676  AAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXX 855
                   +    IP++ P      S+D++GS   V G +L      +   + W       
Sbjct: 208  EERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVSGSVLIVAGLTEG-GESWRRPVAYV 263

Query: 856  XXXXXXXXXXXFGIYELRYAE-------------------NPLLPSEIIRNRQLIMILTA 978
                       F I+   Y +                     L+P +++     I I+  
Sbjct: 264  PFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPII-- 321

Query: 979  MTFGWGSFGIWTFYYF--SFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA 1152
            ++F   +  +++  Y    +   +   SPL AG      ++S  I   +C     ++RP 
Sbjct: 322  LSFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPK 381

Query: 1153 VLLTFSMVGFNLGCIIFSV--TPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 1326
            V +    +    G II     T  +  +++    + I + LG  + +P +  ++    P+
Sbjct: 382  VGVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPD 441

Query: 1327 QHQGMAGSLVNTV----INYSNSLFLGIAGT---VEQHCNKNGTDLLRGYRGALYFGIAC 1485
              +G+A  +  T     +  + S+ + + G    V++  N   T   R ++   YF +A 
Sbjct: 442  GAKGIASGMTQTFAQFGVEVTFSVMVSVLGNITDVKETLNSQETFKDR-FQNCAYFSVAV 500

Query: 1486 SGVAVLI 1506
            + + +++
Sbjct: 501  AALGLIL 507

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa] {ON}
            weakly similar to uniprot|Q04602 Saccharomyces cerevisiae
            YDR119W Uncharacterized transporter
          Length = 657

 Score = 62.4 bits (150), Expect = 2e-09
 Identities = 102/470 (21%), Positives = 186/470 (39%), Gaps = 30/470 (6%)
 Frame = +1

Query: 91   ESPSMELKNSSLRNPDYFNSTTQE-YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 267
            E+ S+E KN++  +P          Y  IF   L+ L N   +T    I +      H S
Sbjct: 111  ETSSIEAKNNTGLSPARIKIIMGSMYLGIF---LASLDNTIVSTLLAHIASEFNEMPHIS 167

Query: 268  DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 447
                 W+  ++ L S +F  + G++ DI+G K +LI   V+  +  LI GLS     G++
Sbjct: 168  -----WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS----PGLW 218

Query: 448  FIIA-RAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             ++A R   G+G        S+   +++ L     +   L + +     G  +  G  +G
Sbjct: 219  CLVAGRFIAGIGGGGLTSMSSITTSDIVPL-----RNRALYQGICNFFFGLGTACGGLVG 273

Query: 604  GLFSGLVATESEGSWPWAFYAY--TLAAFINTFISYYSIP-------------NNIPTNV 738
            G FS     E  G W  AF       A   +  ++Y  +P             N I   +
Sbjct: 274  GWFS-----EHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKL 328

Query: 739  NRLSMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYA 915
             R+  DW G+ + V+ L+LF    +    +  +                  F   E   +
Sbjct: 329  RRI--DWFGALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVS 386

Query: 916  ENPLLPSEIIRNRQLIMILTAMTFGWGS-FGIWTFYYF--SFVLNLRNYSPLWAGGSYFI 1086
            ++P+LP   ++NR    IL +    W S  G+ T  YF   +   + N  P   G     
Sbjct: 387  KDPILPVAFLKNR---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIP 443

Query: 1087 FVISGTITAISCGFLMKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII 1260
               S  + ++  G+ MKK      +L+ F  +   +G +  S+   +   +R  +  ++I
Sbjct: 444  SFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAV-VGQLQISLIEPNIAVWRQYI-LLVI 501

Query: 1261 LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
               G+ +    + + +   +P++HQ    S+     +   +L + I G +
Sbjct: 502  PGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] {ON} 
            possible pseudogene; N added at two sites to avoid
            frameshifts
          Length = 497

 Score = 60.8 bits (146), Expect = 4e-09
 Identities = 93/440 (21%), Positives = 162/440 (36%), Gaps = 34/440 (7%)
 Frame = +1

Query: 199  LNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLIL 378
            ++L   +  +S+++ L+ +   S +   W + S+ +    FI   GRLGDI G  ++  +
Sbjct: 40   IDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTV 99

Query: 379  GYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMV 558
                  I SL+ GL     +   F + RA QG+  + ++     LI ++     +++   
Sbjct: 100  SCGCFAILSLLCGLMPNFEA---FAVMRALQGIAAAGLVMCGYALIPILSPKEQVQEYFS 156

Query: 559  ISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN----- 723
            I   G  S IG    G   G      +G +   F A TL   +  F +     N      
Sbjct: 157  IVSCGFSSTIGI---GFIIGGAXXGYKGIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLE 213

Query: 724  -IPTNVNRLSMDWIGSFTGVLGLILF-------NFVWNQAPA--------------DGWN 837
               +     S+D+IGS   + G IL           W +A A                WN
Sbjct: 214  VKESTATVASLDFIGSLIFITGSILIVVGLTEGGESWREAKAYVTFAIGIILFLSFFAWN 273

Query: 838  XXXXXXXXXXXXXXXXXFGIYELRYAEN-PLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 1014
                              GI   +Y E   LL    I     I++  AM        I+ 
Sbjct: 274  -----CFYLKIVNGIRLIGIDTTKYFEKVQLLVPLNIHFMTXIVLAFAMNNACPFSSIYI 328

Query: 1015 FYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGC 1194
               +S      N SPL AG      +IS  I    CG    ++RP   +T        G 
Sbjct: 329  IDQYS--QYKENDSPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALSGS 386

Query: 1195 IIFSVTPV--HQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV- 1365
            II +      +  +++      +++  G+ + +P +  +     P++ +G+A  +  T  
Sbjct: 387  IILTQLRAVKYDVFWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQTFG 446

Query: 1366 ---INYSNSLFLGIAGTVEQ 1416
               I  + S+   + G +E+
Sbjct: 447  QLGIEIAFSIMASVLGNIEE 466

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
            Anc_8.272 YDR119W
          Length = 906

 Score = 59.7 bits (143), Expect = 1e-08
 Identities = 79/391 (20%), Positives = 160/391 (40%), Gaps = 15/391 (3%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            W+  S+ L S  F  + G+L DI+G K +LI   +I     +I G+S   +  ++     
Sbjct: 436  WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVA 495

Query: 463  AFQGLGI-SLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESE 639
               G GI S+    V  ++ +  +   + + +     G  +  G  +GG+F      + +
Sbjct: 496  GIGGGGITSMTTITVSDIVPL--RSRAVYQGICNFFFGLGTAFGGVIGGIF-----VDHQ 548

Query: 640  GSWPWAFYAYTLAAFINTFI--SYYSIP--NNIPTNVNR--LSMDWIGSFTGVLGLILFN 801
              W   F++    + ++T +  S+  +P   N   ++ R  + +DW+GS + +L L  F 
Sbjct: 549  YGWRMVFWSQVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGSISMILWLTSFL 608

Query: 802  FVWNQAPADGW--NXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILT 975
             +           +                 F + EL  A +P+LP   + NR ++    
Sbjct: 609  LITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASL 668

Query: 976  AMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR 1146
               F    F    FY   YF+ VL++   SP   G       +   + ++  G  MK+  
Sbjct: 669  GNFFCVMGFMTICFYLPIYFASVLDI---SPTGIGKRMAPNFLCTALGSLGAGVYMKQTG 725

Query: 1147 PA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILP-LGMDLSFPASSIILSDN 1317
                 ++ F++V   LG    ++ P+  T    +   +++LP +G  +    + + +   
Sbjct: 726  KYYWFVVLFALVS-TLGHYYLTLIPL--TVSITVQYLLVVLPGVGSSIIIVVALLAMIAA 782

Query: 1318 LPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
            +P++HQ    S+     +   +L + +  +V
Sbjct: 783  VPHKHQAATTSISYAFRSTGGTLGVALGSSV 813

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa] {ON}
            conserved hypothetical protein
          Length = 551

 Score = 58.2 bits (139), Expect = 3e-08
 Identities = 105/524 (20%), Positives = 188/524 (35%), Gaps = 51/524 (9%)
 Frame = +1

Query: 166  AFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLG 345
            A IF      LLN+AG    +S++  L        +   W + S+ +     I   GRLG
Sbjct: 35   ALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLG 91

Query: 346  DIYGLKKML-ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
            DI G   +  I G+   +   L   ++ +      F + RA QG+  + ++P    LI  
Sbjct: 92   DIIGNSVLFTISGFFFSLFCLLCAVVTNFP----AFAVLRALQGIAAAGLVPCGYALIPT 147

Query: 523  IYKPGTLKKNMVISIVGAMSPIGATL--GGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
            +  P  ++    +   G  S IG  L  GG F+ L     +G +  +F    L +    F
Sbjct: 148  LADPEDVQLFFAVVSCGFSSTIGIGLIIGGAFA-LTNVGYKGIFYLSFAGMLLVSIAAFF 206

Query: 697  ISY---------YSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXX 849
             +Y              +I       S+D++GS   + G +L   V      + W     
Sbjct: 207  FTYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLI-VVGLTEGGESWKRPVA 265

Query: 850  XXXXXXXXXXXXXF-----------------GIYELRYAE--NPLLPSEIIRNRQLIMIL 972
                         F                 G    RY E    L+P +++     I I 
Sbjct: 266  YVPFTIGMIFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLEKVQVLIPRDVLFMTNFIPIT 325

Query: 973  TAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA 1152
                   G      +    +   +   SPL AG      +I+  I    C     K+RP 
Sbjct: 326  LGFLCNGGCLYSNIYIIDQYSQYVDKNSPLLAGVKLVPLIITMVIGNTICASKSVKLRPR 385

Query: 1153 VLLTFSMVGFNLGCIIFSVTPV--HQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 1326
            + +    +    G II     +     Y++ +  + I++  G  + +P +  ++  + P+
Sbjct: 386  IGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVVGDAPS 445

Query: 1327 QHQGMAGSLVNTV----INYSNSLFLGIAGTVEQ-HCNKNGTDLLR-GYRGALYFGIACS 1488
              +G+A  +  T     I  + S+ + + G + Q     +  +  R G++   YF +A  
Sbjct: 446  GAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSFERFRDGFQKCTYFTLASG 505

Query: 1489 GVAVLIAGLYMVETIFD--SYKD----------RKEKDCENCEQ 1584
               +++   ++    F   S KD          + E +CE  EQ
Sbjct: 506  AFGLVLTTFFVRGPRFSNGSPKDATALENGSYSQTESNCEKKEQ 549

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
            uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
            Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 58.2 bits (139), Expect = 3e-08
 Identities = 86/381 (22%), Positives = 154/381 (40%), Gaps = 20/381 (5%)
 Frame = +1

Query: 214  TTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVIL 393
            +T T S    +  + +  D L  W+ AS+ + S SF  + G   D+ G +K L    +I 
Sbjct: 84   STVTASTYQTIGNEFNHMD-LSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIF 142

Query: 394  VIWSLITGLSGYSHSGIFFIIARAFQGLGIS-LVLPNVLGLIGMIYKPGTLKKNMVISIV 570
             I  L  G+S    + ++    RAF G+G   L+  + +    MI    T K+ +  +  
Sbjct: 143  SIGCLGCGIS---INILWLSFMRAFTGIGGGGLITLSTIVNSDMI---PTSKRGIFQAFQ 196

Query: 571  GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN---------- 720
              +  +GA  G  F G++ T S G W W F      +     I +  + N          
Sbjct: 197  NLLLGLGAICGASFGGVI-TSSIG-WRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSK 254

Query: 721  -NIPTNVNRLSMDWIGSFTGVLGLIL---FNFVWNQAPADG--WNXXXXXXXXXXXXXXX 882
             +  T      +D+ G+F  ++GL L   +  + + A   G  W+               
Sbjct: 255  ESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVL 314

Query: 883  XXFGIYELRYAENPLLPSEIIRNRQLIMILT-AMTFGWGSFGIWTFYYFSFVLNLRNYSP 1059
              F + E R +   ++PS+++R+    ++LT ++  G+ S+  + F    F   +   S 
Sbjct: 315  VLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFASYA-YLFTLPLFFQVILGDST 373

Query: 1060 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFN-LGCIIFSVTPVHQTYFR 1236
              AG    I  +   +  +  G  M K      L +  + F  LG  +F       T   
Sbjct: 374  AKAGLRLAIPSVFTPVGGLIAGICMSKFNCLQTLLYVGIAFMCLGNFLFLYIGADAT--D 431

Query: 1237 NILGTMII-LPLGMDLSFPAS 1296
            +++G  +I   LG  ++FP+S
Sbjct: 432  SLIGFFLIPANLGQGITFPSS 452

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
            weakly similar to uniprot|Q04602 Saccharomyces cerevisiae
            YDR119W Uncharacterized transporter
          Length = 579

 Score = 57.8 bits (138), Expect = 4e-08
 Identities = 75/353 (21%), Positives = 134/353 (37%), Gaps = 22/353 (6%)
 Frame = +1

Query: 148  STTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFIL 327
            S  + +  I S  L   L     T   ++++ +  + +    +  W+  ++ L S +F  
Sbjct: 56   SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHIS-WIATAYLLSSATFQP 114

Query: 328  VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIA-RAFQGLGISLVLPNV 504
            + G++ DI+G + ++I+  +  ++  LI GLS      ++ ++A R   G+G   V    
Sbjct: 115  LYGKISDIFGRRPLIIISNLFFILGCLICGLS----KNLWTLVAGRFIAGIGGGGV--TS 168

Query: 505  LGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYT--LA 678
            LG I          + +   I      +G  +GGL  G   +ES+  W  AF       A
Sbjct: 169  LGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWF-SESKNGWRMAFLVQVPLCA 227

Query: 679  AFINTFISYYSIP--------------NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQ 816
              +   I +  +P                +        +DW+GS    L L+ F F +  
Sbjct: 228  ISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGS----LSLVTFLFAFML 283

Query: 817  APADG-----WNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAM 981
            A + G     +N                 F   EL  +++P+LP   + NR ++    A 
Sbjct: 284  ASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFAN 343

Query: 982  TFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKK 1140
             F   S     FY   +  +++N  P   G        S    +I  G+ MKK
Sbjct: 344  WFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKK 396

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 56/186 (30%), Positives = 84/186 (45%), Gaps = 15/186 (8%)
 Frame = +1

Query: 181 CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-------WLVASFPLVSGSFILVSGR 339
           C++S LL L      L I+ V+T  L+ +  +K        WLV  + L +  F+L+ GR
Sbjct: 10  CVISLLLTLF--LAALDIVIVVT--LYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGR 65

Query: 340 LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 519
           L +I G K+ L++  ++  I SLI+ LS    + I   +   F G GI  +   V   I 
Sbjct: 66  LAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIV 125

Query: 520 MIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY--------AYTL 675
                G +   + IS V A   +G  +GG F+         SW W FY        A+ +
Sbjct: 126 RENHRGIMITALAISYVIA-EGVGPFIGGAFN------EHLSWRWCFYINLPIGAFAFII 178

Query: 676 AAFINT 693
            AF NT
Sbjct: 179 LAFCNT 184

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 55/226 (24%), Positives = 97/226 (42%), Gaps = 16/226 (7%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFI 324
           N +  +   + S  L   ++    T   +IMN +  +   SD  K W+  SF L + +F 
Sbjct: 29  NLSLPKLPILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDK-KQWIATSFLLTNTAFQ 87

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG-------I 483
            + G+L D+ G K  L++ Y  LVI  L+T L   + +   F +ARA  G+G        
Sbjct: 88  PLYGKLSDVTGRKFALLMAYFFLVIGCLLTCL---ARNVTEFAVARAICGIGGGGINACS 144

Query: 484 SLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 663
           S+ + ++        K   + +     + G    +GA LGGLF   +       W   F 
Sbjct: 145 SITVSDI-----CTAKERGIYQGYANIVFGMGQMLGAPLGGLFIDTI------GWRAIFG 193

Query: 664 AYTLAAFINTFISYYSIP---NNIP------TNVNRLSMDWIGSFT 774
                  ++ F++Y ++    +++P      T  N   +D++GS T
Sbjct: 194 IQVPVVMVSAFLAYRNVNIKLSHVPPISERFTRKNLSRIDFLGSVT 239

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
            YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 89/447 (19%), Positives = 166/447 (37%), Gaps = 22/447 (4%)
 Frame = +1

Query: 79   DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQL 258
            D    S   +L       P++  S+++    + S  L   L     T   +++  +  + 
Sbjct: 54   DRTATSARCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEF 113

Query: 259  HSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHS 438
            +S D +  W+  S+ L S +   + G+L D  G K +L+   V+  I  LI G+   S S
Sbjct: 114  NSLDKVS-WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM---STS 169

Query: 439  GIFFIIARAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGAT 597
              + ++ R   G+G        S+V+ +++ L     +   + + +   I G  +  G  
Sbjct: 170  IWWVVVGRFVSGIGGCGLTCLASMVISDLVPL-----RERAVYQGLCNFIFGLGTASGGL 224

Query: 598  LGGLFSGLVATESEGSWPWAFYAYTLAAFIN--TFISYYSIPNNIPTNVNR------LSM 753
            +G  F           W  AF      +  +    +SY  +P     + +R        +
Sbjct: 225  VGAAFQ---------DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDL 275

Query: 754  DWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 930
            DW G  T V  L LF  V +    +  ++                 F   EL  A +P+L
Sbjct: 276  DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVL 335

Query: 931  PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 1110
            P   ++ R ++    A  F   S     +Y   +  ++ N  P   G        S    
Sbjct: 336  PIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFG 395

Query: 1111 AISCGFLMKKIRPA--VLLTFSMVGFNLG----CIIFSVTPVHQTYFRNILGTMIILPLG 1272
            ++  G  MK+       LL F  +G  LG     ++   TPV Q Y       +++   G
Sbjct: 396  SLGAGIYMKRTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQQYL-----LLVVPSFG 449

Query: 1273 MDLSFPASSIILSDNLPNQHQGMAGSL 1353
            + +    + + +   +P++H     S+
Sbjct: 450  LSVLITVTLLAMISAVPHEHHAATTSI 476

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
            YKR105C (REAL)
          Length = 580

 Score = 55.1 bits (131), Expect = 3e-07
 Identities = 100/444 (22%), Positives = 168/444 (37%), Gaps = 61/444 (13%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTL----SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGR 339
            ++ C+ S  L L  T   +    +I++V+  Q   + S   WLV  + L +    LV GR
Sbjct: 34   LYLCLTSLTLVLFITALDILIVGTIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLVWGR 92

Query: 340  LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 519
               I G +  LIL  +I    SL+  L   ++S    I+ R   G+G S       GL  
Sbjct: 93   FASIIGFQHSLILAVLIFEAGSLVAAL---ANSMNMLIVGRVVAGVGGS-------GLQT 142

Query: 520  MIYKPGTLKKN-----MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY------A 666
            + +  G    N     +VISI+     + A +G +  G   T    +W W FY       
Sbjct: 143  LCFVIGCTMVNERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGG 200

Query: 667  YTLAAFINTF-----------------ISYYSIPN-NIPTNVNR------LSMDWIGSFT 774
            + +  F+ T+                 IS + +     P N+ +         D++G   
Sbjct: 201  FAVIMFLLTYKTKSENILQQTRNILGRISKFELRRLTEPGNLRKALIGILFKFDFLGFAL 260

Query: 775  GVLGLILF----NFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYEL-----------R 909
               GL+LF     F  N+     WN                   IY+             
Sbjct: 261  SSAGLVLFLLGLTFGGNKY---SWNSGQIITYLVLGILLFVFSLIYDFFIFQKFNPEPDN 317

Query: 910  YAENPLLPSEIIRNRQLI---MILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY 1080
             +  PL    ++    +I   M+   +  G+    I++  +F  +      S  W  G +
Sbjct: 318  TSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQLIF----ASSAWKAGLH 373

Query: 1081 FI-FVISGTITAISCGFLMKK---IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILG 1248
             I  VI+  I AI+ G + KK   ++P  LL F  +   +G  + ++   + T    I  
Sbjct: 374  LIPIVITNVIAAIASGVITKKLGLVKP--LLIFGGILGVIGAGLMTLMSNNSTSSTQI-- 429

Query: 1249 TMIILPLGMDLSFPASSIILSDNL 1320
             ++ILP G+ L F   + ++S  L
Sbjct: 430  GVLILP-GLSLGFALQASLMSAQL 452

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa] {ON}
            similar to uniprot|P36172 Saccharomyces cerevisiae
            YKR105C Hypothetical ORF
          Length = 611

 Score = 55.1 bits (131), Expect = 3e-07
 Identities = 73/349 (20%), Positives = 133/349 (38%), Gaps = 51/349 (14%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            WL+A + L +  F L+ GR   + G +  + L   I  + S+++  S  S   +  I+ R
Sbjct: 97   WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSA-SATSMDNL--IVGR 153

Query: 463  AFQGLGIS--LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES 636
               G+G S    L  V+G   +  K   +  ++V+S   A S IG  +GG F+  V    
Sbjct: 154  VIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVI--- 210

Query: 637  EGSWPWAFYAYTLAAFINTFISYYSI-PNNIPT---------NVNRLSM----------- 753
               W W F+       +   + Y++  P  +           +V  LS            
Sbjct: 211  ---WRWCFWINLPIGAVTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRC 267

Query: 754  ---------DWIGSFTGVLGLILFNF-VWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 903
                     D +G  TG  G+ L    +      D W                    +Y+
Sbjct: 268  MGKNLLFRFDIVGFATGCAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYD 327

Query: 904  LRYAEN-----------PLLPSEIIRNRQLIM---ILTAMTFGWGSFGIWTFYYFSFVLN 1041
                +            P+L   ++ NR +++   +  A    +  + +++  +F  V+ 
Sbjct: 328  FYIFDKINPEPSNLSFRPMLVKGLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMG 387

Query: 1042 LRNYSPLWAGGSYFI-FVISGTITAISCGFLMKK---IRPAVLLTFSMV 1176
                S  W  G + I  VI+  ++AI CG +MKK   ++P ++ T S++
Sbjct: 388  ----SSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVKPLMISTVSIL 432

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 54.3 bits (129), Expect = 5e-07
 Identities = 51/191 (26%), Positives = 81/191 (42%), Gaps = 8/191 (4%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFI 324
           N T      I S +L+  L        +++ + +  + H   ++  WLV  + L +  F+
Sbjct: 2   NKTLSLTLCIISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIG-WLVTGYALTNAVFM 60

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNV 504
           L+ GRL +I G  + L++  +I  + SLI+ LS    + I   +   F G GI  +   V
Sbjct: 61  LLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVV 120

Query: 505 LGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY------- 663
              I      GT+   +  S V A   +G  +GG F+         SW W FY       
Sbjct: 121 GTSIVQENHRGTMITALATSYVIA-EGVGPFIGGAFN------EHLSWRWCFYINLPIGA 173

Query: 664 -AYTLAAFINT 693
            A  + AF NT
Sbjct: 174 FALIILAFCNT 184

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 54.3 bits (129), Expect = 6e-07
 Identities = 56/209 (26%), Positives = 91/209 (43%), Gaps = 8/209 (3%)
 Frame = +1

Query: 61  IRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMN 240
           +RS  +    ++ +    + S    D+    + ++A +  C+LS +L L      + I+ 
Sbjct: 9   LRSAAAKTRTDTQAQTAPSHSFSLQDF----SAKHALLALCLLSLVLTLFLAALDIVIVV 64

Query: 241 VLTRQLHS--SDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 411
            L   +    +D   V WLV  + L S  F L+ GR+  + GLK  L+L  +I  I SLI
Sbjct: 65  TLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLI 124

Query: 412 TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGA 576
             +   S+S    I  R   G G S       G+  ++Y  GT       + MVI ++  
Sbjct: 125 AAV---SNSMGMLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVL-T 173

Query: 577 MSPIGATLGGLFSGLVATESEGSWPWAFY 663
            + +G+  GG   G  A     SW W F+
Sbjct: 174 FAFVGSNAGGPILG-GALNEHASWRWCFF 201

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa] {ON}
            similar to uniprot|Q04301 Saccharomyces cerevisiae
            YMR088C VBA1 Permease of basic amino acids in the
            vacuolar membrane
          Length = 571

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 72/337 (21%), Positives = 137/337 (40%), Gaps = 15/337 (4%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            ++S  +   L    +T   +IMN +  +   SD  K W+V SF L + +F  + G+L D+
Sbjct: 43   LYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDK-KQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
             G K  L++ +   ++  L T L   S + + F IARA  G+G   +  + L  I +   
Sbjct: 102  AGRKTALMVAHSFFLVGCLFTAL---SRNLVEFSIARAVCGMGAGGI--SALSSISVSDI 156

Query: 532  PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYS 711
                ++ +       +   G+ LGG   G +  +S G W   F           F+ Y +
Sbjct: 157  CTPKERGVYQGYANVVFGTGSMLGGPIGGWL-MDSFG-WKVIFAGQVPLIMTCMFLGYRN 214

Query: 712  IP---NNIP--------TNVNRL----SMDWIGSFTGVLGLILFNFVWNQAPADGWNXXX 846
            +     ++P         N+ R+    S+  IG+ +G L L   +               
Sbjct: 215  VNIKLLHVPPRHERYRWENIKRIDLGGSISLIGTISGFLCLCSTDL-------------N 261

Query: 847  XXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYF 1026
                          F + EL +A   ++P++++     I  L  +   + +FG   F   
Sbjct: 262  KPLLATLTLLSLVLFIMNELYWAPERIIPTDLLSGTFGITSLLTVFSSFIAFGD-VFRNP 320

Query: 1027 SFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMK 1137
             ++  ++N SP   GG      IS  + +++ G++++
Sbjct: 321  VYLQLVQNISPTSTGGFLLFSSISSALASLATGWILR 357

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
            VBA5Putative transporter of the Major Facilitator
            Superfamily (MFS); proposed role as a basic amino acid
            permease based on phylogeny
          Length = 582

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 96/439 (21%), Positives = 165/439 (37%), Gaps = 56/439 (12%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTL----SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGR 339
            ++ C+ S  L L  T   +    +I++V+  Q   + S   WLV  + L +    L+ GR
Sbjct: 36   LYLCLASLTLVLFITALDILIVGTIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLIWGR 94

Query: 340  LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 519
               I G +  LIL  +I    SLI  L+   +  IF  +     G G+   L  V+G   
Sbjct: 95   FASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQ-TLCFVIGCTM 153

Query: 520  MIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY------AYTLAA 681
            +    G   + +VISI+     + A +G +  G   T    +W W FY         +  
Sbjct: 154  V----GERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGGLAIIM 207

Query: 682  FINTF-----------------ISYYSIPN-NIPTNVNRL------SMDWIGSFTGVLGL 789
            F+ T+                 IS ++        N  RL        D+ G      GL
Sbjct: 208  FLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGL 267

Query: 790  ILF---------NFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYEL---RYAENPLLP 933
            +LF          + WN      +                  F  +       +  PLL 
Sbjct: 268  VLFLLGLTFGGNKYSWNSGQVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLL 327

Query: 934  SEIIRNRQLIMILTAMTF----GWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFI-FVIS 1098
              ++  +  I+I+  +TF    G+    I++  +F  +      S  W  G + I  VI+
Sbjct: 328  RRLVA-KPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIF----ASSAWKAGLHLIPIVIT 382

Query: 1099 GTITAISCGFLMKK---IRPAVLL--TFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 1263
              I AI+ G + KK   ++P ++      ++G  L      +T +  T  ++    +++L
Sbjct: 383  NVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGL------MTLMTNTSTKSTQIGVLLL 436

Query: 1264 PLGMDLSFPASSIILSDNL 1320
            P G  L F   + ++S  L
Sbjct: 437  P-GFSLGFALQASLMSAQL 454

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 46/224 (20%), Positives = 94/224 (41%), Gaps = 4/224 (1%)
 Frame = +1

Query: 4   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAF-IFS 180
           D +++K  +E      +E      SD    S    ++    + P      T+   F +++
Sbjct: 3   DLEVQKNTVE------DEAAYLQSSDEQGSSSHSVIEKPQQQQPQEQLEQTRPTGFTLYA 56

Query: 181 CMLSQLLNLAGTTQTLSIMNVLTRQL---HSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           C++S +L++      + I++ +   +       S   W+ A + L S    L+ GR+  +
Sbjct: 57  CVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAV 116

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
            G K  ++   +I  + SL+  L   ++S    I  R   GLG S +      +I  + +
Sbjct: 117 CGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVE 173

Query: 532 PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 663
               K+ ++I+ +G+   I + +G    G   T    +W W F+
Sbjct: 174 ES--KRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFW 213

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 42/132 (31%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           WLV  + L +  F L+ GRL  I GLK  L    VI  I SLI  +   S+S    I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGR 102

Query: 463 AFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVA 627
              G G S       G+  +++  GT       + MVI+++G    +   +G +  G  A
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGG--A 153

Query: 628 TESEGSWPWAFY 663
                SW W FY
Sbjct: 154 FTENVSWRWCFY 165

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 52.0 bits (123), Expect = 2e-06
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 9/228 (3%)
 Frame = +1

Query: 142 FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
           +N +  ++  + S  L   L+   +T   +IMN +  +   S   K W+  SF L + +F
Sbjct: 27  YNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQE-KQWIATSFLLTNTAF 85

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLV 492
             + G+L DI G K  L+       +   +T LS        F IARA  G+   GI+ +
Sbjct: 86  QPLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNIKQ---FAIARAICGIGGGGINAI 142

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYT 672
               +G I    K   + +     + G    +GA +GGLF   +AT    +  W      
Sbjct: 143 SSITVGDI-CTAKDRGIYQGYANIVFGMGQLLGAPVGGLF---IATIGWRALFWIQVPLV 198

Query: 673 LAA------FINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILF 798
           + A      ++N  + +   P+      N   +D++GSFT V  +  F
Sbjct: 199 IIAIILGEMYVNIKLVHVPPPSERFKWKNISRIDFLGSFTLVSSITCF 246

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
            YCL069W (REAL)
          Length = 590

 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 97/437 (22%), Positives = 165/437 (37%), Gaps = 54/437 (12%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTL----SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGR 339
            ++ C+ S  L L  T   +    +I++V+ +Q   + S   WLV  + L +    L+ GR
Sbjct: 44   LYLCLASLTLVLFITALDILIVGTIIDVVAKQF-GNYSKTGWLVTGYSLPNAVLSLLWGR 102

Query: 340  LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 519
               I G +  LIL  +I    SL+  L   ++S    I+ R   G+G S  L  +  +IG
Sbjct: 103  FASIIGFQHSLILAVLIFEAGSLVAAL---ANSMNMLIVGRVVAGVGGS-GLQTLCFVIG 158

Query: 520  MIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY------AYTLAA 681
                     + +VISI+     + A +G +  G   T    +W W FY         +  
Sbjct: 159  CT-MVDERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGGLAVIM 215

Query: 682  FINTF----------------------ISYYSIPNNIPTNVNRL--SMDWIGSFTGVLGL 789
            F+ T+                       S    P N+   +N L    D+ G      GL
Sbjct: 216  FLLTYDAKNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGL 275

Query: 790  ILF---------NFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYEL---RYAENPLLP 933
            +LF          + W+      +                  F  +       +  PL  
Sbjct: 276  VLFLLGLTFGGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFL 335

Query: 934  SEIIRNRQLIMILTAMTF----GWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFI-FVIS 1098
              ++  +  I+I+  +TF    G+    I++  +F  +      S  W  G + I  VI+
Sbjct: 336  RRLVA-KPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIF----ASSAWKAGLHLIPIVIT 390

Query: 1099 GTITAISCGFLMKK---IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 1269
              I AI+ G + KK   ++P  LL F      +G  + ++   + T    I   ++ILP 
Sbjct: 391  NVIAAIASGIITKKLGLVKP--LLIFGGFLGVIGAGLMTLMKNNSTSSTQI--GVLILP- 445

Query: 1270 GMDLSFPASSIILSDNL 1320
            G  L F   + ++S  L
Sbjct: 446  GFSLGFALQASLMSAQL 462

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 51.6 bits (122), Expect = 4e-06
 Identities = 48/174 (27%), Positives = 78/174 (44%), Gaps = 1/174 (0%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFI 324
           N T      I S +L+  L        +++ + +  + H   ++  WLV  + L +  F+
Sbjct: 2   NKTLSLTLCITSLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIG-WLVTGYALSNAVFM 60

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGI-SLVLPN 501
           L+ GRL +I G  + L++  VI  I SLI+ LS    + I   +   F G GI SL    
Sbjct: 61  LLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVV 120

Query: 502 VLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 663
              ++   Y+ G +   + +S V A   +G  +GG F+         SW W FY
Sbjct: 121 GTSIVQENYR-GIMITALAVSYVIA-EGVGPFIGGAFN------EHLSWRWCFY 166

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 51.6 bits (122), Expect = 4e-06
 Identities = 44/161 (27%), Positives = 73/161 (45%), Gaps = 4/161 (2%)
 Frame = +1

Query: 142 FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
           +N    ++  +FS  L   L+    T   +IMN +  +  S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAF 87

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
             + G+L DI G K  L+  +    I  L+T    ++ +   F IARA  G+G   +  N
Sbjct: 88  QPLYGKLSDITGRKSALLTAHFFFGIGCLLT---CFARNVTEFSIARAICGIGAGGL--N 142

Query: 502 VLGLIGM----IYKPGTLKKNMVISIVGAMSPIGATLGGLF 612
            +G I +      +   + +     + G    +GA LGG+F
Sbjct: 143 AIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVF 183

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 53/233 (22%), Positives = 100/233 (42%), Gaps = 2/233 (0%)
 Frame = +1

Query: 61  IRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMN 240
           I  D   ++DE  + +   S+  +P    +  Q++  +    +    +  G+      + 
Sbjct: 58  IDGDSLQSSDEEKNEQASEST--SPYTLLTYKQKWGMVALLTMCGFWSSLGSPIYYPALR 115

Query: 241 VLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGL 420
            L +Q    ++     V  + L  G    +SG L D++G + ++++G +I V+ S+  GL
Sbjct: 116 QLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI--GL 173

Query: 421 SGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL 600
           +     G+  +  R  Q +GIS  +    G++G      TLK     + VGA S +   L
Sbjct: 174 ACAPSYGV-IVFLRIIQSIGISPTIAISSGVVGDF----TLKHERG-TFVGATSGL-VLL 226

Query: 601 GGLFSGLVATESEGSWPW--AFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 753
           G  F  L+      +W W   F+  T+    +  I++  +P    T V  LS+
Sbjct: 227 GQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 48/204 (23%), Positives = 90/204 (44%), Gaps = 2/204 (0%)
 Frame = +1

Query: 148 STTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFIL 327
           S  Q++  +F  ++    +  G+      +  L ++ +  ++     V  + L  G    
Sbjct: 96  SYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPT 155

Query: 328 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 507
           VSG L D++G + +++ G VI V+ S+  GL+     G+   + R  Q +GIS  +    
Sbjct: 156 VSGGLADVFGRRPIILGGMVIYVVASI--GLACAPSYGVICFL-RCIQSIGISPTIAISS 212

Query: 508 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW--AFYAYTLAA 681
           G++G      TLK     + VGA S +   LG  F  L+       W W   F+   + +
Sbjct: 213 GVVGDF----TLKHERG-TFVGATSGL-VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGS 266

Query: 682 FINTFISYYSIPNNIPTNVNRLSM 753
            +   ++ +++P    T V  LS+
Sbjct: 267 GVALIVAAFTLPETKRTIVGNLSI 290

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa] {ON}
            weakly similar to uniprot|Q04602 Saccharomyces cerevisiae
            YDR119W Uncharacterized transporter
          Length = 593

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 85/450 (18%), Positives = 171/450 (38%), Gaps = 18/450 (4%)
 Frame = +1

Query: 58   TIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIM 237
            T +S  S  N+   +     +   + +++  +++    +FS  L   L     T   +++
Sbjct: 51   TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110

Query: 238  NVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITG 417
              +  + +S D    W+  S+ L S +   + G+L D  G K +L+    +  I  LI G
Sbjct: 111  THIGSEFNSLDKAS-WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICG 169

Query: 418  LSGYSHSGIFFIIARAF----QGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 585
            LS    + I+ ++A  F     G G++ +   ++  + +  +   + + +   + G  + 
Sbjct: 170  LS----NSIWAVVAGRFISGIGGCGLTSLATMIMSDL-VPLRDRAVYQGLCNFVFGLGTA 224

Query: 586  IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFIN--TFISYYSIP------NNIPTNVN 741
             G  +G  F           W  AF      + ++    + Y  +P      N    +  
Sbjct: 225  SGGLVGAYFR---------DWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR 275

Query: 742  RLSMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAE 918
               +DW G+ + +  L LF    +   +   +                  F   ELR A 
Sbjct: 276  LRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAA 335

Query: 919  NPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIF 1089
            +P+LP   +R+R ++    A  F   S     FY   Y+S VL ++           F  
Sbjct: 336  DPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFS 395

Query: 1090 VISGTITAISCGFLMKKIRP--AVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 1263
            V  G++ A   G  MK+       LL F ++       I  +TP    + + +L   ++ 
Sbjct: 396  VAFGSLGA---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLL--QVVP 450

Query: 1264 PLGMDLSFPASSIILSDNLPNQHQGMAGSL 1353
              G+ +    + + +   +P++H     S+
Sbjct: 451  GFGVSVLITVTLLAMIAAVPHEHHAATTSI 480

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 3/177 (1%)
 Frame = +1

Query: 91  ESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSD 270
           E+P +E K         +N    ++  +FS  L   L+   +T   +IMN +     S  
Sbjct: 18  EAPPLEQKYHE------YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SES 70

Query: 271 SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
           S K W+  SF L + +F  + G+L DI G K  L++      +  L+T    ++ +   F
Sbjct: 71  SRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLLT---CFARNVTEF 127

Query: 451 IIARAFQGL---GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLF 612
            IARA  G+   G++ +    +  I    + G  +    I + G    +GA LGG+F
Sbjct: 128 SIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYANI-VFGFGQLLGAPLGGVF 183

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 1/124 (0%)
 Frame = +1

Query: 112 KNSSLRNPDY-FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWL 288
           KNSSL    +  N    +   +FS  +   L     T   +IMN +  +   SD  K W+
Sbjct: 33  KNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDK-KQWI 91

Query: 289 VASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAF 468
             SF L + +F  + G+L DI G K  L++ +    +  L+T    ++ +   F IARA 
Sbjct: 92  ATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLT---CFARNVTEFSIARAI 148

Query: 469 QGLG 480
            G+G
Sbjct: 149 CGIG 152

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 58/246 (23%), Positives = 105/246 (42%), Gaps = 5/246 (2%)
 Frame = +1

Query: 31  EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ--LLN 204
           + +S +    +R   SD+ D   S  + NS L     F   +    +    +L+     +
Sbjct: 41  DAASRVTTREMRESSSDSRDRVESSGV-NSKLPQGAPFTLLSHGQKWFMVALLTSAGFWS 99

Query: 205 LAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGY 384
             G+      +  L ++ + S+ +    V  + +  G    +SG L D+YG + ++++G 
Sbjct: 100 SLGSPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGM 159

Query: 385 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
           +I V  S+  GL+     G+  +  R  Q  GIS ++    G++G      TLK     +
Sbjct: 160 LIYVCASI--GLACSQSYGV-IVFLRCLQSAGISPIIAINSGVVGDF----TLKHERG-T 211

Query: 565 IVGAMSPIGATL-GGLFSGLVATESEGSWPW--AFYAYTLAAFINTFISYYSIPNNIPTN 735
            VGA+S  G TL G  F  L+      ++ W   F+  T+       I++  +P    T 
Sbjct: 212 FVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMIINFLILPETKRTL 269

Query: 736 VNRLSM 753
           V  LS+
Sbjct: 270 VGNLSI 275

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
            (REAL)
          Length = 474

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 83/385 (21%), Positives = 148/385 (38%), Gaps = 25/385 (6%)
 Frame = +1

Query: 271  SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
            S+  W+  ++ + S SF  + G   D  G +  L        I  L  G S    S I+ 
Sbjct: 2    SISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFS----SNIYM 57

Query: 451  I-IARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVA 627
            +   RA  G+G   ++   L  I       T K+ +  +    +   GA  G  F G +A
Sbjct: 58   LSFMRALTGIGGGGLI--TLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIA 115

Query: 628  TESEGSWPWAFYAYTLAAFINTFISYYSIPN---------NIPTNVNRL--SMDWIGSFT 774
              S   W W F      + I++ +  Y +PN         NI  +  ++   +D +GS  
Sbjct: 116  --STIGWRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSIL 173

Query: 775  GVLGL---ILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEII 945
             + GL   +L+  +        W                  F ++E +     ++P E++
Sbjct: 174  IITGLTLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELV 233

Query: 946  RNRQLIMILT-AMTFGWGSFG-IWTF-YYFSFVLNLRNYSPLWAGGSYFIFVISGTITAI 1116
             +    ++L+ ++  G+ S+  ++T   +F  VL     S   AG    I  +   + ++
Sbjct: 234  SSSYSFVVLSISILVGFASYAYLFTLPLFFQIVL---GDSTAKAGLRLTIPSLFTPVGSL 290

Query: 1117 SCGFLMKK---IRPAVLLTFSM--VGFNLGCIIFSVTPVHQTYFRNILGTMIILP--LGM 1275
              GF M K   +R  + L  S+  +G  L   I   +P       N L ++ ++P  LG 
Sbjct: 291  ITGFSMSKYNCLRSLLYLGISLMFLGNFLFLFIEETSP-------NWLISLFLIPANLGQ 343

Query: 1276 DLSFPASSIILSDNLPNQHQGMAGS 1350
             ++FP +        P   Q  A S
Sbjct: 344  GITFPTTLFTFIFMFPKSDQATATS 368

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 3/177 (1%)
 Frame = +1

Query: 91  ESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSD 270
           E+P +E K         +N    ++  +FS  L   L+   +T   +IMN +  +  S  
Sbjct: 18  EAPPLEQKFHE------YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SES 70

Query: 271 SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
           S K W+  SF L + +F  + G+L DI G K  L+       +  L+T    ++ +   F
Sbjct: 71  SKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLLT---CFARNVTEF 127

Query: 451 IIARAFQGL---GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLF 612
            IARA  G+   G++ +    +  I    + G  +    I + G    +GA LGG+F
Sbjct: 128 SIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYANI-VFGFGQLLGAPLGGVF 183

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 4/188 (2%)
 Frame = +1

Query: 61  IRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMN 240
           IRS   D  +++   E  +        +N +  ++  + S  L   L+   +T   +IMN
Sbjct: 13  IRSSIEDGEEDNGLEEQYHE-------YNLSLPKFPILLSLWLGSFLSSLDSTIVANIMN 65

Query: 241 VLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGL 420
            +  +   SD  K W+  SF L + +F  + G+L DI G K  ++  +    +   +T  
Sbjct: 66  KVAEEFEESDK-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLT-- 122

Query: 421 SGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS----IVGAMSPI 588
             ++ +   F IARA  G+G   V  N +  I +     T ++ +       + G    +
Sbjct: 123 -CFAQNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQLL 179

Query: 589 GATLGGLF 612
           GA LGGLF
Sbjct: 180 GAPLGGLF 187

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 58/239 (24%), Positives = 101/239 (42%), Gaps = 24/239 (10%)
 Frame = +1

Query: 19  KKN----IEVSSYIAEETIRSDCSDANDESPS-MELKNSSLRNPDYFNSTTQEYAF---- 171
           KKN    + + S+  E ++       N+ES +  E+ N   + P+ FNS   + A     
Sbjct: 13  KKNPEILVSIDSFGIEPSMEIASHGINEESGTDAEVSNHVEKKPN-FNSKYGKNAMGEDL 71

Query: 172 -----IFSCMLSQLLNLAGTTQTLSIMNVLT-----RQLHSSDSLKVWLVASFPLVSGSF 321
                +++C  S  L LA     L IM V T      +   + S   W+ A + L +   
Sbjct: 72  PSGIVLYTCAFS--LALAIFLAALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALL 129

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
            L+ GR+  I G K  ++   +I  I SLI   SG ++S    I  R   G+G S     
Sbjct: 130 ALLWGRIASIIGFKSCMLAAIIIFEIGSLI---SGVANSMNMLIGGRVIAGVGGS----- 181

Query: 502 VLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 663
             G+  + +  G+      ++ ++I+ + +   + + +G    G   T +  +W W FY
Sbjct: 182 --GIQSLAFVIGSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHA--TWRWCFY 236

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
            Anc_8.272 YDR119W
          Length = 636

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 97/467 (20%), Positives = 187/467 (40%), Gaps = 33/467 (7%)
 Frame = +1

Query: 52   EETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCM-LSQLLNLAGTTQTL 228
            EE  R     +N       + NS + + D  N +        S M L   L+    T   
Sbjct: 57   EELYREASIASNQHHDYGSVANSIILDNDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVS 116

Query: 229  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 408
            +++  +  + +    +  W+  ++ L S +F  + G++ DI+G K +L    V   I  L
Sbjct: 117  TLLARIGSEFNELPRIS-WIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCL 175

Query: 409  ITGLSGYSHSGIFFIIARAFQGLG----ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGA 576
            I G    + S    +I R   G+G     S+    V  +I +        + +   +   
Sbjct: 176  ICGT---AKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPL------RNRALYQGVCNF 226

Query: 577  MSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFI------------SY---YS 711
               +G  LGG+  G   TE  GSW  AF      + I+T              SY    +
Sbjct: 227  YYGLGIALGGIIGGWF-TEKLGSWRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEIT 285

Query: 712  IPNNIPTN------VNRL-SMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXX 867
            + NN   N      + +L ++DW G+ + V+ L+ F  + +   +D              
Sbjct: 286  MSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLI 345

Query: 868  XXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVL 1038
                   F   EL++A++P+LP   +++R ++    +  F        ++Y   YF+ V+
Sbjct: 346  SVTSFISFIYIELKFAKDPILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVM 405

Query: 1039 NLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKI-RPAVLLTFSMVGFNLGCI-IFSVT 1212
             +  Y         F  V  G++ A   G+ MKK  +    +TF  +   +GC+ I+ + 
Sbjct: 406  GIGAYDVGKRTLPNFFSVAFGSLGA---GYYMKKTGKYYWFVTFFCLVVVIGCLQIYLIN 462

Query: 1213 PVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSL 1353
                 + + +L  +  L   + ++    S+I++  +P+++Q +  S+
Sbjct: 463  DGISVWRQYLLSFVPGLGAAVLITIALLSMIVA--VPHEYQAVTTSI 507

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 52/215 (24%), Positives = 94/215 (43%), Gaps = 9/215 (4%)
 Frame = +1

Query: 172 IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           + S  ++  L     T   +IMN +T +   S  ++ W+  SF L S  F  + G+L D+
Sbjct: 50  LLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDV 108

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
            G + +L+L Y + ++  L+T    Y+ +   F   RA  G+G   +    +  +G ++ 
Sbjct: 109 TGRRFVLVLAYSLFLLGCLVT---AYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF- 164

Query: 532 PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYS 711
               ++++  S    +  IG  LG    G +A E+ G W   F A      I  +++   
Sbjct: 165 -SVKEQSIYQSYAHIIYTIGEVLGAPIGG-IALETVG-WRAIFLAQVPVLTICIYLTLCD 221

Query: 712 ---IPNNIPTNVNRLS------MDWIGSFTGVLGL 789
                 +IP +  RL+      MD  GS   ++ L
Sbjct: 222 DDLAQQHIPPHGERLTWKNISRMDLSGSILLIISL 256

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
            similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 79/382 (20%), Positives = 151/382 (39%), Gaps = 22/382 (5%)
 Frame = +1

Query: 283  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
            W+ AS+ L +  F  + G+L DI+G K +L+   ++  +  L+ G +      +++++A 
Sbjct: 191  WIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA----PTVWWLLAG 246

Query: 463  AF----QGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
             F     G G++ +   ++  I  +    + +    I  V     +G TLGG   G +A 
Sbjct: 247  RFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYV-----LGITLGGSMGGWLA- 300

Query: 631  ESEGSWPWAFYAYTLAA-----FINTFI--------SYYSIPNNIPTNVNRLSMDWIGSF 771
               G W   F    +AA     FI  F+        +  ++ N          MDW+G+F
Sbjct: 301  -EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTF 359

Query: 772  TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 951
              V+ L       +       N                 F  +EL  A +P+L   ++ +
Sbjct: 360  CLVIFLASLTLTCSLVDL---NFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTD 416

Query: 952  RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 1131
            R ++    A  F   +  +  FY   +  ++    P   G    I  +  +I +   G+ 
Sbjct: 417  RNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYY 476

Query: 1132 MKKIRPAVLLTFSMVGFNLGCI----IFSVTPVHQTYFRNILGTMIILPLGMDLSFPASS 1299
            +K  R     TF  +   +G +    I  + P   T+ + +L   +++P+    +   S 
Sbjct: 477  IK--RRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLL---LLIPILYTTTVRTSL 531

Query: 1300 II-LSDNLPNQHQGMAGSLVNT 1362
            +I L   +P ++Q  A S+  T
Sbjct: 532  LISLIAAVPYKNQTAAASISYT 553

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 50/239 (20%), Positives = 100/239 (41%), Gaps = 3/239 (1%)
 Frame = +1

Query: 46  IAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 225
           + ++   S+CS  +DE     +       P    +  Q++  +F   ++   +  G+   
Sbjct: 53  LGDDDTSSECS--HDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIY 110

Query: 226 LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 405
              +  L ++ +  ++     V  + L  G    +SG L D+YG + +++ G +I V+ S
Sbjct: 111 YPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVAS 170

Query: 406 LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 585
           +  G++     G+  +  R  Q +GIS  +    G++       T+K+    + VGA S 
Sbjct: 171 I--GIAKAPSYGV-IVFLRCIQSIGISPTIAISSGVVSDF----TVKRERG-TFVGATSG 222

Query: 586 ---IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 753
              IG  +G L   ++       W   F+  T+       I ++ +P    T V  LS+
Sbjct: 223 LVLIGQGIGPLLGAVITAALH--WRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 38/164 (23%), Positives = 71/164 (43%)
 Frame = +1

Query: 172 IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           I S +L   L+       ++I+N +  + ++   +  WL+  + L +  F L+ GR   I
Sbjct: 23  IISLLLVLFLSSLDIIIVVTILNTIADKFNAYSKIG-WLITGYSLSNALFTLLWGRFAVI 81

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
           +G K  L++  +I  I SL+  +   S+S    I  R   G G S +   V  +   +  
Sbjct: 82  FGSKTTLMVSIIIFEIGSLVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVD 138

Query: 532 PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 663
             T  +  +++++     + + LG    G  A     +W W FY
Sbjct: 139 EHT--RGTIVTLLSLSYAVASALGPYIGG--ALTEYVTWRWCFY 178

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
            YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 93/446 (20%), Positives = 168/446 (37%), Gaps = 16/446 (3%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS--SDSLKVWLVA-SFPLVSGSFILVSGRL 342
            IF    S  L +       +I++ L   + S  +D   V LVA S+      F  + G+ 
Sbjct: 80   IFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCAIFQPLFGKT 139

Query: 343  GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
             D++G K +LI   ++     L  GLS    +  + I+ R   G+G   +      +I  
Sbjct: 140  SDVFGRKPLLISSNLLFFAGCLTCGLS---KTIWWLILGRLVTGIGGGGLTSMCTIIIND 196

Query: 523  IYKPGTLKKNMVISIVGAMS-PIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF- 696
            I     L+   V    G +   +G   GGL  GL +    G W  AF       F++T  
Sbjct: 197  IVP---LRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNG-WRMAFMIQLPFCFLSTIS 252

Query: 697  ISYYSIPNNIPTNVNRLSM-------DWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXX 852
            I  Y   ++   ++ R S+       DW+G+ T V  L+LF            +      
Sbjct: 253  IIVYLDLSDDKQDLGRSSLYCKLRLIDWLGALTLVTFLLLFLVTMTIGGQHVPYGSLRFF 312

Query: 853  XXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSF 1032
                            E+  A +P+LP   +RN+ ++    A  F        T+Y   +
Sbjct: 313  LLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGSSLANWFCMMGMMTITYYLPIY 372

Query: 1033 VLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKK--IRPAVLLTFSMVGFNLGCIIFS 1206
              ++ N  P+  G        S  + +    + ++K      +L+T  ++       I  
Sbjct: 373  WSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYYRLLMTSCLIIIFGQLQIVY 432

Query: 1207 VTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSL 1386
            +TP    + + IL  + +   G+ +    + + +   +P++HQ    SL          +
Sbjct: 433  ITPEMPQWRQYIL--LAVPGFGVSILITVTLLAMIAAVPHKHQAATTSLSYAFRTTGCII 490

Query: 1387 FLGIAGTVEQH-CNKNGTDLLRGYRG 1461
               +AG + Q+   KN T  +  + G
Sbjct: 491  GASLAGAIFQNTLKKNVTTAVMKFLG 516

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 4/171 (2%)
 Frame = +1

Query: 163 YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRL 342
           Y  + +  LS  L         +I+  + +QL S   +  WL   + L +   +L+ GR+
Sbjct: 61  YVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIG-WLFTGYSLPNALLVLIWGRI 119

Query: 343 GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
               G K  ++   VI  I SLI+ L+    S    I  R   G+G    + ++  +IG 
Sbjct: 120 ATPIGFKATMLFAIVIFEIGSLISALAS---SMNMLIGGRVIAGIG-GCGIQSLSFVIGS 175

Query: 523 IYKPGTLKKNMVISIVGA----MSPIGATLGGLFSGLVATESEGSWPWAFY 663
                + K+ M+I+I+ +     S +G  LGG+F+  V      +W W FY
Sbjct: 176 TLVEES-KRGMLIAILSSSFAIASVVGPFLGGVFTSSV------TWRWCFY 219

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 39/132 (29%), Positives = 60/132 (45%), Gaps = 5/132 (3%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           WL+A + L +  F+L+ GR+  + GLK  L+   VI    SL   ++G ++S    I AR
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSL---MAGAANSMGMLIGAR 102

Query: 463 AFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVA 627
              G G S       G+  ++Y  GT       +  VI+++G    +    G    G +A
Sbjct: 103 VISGFGGS-------GIESLVYGVGTSIVEEKHRARVITVLGIAYMLAEGAGPFVGGGLA 155

Query: 628 TESEGSWPWAFY 663
                SW W FY
Sbjct: 156 --EHVSWRWCFY 165

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
            (REAL)
          Length = 560

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 94/463 (20%), Positives = 171/463 (36%), Gaps = 19/463 (4%)
 Frame = +1

Query: 19   KKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQL 198
            K  I  S  + E ++  D +D  D     ++  S + N     +T     F        L
Sbjct: 14   KDGIYGSIEVTETSLVEDNADIEDVDKDEDMALSRIPNLWIIEATLFSNVF--------L 65

Query: 199  LNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLIL 378
                GT  T S    +  + +   S+  W+  ++ + S SF  + G   D  G +  L  
Sbjct: 66   SGFDGTV-TASTYQTIGNEFNQM-SISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFF 123

Query: 379  GYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMV 558
                  I  L   LS   ++     + RA  G+G   ++  +  ++     P + K+ + 
Sbjct: 124  ANAAFTIGCLACSLSTNIYT---LSLMRALAGIGGGGLI-TLSTIVNSDVIPSS-KRGIF 178

Query: 559  ISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN------ 720
             +    +   GA  G  F G +A  S   W W F      + I++ +  Y +PN      
Sbjct: 179  QAFQNLLLGFGAICGASFGGTIA--STIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNH 236

Query: 721  ---NIPTNVNRL--SMDWIGSFTGVLGL---ILFNFVWNQAPADGWNXXXXXXXXXXXXX 876
               NI  N  R+   +D  GS   + GL   +L+  +        W              
Sbjct: 237  ENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIA 296

Query: 877  XXXXFGIYELRYAENPLLPSEIIRNR-QLIMILTAMTFGWGSFG-IWTF-YYFSFVLNLR 1047
                F  +E +     ++P E++ +    +++L ++  G+ S+  ++T   +F  VL   
Sbjct: 297  ILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVL--- 353

Query: 1048 NYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQT 1227
              S   AG    I  +   + ++  GF M K     L +   VG +L  +   +    + 
Sbjct: 354  GDSTAKAGLRLAIPSLFTPVGSLITGFSMSKYN--CLRSLLYVGVSLMFLGNFLFLFIEK 411

Query: 1228 YFRNILGTMIILP--LGMDLSFPASSIILSDNLPNQHQGMAGS 1350
               N L ++ ++P  LG  ++FP +        P   Q  A S
Sbjct: 412  TSPNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATS 454

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 3/160 (1%)
 Frame = +1

Query: 142 FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
           +N    ++  +FS  L   L+   +T   +IMN +  +  S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAF 87

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLV 492
             + G+L DI G +  L+       +  L+T    ++ +   F IARA  G+   G++ +
Sbjct: 88  QPLYGKLSDIIGRRPALLTAQFFFGLGCLMT---CFARNVTEFSIARAVCGIGAGGLNAI 144

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLF 612
               +  I    + G  +    I + G    +GA LGG+F
Sbjct: 145 SSIAVSDICTARERGVYQGYANI-VFGFGQLLGAPLGGIF 183

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 46/178 (25%), Positives = 81/178 (45%), Gaps = 8/178 (4%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           WL   + L +   +L+ GR+  + G K   +   VI  + SL++ L   ++S    I  R
Sbjct: 82  WLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---ANSMDMLIGGR 138

Query: 463 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV----GAMSPIGATLGGLFSGLVAT 630
              G+G S V   V  +   + +     + ++I+++    G  S +G  LGG F+  V  
Sbjct: 139 VIAGIGGSGVQSLVFVISSTLVE--ERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHV-- 194

Query: 631 ESEGSWPWAFYAYT----LAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLI 792
               +W W FY       LA F+  F+++Y+ P     N +    + +G+  G LGL+
Sbjct: 195 ----TWRWCFYINLPVGGLAFFL--FLTFYN-PEKWVVNKDTAEDEVVGN--GRLGLL 243

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease of
            basic amino acids in the vacuolar membrane
          Length = 474

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 74/361 (20%), Positives = 140/361 (38%), Gaps = 19/361 (5%)
 Frame = +1

Query: 271  SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
            S+  W+  ++ + S SF  + G   D  G +  L        I  L  G S   +   F 
Sbjct: 2    SISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFM 61

Query: 451  IIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
               RA  G+G   ++  +  ++     P + K+ +  +    +   GA  G  F G +A 
Sbjct: 62   ---RALTGIGGGGLI-TLSTIVNSDVIPSS-KRGIFQAFQNLLLGFGAICGASFGGTIA- 115

Query: 631  ESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS-----------MDWIGSFTG 777
             S   W W F      + I++ +  Y +PN    N    S           +D +GS   
Sbjct: 116  -SSIGWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILI 174

Query: 778  VLGL---ILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIR 948
            + GL   +L+  +        W                  F ++E + +   ++P E++ 
Sbjct: 175  ITGLTLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVN 234

Query: 949  NRQLIMILT-AMTFGWGSFG-IWTF-YYFSFVLNLRNYSPLWAGGSYFIFVISGTITAIS 1119
            +   +++L+ ++  G+ S+  ++T   +F  VL     S   AG    I  +   + ++ 
Sbjct: 235  SSYSVVVLSISILVGFASYAYLFTLPLFFQIVL---GDSTAKAGLRLTIPSLFTPVGSLI 291

Query: 1120 CGFLMKKIRPAVLLTFSMVGFN-LGCIIFSVTPVHQTYFRNILGTMII-LPLGMDLSFPA 1293
             GF M K     LL +  +    LG  +F    + +T    ++G  +I   LG  ++FP 
Sbjct: 292  TGFSMSKYNCLRLLLYIGISLMFLGNFLFLF--IEKTSPNWLIGLFLIPANLGQGITFPT 349

Query: 1294 S 1296
            +
Sbjct: 350  T 350

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 51/200 (25%), Positives = 92/200 (46%), Gaps = 9/200 (4%)
 Frame = +1

Query: 181 CMLSQLLNLAGTTQTLS------IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRL 342
           CM++ LL  AG   +L        +  L +Q   S+ L    V  + +  G    +SG L
Sbjct: 87  CMVA-LLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGL 145

Query: 343 GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
            D+YG + ++++G +I V  S+  GL+  +  G+  +  R  Q  GIS ++    G++G 
Sbjct: 146 ADVYGRRPVILIGMLIYVCASI--GLACSNSYGV-IVFLRCLQSAGISPIIAINSGVVGD 202

Query: 523 IYKPGTLKKNMVISIVGAMSPIGATL-GGLFSGLVATESEGSWPW--AFYAYTLAAFINT 693
                T+K+    + VGA+S  G TL G  F  L+      ++ W   F+  T+      
Sbjct: 203 F----TVKQERG-TFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCM 255

Query: 694 FISYYSIPNNIPTNVNRLSM 753
            +++  +P    + V  +S+
Sbjct: 256 LVNFLLLPETKRSIVGNMSI 275

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 51/222 (22%), Positives = 93/222 (41%), Gaps = 6/222 (2%)
 Frame = +1

Query: 16  KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNS--SLRNPDYFNSTTQEYAFIFSCML 189
           K++N +     A   +    +   D + ++E +N+  S R           YA + +  L
Sbjct: 25  KEQNQQQKQQFAVSQVSMHTAAEQDAASALENRNAKHSARENSALPKGFVLYASLTALAL 84

Query: 190 SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           S  L    T    +I+  + +Q  S   +  WL   + L +    L+ GR+    G K+ 
Sbjct: 85  SLFLAALDTMIVSTIIEEVAKQFGSYSEIG-WLFTGYSLPNALLALIWGRIATPIGFKRT 143

Query: 370 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
           ++   VI  + SLI+ L+   +  I   +     G GI   L  V+G   ++ +     +
Sbjct: 144 MLFAIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQ-SLSFVIG-SNLVEES---NR 198

Query: 550 NMVISIVGA----MSPIGATLGGLFSGLVATESEGSWPWAFY 663
            ++I+I+       S +G  LGG+F+  V      +W W FY
Sbjct: 199 GVLIAILSCSFAIASVVGPFLGGVFTSRV------TWRWCFY 234

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 2/144 (1%)
 Frame = +1

Query: 328 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 507
           +SG L D+YG + +++ G +I V+ S+  GL+  +  G+  +  R  Q  GIS ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLACSNSYGV-IVFLRCVQSAGISPLIAISS 208

Query: 508 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW--AFYAYTLAA 681
           G++G         K+   S VGA+S   A +G  F  L+      ++ W   F+  T+  
Sbjct: 209 GVVG-----DFTTKSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 682 FINTFISYYSIPNNIPTNVNRLSM 753
                I+++ +P    T    LS+
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSI 286

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 4/179 (2%)
 Frame = +1

Query: 88  DESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 267
           +E P  E + S  +     N +  +   + S  L    +   +T   +IMN +  +   S
Sbjct: 18  EEVPEGEYEISLEKKYHEHNLSLPKVPILSSLWLGSFFSSLDSTIVANIMNRVAEEFAES 77

Query: 268 DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 447
           D  K W+  SF L + +F  + G+L DI G K  ++  +    +  L+T    ++ +   
Sbjct: 78  DK-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLT---CFAQNVTQ 133

Query: 448 FIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS----IVGAMSPIGATLGGLF 612
           F IARA  G+G   +  N +  I       T ++ +       + G    +GA LGGLF
Sbjct: 134 FSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQVLGAPLGGLF 190

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 51/198 (25%), Positives = 88/198 (44%), Gaps = 5/198 (2%)
 Frame = +1

Query: 85  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 264
           +DE+  + +K S+   PD   ++ +    +F  +LS  L++  T   + I+  +   + +
Sbjct: 17  SDETKDLSVKQSACIAPD---ASKRNRVKLFLSLLSLGLSMFVTALDVLIVGTIIDTVCT 73

Query: 265 S--DSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH 435
           S  D  K  W+V  + L +  F L+ GRL  + G +  +I   ++    SLI+ L   + 
Sbjct: 74  SFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISAL---AK 130

Query: 436 SGIFFIIARAFQGLGIS--LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGL 609
           S    I  R   G+G S    L  V+G   +  K   L  +++       S +G  LGG 
Sbjct: 131 SMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGA 190

Query: 610 FSGLVATESEGSWPWAFY 663
           F+  V      +W W FY
Sbjct: 191 FTTHV------TWRWCFY 202

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
            complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 74/347 (21%), Positives = 135/347 (38%), Gaps = 32/347 (9%)
 Frame = +1

Query: 202  NLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILG 381
            ++ GT QTL+  +      +S  SL   +     ++S +  +   R  DI+G   +LIL 
Sbjct: 74   DVRGTYQTLATSS------YSKHSLLATVQCINQVISAAGQIWYARASDIFGRTPILILS 127

Query: 382  YVILVIWSLI----TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
             +   I +LI    T +S Y+     + +     G   S+++  VL     +    TLK 
Sbjct: 128  ILFYFIGTLIESQATDISKYAAGSCIYAL-----GYAGSVLVTQVL-----VSDYSTLKW 177

Query: 550  NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAF----YAYTLAAF----INTFISY 705
             +V S V  +  I  T  G   G +  +    W W F    + + LA+         + Y
Sbjct: 178  RLVSSTVLFLPNIINTWVG---GNITEDVGNRWQWGFGMWAFIFPLASIPLLCCLAHMKY 234

Query: 706  YSIPN--------NIPTNVN-----------RLSMDWIGSFTGVLGLILFNFVWNQAPAD 828
             +I N        + P +++           +L M  +        LIL      +   +
Sbjct: 235  LAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLILLVAFFALILVPLTLAKGLHE 294

Query: 829  GW-NXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFG 1005
            GW +                 F  +EL++A NP+ P ++I++R +   +    F    + 
Sbjct: 295  GWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGIYGGIGVSLFLEFVYD 354

Query: 1006 IWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR 1146
            I + Y ++ ++   N S   A     +F     +TA   GF++ K+R
Sbjct: 355  IGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFVVVKVR 401

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 42/171 (24%), Positives = 76/171 (44%), Gaps = 4/171 (2%)
 Frame = +1

Query: 163 YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRL 342
           YA + +  LS  L         +I+  + +Q  S   +  WL   + L +    L+ GR+
Sbjct: 67  YASLIALALSLFLAALDIMIVSTIIEEVAKQFGSYSEIG-WLFTGYSLPNALLALIWGRI 125

Query: 343 GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
               G K+ ++   VI  I SLI+ L   ++S    I  R   G+G    + ++  +IG 
Sbjct: 126 ATPIGFKETMLFAIVIFEIGSLISAL---ANSMSMLIGGRVIAGVG-GCGIQSLSFVIGS 181

Query: 523 IYKPGTLKKNMVISIVGA----MSPIGATLGGLFSGLVATESEGSWPWAFY 663
                + ++ ++I+++       S +G  LGG+F+  V      +W W FY
Sbjct: 182 TLVEES-QRGILIAVLSCSFAIASVVGPFLGGVFTSSV------TWRWCFY 225

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 76/380 (20%), Positives = 141/380 (37%), Gaps = 20/380 (5%)
 Frame = +1

Query: 271  SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 450
            ++  W+  ++ + S SF  + G   D  G +  L        I  L  GLS    + +  
Sbjct: 90   NISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLSP---NIVVL 146

Query: 451  IIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
               RA  G+G   ++  +  ++     P + K+ +  +    +  +GA  G  F G +A 
Sbjct: 147  SFMRALTGIGGGGLI-TLSTIVNSDMIPSS-KRGIFQAFQNLLLGLGAICGASFGGSIA- 203

Query: 631  ESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRL-----------SMDWIGSFTG 777
             S   W W F+        N+ I    +PN        +            +D  GS   
Sbjct: 204  -SSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKDIDVTGSVFI 262

Query: 778  VLGL---ILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIR 948
            ++GL   +L+  + +      W                  F   E + +   ++P E++R
Sbjct: 263  IIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSARAIIPLELMR 322

Query: 949  NRQLIMILT-AMTFGWGSFG-IWTF-YYFSFVLNLRNYSPLWAGGSYFIFVISGTITAIS 1119
            +    ++LT ++  G+ S+  ++T   +F  VL     S   AG    I  +   +  + 
Sbjct: 323  SSFSFVVLTISILVGFASYAYLFTLPLFFQIVL---GDSTAKAGLRLTIPSLFTPVGGLI 379

Query: 1120 CGFLMKKIRPAVLLTFSMVG-FNLGCIIFSVTPVHQTYFRNILGTMIILP--LGMDLSFP 1290
             G  M +     +L ++ V    LG  +F      +    N L  + ++P  LG  ++FP
Sbjct: 380  TGICMSRYNCLQILLYAGVFLMALGNFLFLFI---EKGSPNWLVGLFLIPANLGQGITFP 436

Query: 1291 ASSIILSDNLPNQHQGMAGS 1350
            A+        P   Q  A S
Sbjct: 437  ATLFTFIFAFPKSRQATATS 456

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 2/129 (1%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           W+V+ + L      L+ GR   I+G K  L+L  +I    SLI   S  S+S    I  R
Sbjct: 80  WIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI---SAVSNSMNVLIGGR 136

Query: 463 AFQGLGISLVLPNVLGLIGMIYKPGTLKKN--MVISIVGAMSPIGATLGGLFSGLVATES 636
              G+G S     +  L  +I    T +++  + IS++     + A  G    G   T  
Sbjct: 137 VVAGIGGS----GIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHV 192

Query: 637 EGSWPWAFY 663
             +W W FY
Sbjct: 193 --TWRWCFY 199

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 43/183 (23%), Positives = 77/183 (42%), Gaps = 1/183 (0%)
 Frame = +1

Query: 172 IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           IF C LS   N +     LS+   ++++ H S          F +  G    +     + 
Sbjct: 86  IFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEE 142

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNV-LGLIGMIY 528
           YG + ++ L      IW ++ G +         II   F G GIS    +V LG++  ++
Sbjct: 143 YGRRNIMQLSLFFTNIWQILGGKA----PNFGTIIVARFLG-GISQAGGSVTLGVVADMW 197

Query: 529 KPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 708
           +P        ++ V   S +GA +G +F GL+  E   SW W F+   +   +   + ++
Sbjct: 198 QPQD--HGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFGGVTQLLHFF 253

Query: 709 SIP 717
            +P
Sbjct: 254 LVP 256

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
            (REAL)
          Length = 562

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 93/467 (19%), Positives = 175/467 (37%), Gaps = 29/467 (6%)
 Frame = +1

Query: 37   SSYIAEETIRS--DCSDANDESPSMELKNSSLR-NPDYFNSTTQE--------YAFIFSC 183
            SS I   T++   DC+  + +   + + N+ +R N +  N+   E          +I   
Sbjct: 3    SSSIKHVTLKKKGDCTYGSIDGSGIVIANNHVRDNEEIQNADDDEDIPLSRIPNLWIIEA 62

Query: 184  MLSQLLNLAGTTQTLSIMNVLT-RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 360
             L   + LAG   T++     T     +  S+  W+  ++ + S SF  + G   D  G 
Sbjct: 63   TLFSNVFLAGFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGSFSDALGR 122

Query: 361  KKMLILGYVILVIWSLITGLSGYSHSGIFFI-IARAFQGLGISLVLPNVLGLIGMIYKPG 537
            +  L     +  I  L    S    + I+ +   RA  G+G   ++  +  ++     P 
Sbjct: 123  RNCLFFANAVFTIGCLACSFS----TNIYMLSFMRALAGIGGGGLI-TLSTIVNSDVIPS 177

Query: 538  TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
            + K+ +  +    +   GA  G  F G +   S   W W F      + I + +  Y +P
Sbjct: 178  S-KRGIFQAFQNLLLGFGAICGASFGGTIT--STIGWRWCFLIQVPISMIASLLMNYYVP 234

Query: 718  N---------NIPTNVNRL--SMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXX 864
            N         NI  +  ++   +D  GS   + GL L     +   +  W          
Sbjct: 235  NQKEYDDQKINILLSSKKILKDIDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLL 294

Query: 865  XXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILT-AMTFGWGSFG-IWTF-YYFSFV 1035
                    F + E +     ++P E++ +    ++L+ ++  G+ S+  ++T   +F  V
Sbjct: 295  ASIVIIILFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASYAYLFTLPLFFQIV 354

Query: 1036 LNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR-PAVLLTFSMVGFNLGCIIFSVT 1212
            L     S   AG    I  +   + ++  G  M K      LL   +    LG  +F   
Sbjct: 355  L---GDSTAKAGLRLTIPSLFTPVGSLITGISMSKYDCLQSLLYIGIFLMFLGNFLFLF- 410

Query: 1213 PVHQTYFRNILGTMII-LPLGMDLSFPASSIILSDNLPNQHQGMAGS 1350
             + +T    ++G  +I   LG  ++FP +        P + Q  A S
Sbjct: 411  -IEKTSPNWLIGVFLIPANLGQGITFPTTLFTFIFAFPKRDQATATS 456

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 4/160 (2%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFI 324
           N +  +   + S  L   L+    T   +IMN +  +   SD  K W+  S+ L + +F 
Sbjct: 31  NLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDK-KQWIATSYLLTNTAFQ 89

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNV 504
            + G+L D+ G K  ++  +    +  L+T    +++S   F IARA  G+G   +  N 
Sbjct: 90  PLYGKLSDLTGRKFAVLTAHFFFGLGCLLT---CFANSVTQFAIARAICGVGGGGI--NA 144

Query: 505 LGLIGM----IYKPGTLKKNMVISIVGAMSPIGATLGGLF 612
           +  I +      +   + +     + G    +GA +GGLF
Sbjct: 145 MSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLF 184

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 3/117 (2%)
 Frame = +1

Query: 385 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
           +++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K +   
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF- 192

Query: 565 IVGAMSPIGATLGGLFSGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 726
             G+ +  GA  G + +GL +  + G    W W +    L +   +F  ++ +P+N+
Sbjct: 193 FFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 3/117 (2%)
 Frame = +1

Query: 385 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
           +++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K +   
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF- 192

Query: 565 IVGAMSPIGATLGGLFSGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 726
             G+ +  GA  G + +GL +  + G    W W +    L +   +F  ++ +P+N+
Sbjct: 193 FFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 59/234 (25%), Positives = 101/234 (43%), Gaps = 17/234 (7%)
 Frame = +1

Query: 4   DTDLKKKNIEVSSYIAE--ETIRSDCSDANDESPSMEL----------KNSSLRNPD--Y 141
           DT+ KKKN + +   +    T+  +  D  D+  + E+          K   L   D  Y
Sbjct: 14  DTETKKKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPY 73

Query: 142 FNSTTQEYAFIFSCMLSQ-LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGS 318
              T ++  F+ + + S    +  G+      +  L  +   ++ L    V  + L  G 
Sbjct: 74  TLLTYRQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGI 133

Query: 319 FILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS-GYSHSGIFFIIARAFQGLGISLVL 495
              +SG L D+YG + +++LG +I VI S+  GL+   S+  + F+  R  Q  GIS ++
Sbjct: 134 APTISGGLADVYGRRPIILLGMLIYVIASI--GLACSKSYGAVVFL--RCLQSAGISPII 189

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL-GGLFSGLVATESEGSWPW 654
               G+ G      T+K     + VGA+S  G TL G  F  L+      ++ W
Sbjct: 190 AINSGVAGDF----TVKSERG-TFVGAVS--GFTLMGQAFGSLIGAALTAAYDW 236

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar to
            uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
            Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 63/300 (21%), Positives = 120/300 (40%), Gaps = 12/300 (4%)
 Frame = +1

Query: 142  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
            +N +  +   + S  L   +     T   +IMN +  +   SD  K W+  SF L + +F
Sbjct: 26   YNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDK-KQWIATSFLLTNTAF 84

Query: 322  ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLV 492
              + G+L DI G +  L+  +    +  L+T    ++ S   F +ARA  G+   GI+  
Sbjct: 85   QPLYGKLSDITGRRFALLTAHFFFGLGCLLT---CFAQSVEQFALARAICGIGGGGINAC 141

Query: 493  LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYT 672
                +  I    + G+ +    I + G    +G  +GGL    +       W   F    
Sbjct: 142  SSIAVSDICTAKERGSYQGYANI-VFGTGQMLGGPIGGLLIDTI------GWRAIFAVQV 194

Query: 673  LAAFINTFISYYSIP---NNIP------TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPA 825
                  +F++Y +I    ++IP      T +N   +D +GS + V+ +    F+     +
Sbjct: 195  PIIMFCSFLTYKNITIKLSHIPPVSERFTWMNLSRIDIMGSSSLVVVICGILFIC----S 250

Query: 826  DGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFG 1005
              WN                 F + E  +A+  +LP ++++    +  L  +   + +FG
Sbjct: 251  TNWN---KVILSTFTIVGFLFFIVTETYFAKECILPLKLLKGASGLCSLVTVLSSFITFG 307

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 29/103 (28%), Positives = 49/103 (47%)
 Frame = +1

Query: 172 IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           + S  L   ++    T   +IMN +  +   SD  K W+  S+ L + +F  + G+L DI
Sbjct: 45  LLSLWLGSFVSALDGTVVANIMNSIAAEFAESDK-KQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 480
            G K  +I  +    +  L+T    ++ +   F IARA  G+G
Sbjct: 104 TGRKVAVITAHFFFALGCLLT---CFAQNVTQFSIARAICGIG 143

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 3/159 (1%)
 Frame = +1

Query: 142 FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 321
           +N +  +   + S  L   L+    T    IMN +    ++S+  K W+  S+ L + +F
Sbjct: 59  YNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQ-KQWIATSYLLTNTAF 117

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLV 492
             + GRL DI G K   +   ++   + + + L+ +S +   F +ARA  G+   GIS +
Sbjct: 118 QPLYGRLSDIIGRKYTQL---IVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAM 174

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGL 609
               +  I  + + G + +       GA   IGA +GGL
Sbjct: 175 SSIAVSDICTVKERG-MYQGYANIFYGAGQLIGAPIGGL 212

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 49/224 (21%), Positives = 94/224 (41%), Gaps = 8/224 (3%)
 Frame = +1

Query: 31  EVSSYIAEETIRS--DCSDANDESPSMELKNSS----LRNPDYFN-STTQEYAFIFSCML 189
           +V SY  ++   S  + SD N ++   + K++     + +P Y    TT++   +  C  
Sbjct: 27  KVRSYHNDDDDESVINISDINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCAF 86

Query: 190 SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           +   +         +++V+  + + ++ +    V  + +  G    + G L D  G + +
Sbjct: 87  TGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPV 146

Query: 370 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
           ++    +LV      GL+  SH+    I+ R  Q  GIS V+    G++G I      ++
Sbjct: 147 VLSS--VLVYCCACIGLA-CSHTYAQIIVLRCLQAAGISPVIAINSGIMGDI--TTRAER 201

Query: 550 NMVISIVGAMSPIGATLGGLF-SGLVATESEGSWPWAFYAYTLA 678
              +  V     IG+  G L  +GL AT     W W    + LA
Sbjct: 202 GGYVGYVSGFQVIGSAFGALIGAGLSAT-----WSWRSIFWFLA 240

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 37/145 (25%), Positives = 68/145 (46%)
 Frame = +1

Query: 244 LTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 423
           L ++ +  ++L    V  + +  G    VSG L DIYG + +++ G ++ V+ S+  G++
Sbjct: 125 LEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVVASI--GIA 182

Query: 424 GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             +  G+  I  R  Q  GIS ++    G +G      T+K     + VGA+S +   +G
Sbjct: 183 ACNSYGV-IIFLRCLQSTGISPLIAISSGAVGDF----TVKAERG-TFVGAVSGL-VLMG 235

Query: 604 GLFSGLVATESEGSWPWAFYAYTLA 678
             F  L+      ++ W    + LA
Sbjct: 236 QAFGSLIGAALAAAYNWRAIFWFLA 260

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 8/117 (6%)
 Frame = +1

Query: 400 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 579
           WS+IT  +G+  S    I  R   G       P ++ L+ MIYKP    K + +   G  
Sbjct: 144 WSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIAL-FFGC- 201

Query: 580 SPIGATLGGLFSGLVAT--------ESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 726
               A L G F GL+AT             W W +    L +   +   Y+ +P +I
Sbjct: 202 ----AALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLISITASIWIYFGLPTDI 254

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 3/114 (2%)
 Frame = +1

Query: 394 VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVG 573
           + W L+T  +G S S     I R F G+  +      + L G  +K G + +     IVG
Sbjct: 160 ICWGLLTIGTGKSTSVRQIKILRFFTGVFEAPSYIAYMYLFGSFFKSGEVARRSGFMIVG 219

Query: 574 AMSPI---GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 726
             + +   GA    +F  L  +     W W F      + +   + +YS+P +I
Sbjct: 220 QYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGAISIVVALLGFYSLPGDI 273

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 53/267 (19%), Positives = 105/267 (39%), Gaps = 20/267 (7%)
 Frame = +1

Query: 55  ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 234
           + + + C     E P+ +    +  N      T      + +  L   L+   TT   ++
Sbjct: 6   DLLLAPCLSPIPEIPTFDSSYDAAANHSVLTETKTRI-IVIALFLGSFLSALDTTIVSTL 64

Query: 235 MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 414
           +  +   L +S  +  W+  S+ L   +F  + G+L DI+G K +L+   ++  I   + 
Sbjct: 65  LPTIASDLDASSQMS-WIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALC 123

Query: 415 GLSGYSHSGIFFIIARAFQGL-GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 591
           G S ++ +       R   G+ G  L   + +    +I     L+K  V   +G +    
Sbjct: 124 G-SPWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDII----PLRKRGVYQGLGNICFSL 178

Query: 592 ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY--SIPNNIP------------ 729
               G   G V  +  G W WAF      A I+  +  +   +P++ P            
Sbjct: 179 GCASGSVLGAVLQQGIG-WRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARG 237

Query: 730 -----TNVNRLSMDWIGSFTGVLGLIL 795
                + V ++ +D++GS T V+ ++L
Sbjct: 238 NTFQWSKVTKM-IDFVGSITLVMSMLL 263

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 54/236 (22%), Positives = 96/236 (40%), Gaps = 6/236 (2%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFI 324
           N    +   + S  L   L     T   ++MN +  +   SD  K W+  SF L + +F 
Sbjct: 34  NLALPKIPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK-KQWIATSFLLTNTAFQ 92

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVL 495
            + G+L D+   +K+  L         LI  +S ++ +   F I RA  G+   G+S + 
Sbjct: 93  PLYGKLSDVATGRKLATLIAQFFFFLGLI--ISCFAQNVTQFAIGRAVCGIGGGGVSAMS 150

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES--EGSWPWAFYAY 669
              +  I    + G + +     + G+   +GA LGGL    +   +      P A +  
Sbjct: 151 SIAVSDICTAKERG-MYQGYANIVFGSGQLLGAPLGGLLITTIGWRAIFAIQVPMALFCM 209

Query: 670 TLAA-FINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGW 834
            L    +N  +++    N   T  N   +D +GS T VL +    F+++ +    W
Sbjct: 210 FLTGRNVNIKLAHLPSRNERFTLKNLSRLDLLGSCTLVLSISGLLFLFSTSMNRTW 265

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa] {ON}
            weakly similar to uniprot|Q04301 Saccharomyces cerevisiae
            YMR088C VBA1 Permease of basic amino acids in the
            vacuolar membrane
          Length = 553

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 81/446 (18%), Positives = 167/446 (37%), Gaps = 20/446 (4%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            +F+  +   L    TT   +++  +  +L +S+ +  W+  S+ L   +F  + G+L D+
Sbjct: 35   VFALFVGSYLAALDTTIVTTLLPTIASELDASNQMS-WIATSYLLSCSAFQPLYGKLSDV 93

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
            +G K +LI   +      ++ G + ++ S     I R   G+G   +  N L  I     
Sbjct: 94   FGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDI 150

Query: 532  PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFI--NTFISY 705
                ++ +   +   +  +G   G L    +  +    W WAF      + +  +  + +
Sbjct: 151  IPLRQRGVYQGMGNIVFALGCASGSLIGAFL--QQRIGWRWAFLCQVPLSLLSCSLIMKF 208

Query: 706  YSIP-------------NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXX 846
             ++P               I T   R  +D+ GSFT +  ++L   + +           
Sbjct: 209  LNLPAGSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYG 268

Query: 847  XXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMI--LTAMTFGWGSFGIWTFY 1020
                            +       NP++P  ++ + + ++   LT   F   +F +  +Y
Sbjct: 269  TWALFIVGLALAGYTFVSTELSVHNPMVPIRLLGSNRTVLASSLTNWFFTMSTF-VLAYY 327

Query: 1021 YFSFVLNLRNYSPLWAGGSYFIFVISG-TITAISCGFLMKKIRPAVLLTFSMVGFNLGCI 1197
               F   + +  P W  G   +    G  I ++  G  MK+      L+ ++    +   
Sbjct: 328  VPVFWQTVYHLKP-WNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGT 386

Query: 1198 IFSVTPVHQTYFRNILG-TMIILP-LGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVIN 1371
            +      + T  + +L   M+ LP LG       + + L  ++   HQ    S+      
Sbjct: 387  LIVYLSTYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRA 446

Query: 1372 YSNSLFLGIAGTVEQHCNKNGTDLLR 1449
              ++L +  AG + Q  +K  T LLR
Sbjct: 447  IGSTLGVSFAGLIYQ--SKLQTSLLR 470

>NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155
          Length = 489

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 40/145 (27%), Positives = 72/145 (49%), Gaps = 10/145 (6%)
 Frame = +1

Query: 286 LVASFPL--VSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIA 459
           + ASF +  + GSF  V+G+L + YG K + ++  +I  + S I     +S+S +  I+ 
Sbjct: 87  ITASFSIGGLVGSF--VAGKLAEKYGRKYVSVVNCLIAFLGSFI---MFFSNSVLPMILG 141

Query: 460 RAFQGL--GISLVLPNV-LGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGL---FSGL 621
           R   G+  G+S+V+ ++ +  +  +   G+L         G M+ +   LG L   F+GL
Sbjct: 142 RTIVGIAAGVSVVVTSLFINDVAPVDWRGSL---------GTMNQLSINLGILLTQFAGL 192

Query: 622 --VATESEGSWPWAFYAYTLAAFIN 690
             V  E +G W W  +   + A +N
Sbjct: 193 KFVRNEDDGKWRWVMFIGMVLAILN 217

>KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 508

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 4/113 (3%)
 Frame = +1

Query: 400 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 579
           WS+IT  SG+  S    I  R   G       P ++ L+ MIYKP    K   I+   + 
Sbjct: 144 WSIITLCSGFVKSYHSLIALRVLLGAFEGGYFPAMVLLVSMIYKPEEQAKR--IAFFFSC 201

Query: 580 SPIGATLGGLF-SGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 726
           + +    GGL  +GL      G    W W +    L +       Y+ +P ++
Sbjct: 202 AALAGAFGGLIATGLATVHGAGGLNGWRWLYIIEGLVSTTAAVWIYFGLPTDV 254

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
            (SGE1) - Member of drug-resistance protein family [contig
            363] FULL
          Length = 562

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 91/465 (19%), Positives = 165/465 (35%), Gaps = 53/465 (11%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            IFS  L+  L        +++ + + +  +   ++  WL+  + L +   +L+ GR+  +
Sbjct: 10   IFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVG-WLMTGYNLPNALCMLLWGRIASL 68

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 531
             GLK  L+   VI    SL+  L   + S    I  R   G G S       G+  +++ 
Sbjct: 69   VGLKNSLVASIVIFEAGSLLAAL---ATSMGMLIGGRVIAGFGGS-------GIETLVFA 118

Query: 532  PGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
             GT       +  V++I+G    +    G    G  A     SW W F+       +   
Sbjct: 119  VGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFA--EHVSWRWCFFINIPIGGVALA 176

Query: 697  ISYYSIPNNIPTNVNRLSMDW-------------IGSFTGVLGLILF--NFVWNQAPADG 831
            I  +       T +N L+  W             + S T V+ L ++  + V     + G
Sbjct: 177  ILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGG 236

Query: 832  ----------------WNXXXXXXXXXXXXXXXXXFGIYEL-------RYAEN----PLL 930
                            WN                 F +Y+        R  EN    PL+
Sbjct: 237  FALIMLALTFGGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLV 296

Query: 931  PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 1110
            P  +  N  ++    A  F   +F + + Y   +   + N  P++A    +   +   IT
Sbjct: 297  PWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMSVPALIT 356

Query: 1111 AISCGFLMKK---IRPAVL--LTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 1275
             I    + +K   ++P ++  + F  +G  L  +  S T    +   ++L          
Sbjct: 357  VIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASIGYSMLAG-ASFGCVY 415

Query: 1276 DLSFPASSIILSDNLPNQHQG-MAGSLVNTVINYSNSLFLGIAGT 1407
             LS  +S + +  + P  H+  +  +  NT I      F GI  T
Sbjct: 416  QLSLLSSQLEVRKDDPEYHKNFIEVTAYNTFIKTMGFSFAGILST 460

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)
 Frame = +1

Query: 388 ILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISI 567
           ++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K +    
Sbjct: 123 LVFCWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-F 181

Query: 568 VGAMSPIGATLGGLFSGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 726
            G+ +  GA  G + +GL + +S      W W +    L +   T   ++ +P+N+
Sbjct: 182 FGSSALSGAFGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLPDNL 237

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 39.3 bits (90), Expect = 0.026
 Identities = 46/196 (23%), Positives = 81/196 (41%), Gaps = 3/196 (1%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSF 321
           N+ T+    +FS  LS  +         +I++ + +     D  K  W+V  + L +  F
Sbjct: 37  NNNTRLLLSLFSLGLSMFVTALDVLIVGTIIDTVCKSF--GDYTKSGWIVTGYSLPNALF 94

Query: 322 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
            L+ GR+    G +  ++   V+    SLI+ L   + S    I  R   G+G S +   
Sbjct: 95  SLLWGRISANLGPRISIVACIVLFEAGSLISAL---ARSMNMLIAGRVVSGVGGSGL--Q 149

Query: 502 VLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTL-- 675
            L L+          + +V+S++     I + +G    G   T    +W W FY      
Sbjct: 150 TLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAFTTHV--TWRWCFYINLPIG 207

Query: 676 AAFINTFISYYSIPNN 723
              I TF+ +Y+ P+N
Sbjct: 208 GVAILTFLCFYN-PHN 222

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 38.9 bits (89), Expect = 0.034
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 2/129 (1%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           W+V+ + L      L+ GR   I+G K  L+L  +I    SLI   S  S+S    I  R
Sbjct: 80  WIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI---SAVSNSMNVLIGGR 136

Query: 463 AFQGLGISLVLPNVLGLIGMIYKPGTLKKN--MVISIVGAMSPIGATLGGLFSGLVATES 636
              G+G S     +  L  +I    T +++  + IS++     + A           T  
Sbjct: 137 VVAGIGGS----GIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHV 192

Query: 637 EGSWPWAFY 663
             +W W FY
Sbjct: 193 --TWRWCFY 199

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 38.1 bits (87), Expect = 0.060
 Identities = 47/233 (20%), Positives = 93/233 (39%), Gaps = 25/233 (10%)
 Frame = +1

Query: 172 IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           + + ++   L+   TT   +++  +   L +S  +  W+  ++ L   +F  + G+L DI
Sbjct: 44  VLALLMGSFLSALDTTIVATLLPTIASDLDASSQMS-WIATAYLLSCSAFQPLYGKLSDI 102

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG-------ISLVLPNVLG 510
           +G K +LIL  +   +   I G S ++++       R   G+G        ++   +++ 
Sbjct: 103 FGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIP 161

Query: 511 LIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFIN 690
           L          K+ +   +V     +G   G +  G V  +  G W WAF      A + 
Sbjct: 162 L---------RKRGVYQGLVNICFSLGCASGSVL-GAVLQQGIG-WRWAFLVQVPMALVC 210

Query: 691 TFI--SYYSIPNNIP---------TNVNRLS-------MDWIGSFTGVLGLIL 795
             +      +P + P             RL        +D++GSFT +  +IL
Sbjct: 211 ALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVDFVGSFTLIASMIL 263

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 38/188 (20%), Positives = 76/188 (40%), Gaps = 3/188 (1%)
 Frame = +1

Query: 163 YAFIFSCML---SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVS 333
           + +  +C++   S ++ +  +  T     V+ R  H S  + V  +  +    G   L  
Sbjct: 73  HKYYIACVITFTSLVITIISSCWTFVSPKVIERY-HISHEVSVLGITFYIFGLGFGPLFL 131

Query: 334 GRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGL 513
             + ++YG +   I    + +IW  +T    +SH+ +  +  R   G   S  L    G 
Sbjct: 132 SPISELYGRRLTFIFSMTLSIIWQCLT---TWSHNVVGMMFGRFLSGFFGSAFLSIAGGS 188

Query: 514 IGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINT 693
           I  I+   T+   M +  +      G  LG + SG +  E   ++ W F    +A+ +  
Sbjct: 189 ISDIFDKATITIPMSLYTLSCF--YGPVLGPIVSGALYRE---NYRWVFATLLIASGVCL 243

Query: 694 FISYYSIP 717
            +  ++IP
Sbjct: 244 VLIIFTIP 251

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
            1:1 [contig 55] FULL
          Length = 559

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 73/353 (20%), Positives = 144/353 (40%), Gaps = 18/353 (5%)
 Frame = +1

Query: 172  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
            + S  L   L     T   ++MN +  +   SD  K W+  SF L + +F  + G+L D+
Sbjct: 43   LVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK-KQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 352  YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVLPNVLGLIGM 522
               +K   L  V    + L   +S ++ +   F + RA  G+   GI+ +   V+  I  
Sbjct: 102  ATGRKGAAL--VAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICT 159

Query: 523  IYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES--EGSWPWAFYAYTLA-AFINT 693
              + G + +     + G+   +GA LGGL    +   +      P       LA   +N 
Sbjct: 160  AKERG-MYQGYANIVFGSGQLLGAPLGGLLITTLGWRAIFAIQVPVTLLCMVLAFRNVNI 218

Query: 694  FISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXX 873
             +++   P    T  N   +D +GS T V+ +    F+++      W             
Sbjct: 219  KLAHLPPPKECFTLKNLSRLDLLGSCTLVMSISGLLFLFSTTLNKLW----------ISI 268

Query: 874  XXXXXFGIY---ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNL 1044
                 FG++   E  +A   ++P E++R    +     +   +  FG   F    ++  +
Sbjct: 269  FTAVSFGLFVYNEYYWATERIIPFELLRGESGVTSALTVLSSFVMFGD-VFRSPIYLQVV 327

Query: 1045 RNYSPLWAGGSYFIFVISGTI----TAISCGFLMKK-----IRPAVLLTFSMV 1176
            +N S   +G    +F++ G+I    +++  G+L+++     ++ A L+   M+
Sbjct: 328  QNVSLARSG----LFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIVLGMI 376

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 35/177 (19%), Positives = 79/177 (44%), Gaps = 5/177 (2%)
 Frame = +1

Query: 895  IYELRYAENPLLPSEIIRNRQL---IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLW 1065
            I+E +YA +PL P ++I++R +   ++I   + F W   G + F      +N  N S   
Sbjct: 315  IWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQR 374

Query: 1066 AGGSY-FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNI 1242
                Y F+ VI+GT+  +    ++K  R    + F +V + +   +        +    I
Sbjct: 375  ITSLYSFVSVITGTLLGL---VIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGI 431

Query: 1243 LGTMIILPLGMD-LSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
            +G++ ++  G    ++   + I +    +++  +  SL     N  +++   ++G +
Sbjct: 432  IGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAI 488

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 49/249 (19%), Positives = 93/249 (37%), Gaps = 21/249 (8%)
 Frame = +1

Query: 34  VSSYIAEETIRSDCSDANDESPSMELKNSSLRNPD---------------------YFNS 150
           +SS + EE     CS   D    ++L+ SS RN D                     + ++
Sbjct: 13  LSSKLTEE---EHCSILLDREAKLDLELSSERNDDGGKEHEVIFREDLADPEDIARHMST 69

Query: 151 TTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILV 330
             + Y        S ++ +  ++ TL   +++ +  H S  +    +  +    G   L 
Sbjct: 70  VRRYYISSLITFTSMVITMISSSWTLPSAHII-KSFHISHEVSTLGITLYVFGLGIGPLF 128

Query: 331 SGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLG 510
              L ++YG +   +    + +IW  +T +   + +G+ F   R   G   S  L    G
Sbjct: 129 LSPLSELYGRRITFLYALTLSIIWQCLT-IWSRTITGVMF--GRFLSGFFGSAFLSVAGG 185

Query: 511 LIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFIN 690
            I  I+    +   M I    A   +G +LG +  G +  E   S+ W F    + +   
Sbjct: 186 AIADIFDKDQIGIPMAIYTTSAF--LGPSLGPIIGGALYHE---SYKWTFITLLITSGCC 240

Query: 691 TFISYYSIP 717
             +  ++IP
Sbjct: 241 LVLIMFTIP 249

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
            to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
            Ferrioxamine B transporter member of the ARN family of
            transporters that specifically recognize siderophore-iron
            chelates transcription is induced during iron deprivation
            and diauxic shift potentially phosphorylated by Cdc28p
          Length = 611

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 77/401 (19%), Positives = 154/401 (38%), Gaps = 43/401 (10%)
 Frame = +1

Query: 337  RLGDIYGLKKMLILGYVILVIWSLI----TGLSGYSHSGIFFIIARAFQGLGISLVLPNV 504
            R  D++G   +LI+  +  V+ ++I    T +S ++    F+ +       GI L+L  +
Sbjct: 109  RASDVFGRLSILIIAVLFYVVGTVIESQATNVSRFAAGACFYQLGLT----GIILILEVI 164

Query: 505  LGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW--AFYAYTL- 675
                  +     L   +V S V A+  I   +    SG V +    +W W  A +A+ L 
Sbjct: 165  ------VMDFSNLNWRLVASFVPALPFI---INTWISGDVTSAIGTNWEWGIAMWAFILP 215

Query: 676  --------AAFINTFISYYSIPNNIPTNVNRLSMD-----------WIGSFTGVL----- 783
                          ++++ + P N+ +                   W   F G+L     
Sbjct: 216  LSCIPLVCCMLHMRYLAHKNAPENLMSEFKLYKQMPWSEYLVEIFFWKLDFLGLLLLCVS 275

Query: 784  -GLILFNFVWNQAPADGW-NXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQ 957
             GL+L  F         W +                 F ++E +YA NPL P ++I++R 
Sbjct: 276  FGLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRG 335

Query: 958  L---IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY-FIFVISGTITAISCG 1125
            +   ++I   + F W   G + +      ++    S       Y F+ VI+GT+     G
Sbjct: 336  IFSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSFVSVITGTL----LG 391

Query: 1126 FLMKKIR---PAVLLTFSMVGFNLGCIIF--SVTPVHQTYFRNILGTMIILPLGMD-LSF 1287
            F++ K+R   P +L        + G ++     +  H      I+G++ +L  G    ++
Sbjct: 392  FVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGDSGAH----AGIVGSLCLLGFGAGFFTY 447

Query: 1288 PASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 1410
               + I +    +Q+  +  +L     N  +++   ++G +
Sbjct: 448  TTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAVSGAI 488

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +1

Query: 334 GRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
           G +GD YG K   I+    +++  +ITG     H+  +F+IARAF G+ +  +  N
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF--IKHNFKYFLIARAFFGVVLGGIFGN 184

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 35.8 bits (81), Expect = 0.31
 Identities = 41/154 (26%), Positives = 63/154 (40%), Gaps = 9/154 (5%)
 Frame = +1

Query: 754  DWIGSFTGVLGLILFNFVWN--QAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPL 927
            D IG F   LGL LF   +N      + W                  FGI+E  +A    
Sbjct: 275  DVIGIFILALGLALFLLGFNLYSYQKNEWRSPLIICFLIIGGLLIISFGIWEY-FAPVSF 333

Query: 928  LPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYF----SFVLNLRN---YSPLWAGGSYFI 1086
            +P E++ NR +I   +     + SF IW  Y+F     F L+       + +++ GS F 
Sbjct: 334  IPWELLTNRTVIFTYSMAAAMYCSFYIWDSYFFRHHCRFNLSTARATYITNIYSIGSCFC 393

Query: 1087 FVISGTITAISCGFLMKKIRPAVLLTFSMVGFNL 1188
             ++ G I  I C   +K I     +  +M+G  L
Sbjct: 394  ALVVGVI--IRCYGRLKSIALFWGVPITMLGCGL 425

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 35.8 bits (81), Expect = 0.32
 Identities = 25/60 (41%), Positives = 34/60 (56%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           GSF L  GRLGDIYG +  LI+  VI +I ++I   S    +   ++I R   GLG  L+
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIAS--VKAWYQYMIGRIIAGLGCGLI 189

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 35.0 bits (79), Expect = 0.52
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 5/116 (4%)
 Frame = +1

Query: 328 VSGRLGDIYGLKKMLILGYVILVI--WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPN 501
           ++  L  +  LK+  +  Y+  ++  WS+IT  SG+  S    +  R   G       P 
Sbjct: 104 LAAELPAVLVLKRTNVKYYMSFLVFSWSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPA 163

Query: 502 VLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG---SWPWAF 660
           +  +I ++YKP    K +     G+ +  GA  G + +GL + +  G    W W +
Sbjct: 164 MTLIISIVYKPQEQAKRIAF-FFGSSALSGAFGGLIATGLASVKDAGGLEGWRWLY 218

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 35.0 bits (79), Expect = 0.56
 Identities = 94/501 (18%), Positives = 176/501 (35%), Gaps = 54/501 (10%)
 Frame = +1

Query: 37   SSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGT 216
            +S++ +E   +      DE  + + K  ++R  +  + +  ++      + S  +   G 
Sbjct: 34   NSFVNKEQYEAHQDSTTDEHETGKKKTLTIRKTELLSKSYDKWYLQAILLFSAFVCGYGY 93

Query: 217  TQTLSIMNVLT---RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYV 387
                +I  + T      +S  SL   +     +VS +  +V  RL DIYG   +L++  V
Sbjct: 94   GLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGRMSLLVVAIV 153

Query: 388  ILVIWSLIT----GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 555
            +  + ++I      +  Y+   IF+        +G+ L+L  +L          +L+  +
Sbjct: 154  LYAVGTIIQCQAYDVQRYAAGSIFYNAGY----VGVILILLLILSDFS------SLRWRL 203

Query: 556  VISIVGAMSPIGAT-LGGLFSGLVATESEGSWP---WAF-YAYTLAAFINTFISYYSIPN 720
                V     I  T + G  +         SW    WAF +  +    +   I  +    
Sbjct: 204  FYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPILCCMIHMHWRVR 263

Query: 721  NIPT----------------NVNRLSMDWIGSFTGVL------GLILFNFVWNQAPADGW 834
            N P                  V   ++ W     GVL      G IL         +  W
Sbjct: 264  NDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKW 323

Query: 835  NXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 1014
            N                 F  +E R+A NPL+P +++++R                G+W 
Sbjct: 324  NHSNIIGPFVLGFVLIPIFSYWEARWATNPLVPYKLVKDR----------------GVWA 367

Query: 1015 FYYFSFVLNLRNYSPLWAGGSYFIFVI-------SGTITAISCGFLMKKIRPAVLLTFSM 1173
                SF+++   Y  +     Y + ++       S T  +    F+     P V L  + 
Sbjct: 368  ALGISFLIDFIFY--MAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVALALTR 425

Query: 1174 VG-----FNLGCIIFSVTPVHQTYFR-------NILGTMIILPLGMDL-SFPASSIILSD 1314
            V        +GC ++ +      +FR        I+G + +  LG  L ++P   + +S 
Sbjct: 426  VTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYP---VTVSV 482

Query: 1315 NLPNQHQGMAGSLVNTVINYS 1377
                 H  MA     T +NY+
Sbjct: 483  QAATNHDNMA---TVTALNYT 500

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 34.7 bits (78), Expect = 0.70
 Identities = 37/176 (21%), Positives = 71/176 (40%)
 Frame = +1

Query: 190 SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           S ++ +  ++ TL   +++    H S  +    +  +    G   L    L ++YG +  
Sbjct: 90  SMVITMISSSWTLPSTHII-EHFHISHEVSTVGITLYVFGLGIGPLFLSPLSELYGRRIT 148

Query: 370 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
            +   ++ +IW  +T  SG + +G+ F   R   G   S  L    G I  I+    +  
Sbjct: 149 FLYALMLSIIWQCLTIWSG-TIAGVMF--GRFLSGFFGSAFLSVAGGAIADIFDKDQIGI 205

Query: 550 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
            M I    A   +G +LG +  G +  E   S+ W F    + +     +  ++IP
Sbjct: 206 PMAIYTTSAF--LGPSLGPIIGGALYHE---SYKWTFITLLITSGCCLVLIIFTIP 256

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (REAL)
          Length = 610

 Score = 34.7 bits (78), Expect = 0.73
 Identities = 71/339 (20%), Positives = 125/339 (36%), Gaps = 36/339 (10%)
 Frame = +1

Query: 304  LVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITG----LSGYSHSGIFFIIARAFQ 471
            +VS    +V  RL D +G  ++ +   ++ VI +++      +S Y+   +F+       
Sbjct: 101  VVSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGV 160

Query: 472  GLGISLVLPNVLGLIGMI------YKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATE 633
             L + L+L +   L   I      Y P  +   +  +IV A +P               E
Sbjct: 161  TLVLLLILSDFSSLKWRILYQYVPYWPFIIIPWISGNIVTAANP---------------E 205

Query: 634  SEGSWPWAFYAYT--LAAF----INTFISYYS--------------IPNNIPTNVNRLSM 753
             + SW  A +A+   L+A     +  ++ Y S              I  N     N + +
Sbjct: 206  KDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSKTPEWKALKERTHIKKNQGFLKNTVFL 265

Query: 754  DWIGSFTGV------LGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 915
             W     G+      LG +L         +  W+                 F  +E  YA
Sbjct: 266  FWELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFCIFVFWETAYA 325

Query: 916  ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 1095
            +NPLLP +++ +R +   L    F + +F I   + +  +L   N S   A     +   
Sbjct: 326  KNPLLPFKLLGDRGIWAPLGVAFFNYFTFFIACDFLYPVLLVSMNESSTTATRILNLPDF 385

Query: 1096 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVT 1212
             G   +   G L+ K R    L FS+VG   GC  + ++
Sbjct: 386  VGATLSPFYGILVAKAR---RLKFSVVG---GCAAWMIS 418

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 34.3 bits (77), Expect = 0.91
 Identities = 38/185 (20%), Positives = 74/185 (40%)
 Frame = +1

Query: 163 YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRL 342
           Y  I   + S ++ +  +  +L I   +    H S  + V  ++ +    G   L+   L
Sbjct: 61  YISILITITSMVITIISSCWSL-ISPQIMEHFHISHEVSVLGISFYIFGLGVGPLILSPL 119

Query: 343 GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 522
            ++YG +   I    + +IW  +T  S  +  G+ F   R   G   S  L    G I  
Sbjct: 120 SELYGRRLTFIFSLALSIIWQCLTTWS-KTIEGVMF--GRFLSGFFGSSFLSVAGGSISD 176

Query: 523 IYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFIS 702
           I++   +   M I     M  +G ++G +  G +    + S+ W F    +A+ +   + 
Sbjct: 177 IFEKKDIGIPMAIFTTSPM--LGPSIGPIIGGAL---HKDSYKWTFIVLLIASGVCLVLI 231

Query: 703 YYSIP 717
             ++P
Sbjct: 232 TLTVP 236

>TBLA0F01620 Chr6 complement(404095..405942) [1848 bp, 615 aa] {ON}
           Anc_7.33 YOR356W
          Length = 615

 Score = 34.3 bits (77), Expect = 0.96
 Identities = 19/59 (32%), Positives = 29/59 (49%)
 Frame = +1

Query: 580 SPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMD 756
           SP+G  LG  +SGL +   +G  PW F  +   + + +    Y  P N P   N++S D
Sbjct: 455 SPVGNILGMCYSGLDSLILKGHAPWTFPLHESDSSVTSLAKNYK-PINYPKPDNKISFD 512

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
            (REAL)
          Length = 440

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 889  FGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 1038
            F  +E  YA NPLLP +++++R +          W   G+  F YF+F +
Sbjct: 187  FMFWEASYAHNPLLPFKLLKDRGI----------WAPLGVAFFNYFTFYI 226

>KAFR0C00100 Chr3 (7573..8994) [1422 bp, 473 aa] {ON} 
          Length = 473

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 9/165 (5%)
 Frame = +1

Query: 247 TRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 423
           T QL   +S K+ W+ + FP +     + SG   D  G KK++I+G ++ V      GL 
Sbjct: 87  THQLAEVNSSKIGWIFSIFPFICSVSGIFSGIYFDRNGFKKIVIIGTILHV-----GGLF 141

Query: 424 GYSHSGIFFIIARAFQ---GLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 594
             ++S  ++    +F    G G  L L  ++      +K    ++ + I+     S IG 
Sbjct: 142 AMANSAKYWHFILSFSIICGFGNGLALSPLIICPSHYFK---RRRGLAIACGNLGSCIG- 197

Query: 595 TLGGLFSGLV-----ATESEGSWPWAFYAYTLAAFINTFISYYSI 714
             GG+F  L+      T  E ++    +   + AFIN  +   SI
Sbjct: 198 --GGVFPFLLRRLFRMTSDENAYYGFQWGIRVLAFINLTLLIISI 240

>TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {ON}
           Anc_1.155 YCR028C
          Length = 516

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 5/92 (5%)
 Frame = +1

Query: 400 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 579
           W L+T    ++HS     + R FQ L  S        ++G  Y P  L     I     +
Sbjct: 119 WGLLTLGMSHAHSARDLCVLRFFQALFESCTFSGTHLILGAWYCPRELPLRSAIFTSSGL 178

Query: 580 SPIGATLGGLFSGLVATESEGS-----WPWAF 660
             +GA   G     +A E EG+     W W F
Sbjct: 179 --VGAIFSGFMQTAIAHELEGAGGMAGWRWLF 208

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 24/60 (40%), Positives = 33/60 (55%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           G F L  GRLGDIYG +  LI+  VI +I S+I   S    +   ++I R   G+G  L+
Sbjct: 132 GCFFL--GRLGDIYGRRIGLIVASVIFIIGSVIQIAS--VKAWYQYMIGRIVAGIGCGLI 187

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 31/97 (31%), Positives = 48/97 (49%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           G F L  GRLGD+YG +  +I+  +I V+ ++I   S    +   ++I R   GLG  ++
Sbjct: 133 GCFFL--GRLGDMYGRRMAIIIASIIFVVGTIIQIAS--VKAWYQYMIGRIVAGLGCGII 188

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             +   LI  +  P  L+  MV S    M  +G  LG
Sbjct: 189 AISSPMLISEV-SPKHLRGAMV-SCYQLMITMGIFLG 223

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 24/60 (40%), Positives = 33/60 (55%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           GSF L  GRLGDIYG +  LI+  VI +  ++I   S    +   ++I R   GLG  L+
Sbjct: 137 GSFFL--GRLGDIYGRRIGLIVASVIFIAGTIIQIAS--IKAWYQYMIGRIVAGLGCGLI 192

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
            uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
            Transporter member of the ARN family of transporters that
            specifically recognize siderophore-iron chelates
            responsible for uptake of iron bound to ferrirubin
            ferrirhodin and related siderophores
          Length = 616

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 81/399 (20%), Positives = 145/399 (36%), Gaps = 38/399 (9%)
 Frame = +1

Query: 325  LVSGRLGDIYGLKKMLILGYVILVIWSLITG----LSGYSHSGIFFIIARAFQGLGISLV 492
            LV  RL D +G   + I   V   + ++I      +  Y+   +F+ I      +G+ LV
Sbjct: 116  LVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGY----VGVILV 171

Query: 493  LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGAT-LGGLFSGLVATESEGSWPWAFYAY 669
            L      + M+    +L+  ++ +IV     I  T + G  +     E+  SW    +A+
Sbjct: 172  L------LLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAF 225

Query: 670  T--------LAAFINTFISYYSIPNNIPTNVNR------------LSMDWIGSFTGVL-- 783
                     +A  I+  I     P  I     +            + + W     GVL  
Sbjct: 226  IFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKLDVVGVLLL 285

Query: 784  ----GLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 951
                G IL            WN                    +E+R+A +PL+P  +I++
Sbjct: 286  IATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKD 345

Query: 952  RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWA----GGSYFIFVISGTITAIS 1119
            R +   L      +  F +   Y ++ +L   + S   A      S F+ V+   I ++ 
Sbjct: 346  RGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIFSLF 405

Query: 1120 CGFLMKKIRPAVLL--TFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDL-SFP 1290
                 KK++P ++L     MVG  L       +  H      I+G + +   G  + ++P
Sbjct: 406  I-TRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHS----GIIGALCVWGAGSTMWTYP 460

Query: 1291 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGT 1407
             +   +S      H+ +A     T +NY+     G  GT
Sbjct: 461  VN---ISVQSATSHENLA---TVTALNYTLYRIGGAVGT 493

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 41/180 (22%), Positives = 75/180 (41%), Gaps = 2/180 (1%)
 Frame = +1

Query: 184 MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 363
           + S ++ +  +  TL I + +    H S  + V  ++ +    G   L    L ++YG +
Sbjct: 86  LTSMVITIISSCWTL-ISDRIMDHFHISHEVSVLGISFYIFGLGVGPLFLSPLSELYGRR 144

Query: 364 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 543
           K  I+     ++W  +  +   +  G+ F   R   G   S  L    GL   I++    
Sbjct: 145 KTFIISLFFSIVWQCLV-IWSKTIEGVMF--GRFLSGFFGSAFLSVAGGLFTDIFE---- 197

Query: 544 KKNMVISI-VGAMSP-IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
           KKN+ I I +   SP +G  LG + SG +      ++ W F    LA+ ++       +P
Sbjct: 198 KKNIGIPITIYTTSPMLGPALGPIISGAL---HGTNYKWTFITMLLASGLSFICVILLVP 254

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 51/206 (24%), Positives = 84/206 (40%), Gaps = 8/206 (3%)
 Frame = +1

Query: 16  KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ 195
           K  +IE   + +E T R+  SD+ +   + E +N       +     + +   F C L  
Sbjct: 66  KTTDIEGRPHWSETTSRTHESDSEEGDSNGEAEN-------FPEGGLKAWVVTFGCFLGL 118

Query: 196 -----LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 360
                LLN  G  ++    N L  +   S S   WL + F  V  +  ++SG   D  G 
Sbjct: 119 IACFGLLNSTGVIESHLQDNQLANE---SVSTIGWLFSLFLFVCFASCIISGTYFDRNGF 175

Query: 361 KKMLILGYVILVIWSLITGLS-GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY--K 531
           + ++I+G V  V     T  S  Y H  + F I     G G  +VL  ++ +    +  +
Sbjct: 176 RTIMIVGTVFHVAGLFATANSTKYWHFILSFAIV---CGFGNGIVLSPLVSVPAHYFFKR 232

Query: 532 PGTLKKNMVISIVGAMSPIGATLGGL 609
            GT           AM+ IG ++GG+
Sbjct: 233 RGTAL---------AMATIGGSVGGV 249

>NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 36/125 (28%), Positives = 58/125 (46%), Gaps = 3/125 (2%)
 Frame = +1

Query: 253 QLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYS 432
           + + SD     +VA+F L      ++ GRLGD YG K  L+    + V+  +I   S  +
Sbjct: 96  EYYLSDVRTGLIVATFNLGCAFGGIILGRLGDFYGRKIGLVCVVSVYVVGVVIQISS--T 153

Query: 433 HSGIFFIIARAFQGL---GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           ++ I + I R   GL   GI+++ P ++  I   +  G     M IS+   M       G
Sbjct: 154 NNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRG-----MCISLYQLM-----ITG 203

Query: 604 GLFSG 618
           G+F G
Sbjct: 204 GIFVG 208

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 28/139 (20%), Positives = 54/139 (38%)
 Frame = +1

Query: 166 AFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLG 345
           A ++SC++  L  L G    +  M+ L + +   D   V    +  +V G+ +L+     
Sbjct: 347 ALVYSCVMIGLGQLTGINAIMYYMSTLMKNIGFDDKQSV----AMSMVGGAALLI----- 397

Query: 346 DIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMI 525
                      G V  ++W    G   ++ + I FI+     G+G  + L   +     +
Sbjct: 398 -----------GTVPAILWMDRFGRRTWAMTIIIFIVGLVLVGVGYQINLQTHMAAAEGV 446

Query: 526 YKPGTLKKNMVISIVGAMS 582
           Y  G +  NM      A++
Sbjct: 447 YLTGQIIYNMAFGSYAALT 465

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
            YIL088C
          Length = 479

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
 Frame = +1

Query: 1231 FRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFL--GIAG 1404
            F+ +L T  I+      +    SII  + L N       S++N  I+ S  LFL  GIAG
Sbjct: 187  FKGLLSTFSIIIFAYTGAMNLFSII--NELKNNSMENVSSIINHSISISTILFLTVGIAG 244

Query: 1405 TVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLI 1506
             +   CN  G  LL     +++  IA   +A+++
Sbjct: 245  YLTFGCNTLGNILLNYDADSVWVSIAKFCLAIML 278

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 39/187 (20%), Positives = 76/187 (40%), Gaps = 2/187 (1%)
 Frame = +1

Query: 163 YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVW--LVASFPLVSGSFILVSG 336
           Y  +   + S ++ +  +  T    +++ +  H S  + V   ++  F L  G   L   
Sbjct: 76  YIAVLITVTSMVITMISSCWTFVSPHIIEK-FHVSREVSVLGIMLYVFGLAFGPLFL--S 132

Query: 337 RLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLI 516
            + ++YG +   I    + ++W  +T  S  + +G+ F   R   G   S  L    G I
Sbjct: 133 PISELYGRRATFIFSLTLSIVWQCLTTWS-RTLTGVMF--GRFLSGFFGSSFLSVAGGAI 189

Query: 517 GMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTF 696
             I+    +   M +    AM  +G +LG + SG + T     + W F  + +A+ +   
Sbjct: 190 SDIFLKSQITVPMSLYTTAAM--MGPSLGPIISGALYTV---DFRWTFVTFIIASGVCLV 244

Query: 697 ISYYSIP 717
               +IP
Sbjct: 245 AIVVTIP 251

>Suva_10.14 Chr10 (25745..27340) [1596 bp, 531 aa] {ON} YLL055W
           (REAL)
          Length = 531

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 5/117 (4%)
 Frame = +1

Query: 388 ILVIWSLITGL--SGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVI 561
           IL  W+++  L  + Y+ SG+  +  R F G+  S+V+P ++  +GM +           
Sbjct: 130 ILATWTILVFLLCAAYNFSGV--VALRFFLGMTESVVIPILITTMGMFFNASERAAAQPF 187

Query: 562 SIVGAM-SPIGATLGGLFSGLVATESEGSWPWAFYAYTLA--AFINTFISYYSIPNN 723
                M SPI    G +  G++   +     W  +   +A   FI T + +   PNN
Sbjct: 188 FFAACMGSPI--PTGFIAYGVLHITNPSIALWRIFTIIIAGLTFIMTIVVFLWFPNN 242

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 23/60 (38%), Positives = 33/60 (55%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           GSF L  GRLGDIYG +  LI+   I ++ ++I   S    +   ++I R   GLG  L+
Sbjct: 127 GSFFL--GRLGDIYGRRIGLIVASFIFIVGTVIQIAS--VKAWYQYMIGRIVAGLGCGLI 182

>Kwal_55.21538 s55 complement(878539..879423) [885 bp, 294 aa] {ON}
           YDR352W - Hypothetical ORF [contig 128] FULL
          Length = 294

 Score = 32.7 bits (73), Expect = 2.2
 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 7/113 (6%)
 Frame = +1

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAF---- 660
           LP  L     +  P T    + +S +GA+  +GA +  LF       ++G  P+ F    
Sbjct: 149 LPLGLSAQDAVSSPETSHLGVTLSWIGALCYVGARIPQLFKNYNRKSTDGLSPFLFINTL 208

Query: 661 ---YAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVW 810
                YT++ F  T   Y S P+ +   V+ +         G  G I+F+ V+
Sbjct: 209 IANITYTVSIF--TSCEYLSCPDRLGFAVSEMPF-----IVGSTGTIVFDLVY 254

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
            similar to uniprot|P38731 Saccharomyces cerevisiae
            YHL040C ARN1 Transporter member of the ARN family of
            transporters that specifically recognize siderophore-iron
            chelates responsible for uptake of iron bound to
            ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 33.1 bits (74), Expect = 2.2
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 2/98 (2%)
 Frame = +1

Query: 751  MDWIGSF--TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENP 924
            +D IG+F  T  LG IL         +  W+                   +YEL++A  P
Sbjct: 310  LDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAREP 369

Query: 925  LLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 1038
            +LP ++I++R +          W S  I   Y F F +
Sbjct: 370  ILPWKLIKDRAV----------WASMSISFLYDFIFYM 397

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 41/216 (18%), Positives = 84/216 (38%), Gaps = 5/216 (2%)
 Frame = +1

Query: 85  NDESPSMELK-NSSLRNPD----YFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLT 249
           ND   S E+  N  + +P+    + ++  + Y        S ++ +  ++ TL   +++ 
Sbjct: 43  NDGKQSHEVTFNEDIADPEDIARHMSTARRYYISSLITFTSMVITMISSSWTLPSTHII- 101

Query: 250 RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGY 429
              H S  +    +  +    G   L    L ++YG +   +    + +IW  +T +   
Sbjct: 102 EHFHISHEVSTLGITLYVFGLGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLT-IWSK 160

Query: 430 SHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGL 609
           + +G+ F   R   G   S  L    G I  I+    +   M I    A   +G +LG +
Sbjct: 161 TITGVMF--GRFLSGFFGSAFLSVAGGAIADIFDKDQIGIPMAIYTTSAF--LGPSLGPI 216

Query: 610 FSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
             G +  +   S+ W F    + +     +  ++IP
Sbjct: 217 IGGALYHQ---SYKWTFITLLITSGCCLVMIIFTIP 249

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 34/163 (20%), Positives = 68/163 (41%), Gaps = 6/163 (3%)
 Frame = +1

Query: 289 VASFPLVSGSFILVSGRLG----DIYGLKKMLILGYVILVIWSLITGLSGYSHSGI--FF 450
           VA + L+ G   ++   +G    D  G K  L++G+   +++ LI G +    S I   F
Sbjct: 310 VAEWNLLLGVLAVLGVPIGAYFSDRIGRKYTLMIGFSGYIVFGLIIGCAYDQLSKITPLF 369

Query: 451 IIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 630
           II  A   +  +    N+LG+I       T  + +   I      IG+ +G         
Sbjct: 370 IIFYALMNMLGNAGPGNMLGVISS-ESSATAVRGVFYGISAVTGKIGSVVG--VECFQPI 426

Query: 631 ESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDW 759
                  W F    +   +   I+Y+ +P+++ +++ +  +D+
Sbjct: 427 RDNLGARWTFIIAAICGLVGVVITYFLVPHSLDSDLMKQDVDF 469

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 37/181 (20%), Positives = 69/181 (38%)
 Frame = +1

Query: 175 FSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIY 354
           F+ M+  +++   T  +  IM+      H S  + +  +  +    G   L    + + Y
Sbjct: 95  FTSMVITIISSCWTFVSPKIMS----HFHISHEVSILGITFYIFGLGFGPLFLSPISEFY 150

Query: 355 GLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKP 534
           G +   I    + +IW  +T  S      +F    R   G   S  L    G I  I+  
Sbjct: 151 GRRPTFIFSLTVSIIWQCLTTWSRTIEGMMF---GRFLSGFFGSTFLSVAGGSISDIFDK 207

Query: 535 GTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSI 714
            ++   M I    AM  +G  LG + SG +    +  + W F    +A+ +   +   ++
Sbjct: 208 DSITVPMAIYTTSAM--LGPELGPIISGAL---YKVDYKWTFVTLLIASGVCLALIIVTV 262

Query: 715 P 717
           P
Sbjct: 263 P 263

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = +1

Query: 286 LVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARA 465
           LV+ F +      +  G+LGDIYG +  LIL  +I VI  LI   S        + I R 
Sbjct: 118 LVSIFNIGCAVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITS--VDKWYQYFIGRI 175

Query: 466 FQGLGISLV 492
             G+G+ L+
Sbjct: 176 IAGIGMGLI 184

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 30/155 (19%), Positives = 64/155 (41%)
 Frame = +1

Query: 190 SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           + ++   GT+     + ++T   ++S  +    V  + +  G F L    + ++ G + +
Sbjct: 108 ASMMGPMGTSIVFPAIGLITSDYNTSTIMVNVSVGIYLISLGVFPLWWSSISELKGRRTV 167

Query: 370 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
            ++ + +L  + + T +S    +   FII R   G   + V     G I  +Y P    K
Sbjct: 168 YLVSFTLLFAFCIGTAVSPNIQA---FIILRVLCGASSASVQSVGAGTIADLYAPEERGK 224

Query: 550 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 654
           N+    +GA++        L S ++ +     W W
Sbjct: 225 NLGYFYLGALT------APLLSPIIGSLLVNHWSW 253

>CAGL0J11022g Chr10 (1075366..1076025) [660 bp, 219 aa] {ON} highly
           similar to uniprot|P47822 Saccharomyces cerevisiae
           YDR308c SRB7
          Length = 219

 Score = 32.0 bits (71), Expect = 3.2
 Identities = 21/76 (27%), Positives = 35/76 (46%)
 Frame = +1

Query: 64  RSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNV 243
           R D    ND+ P M  K++S+  P+ F++   E +      + Q+  L  +   + +   
Sbjct: 29  RHDFEPFNDKEPKMTDKHASVATPEEFSNGIDELSTDIIVKIRQITTLIDSLPGVGVS-- 86

Query: 244 LTRQLHSSDSLKVWLV 291
              QLH  DSL+  LV
Sbjct: 87  AEEQLHKIDSLQKKLV 102

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 32.3 bits (72), Expect = 3.6
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 2/130 (1%)
 Frame = +1

Query: 94  SPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLT--RQLHSS 267
           +PS  LKN  L+           + FI S  L+  L +  T   L  +NV++  + L+  
Sbjct: 31  NPSNVLKNVKLKT----------WLFIASAFLA--LTVEATDFYLVSLNVVSIAQDLNVR 78

Query: 268 DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 447
           +    W +    +      +V G +GD +G +   ++   ++ +  L+T   G++ S  +
Sbjct: 79  EDTVTWGITVALMTRTIGAIVYGYIGDRFGQRTSFLINVGMISVLQLVT---GFATSFPY 135

Query: 448 FIIARAFQGL 477
           F+  RA+ G+
Sbjct: 136 FLACRAYFGI 145

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 32.3 bits (72), Expect = 3.6
 Identities = 31/97 (31%), Positives = 48/97 (49%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           G F L  GRLGD+YG +  +I+  +I V+ ++I   S    +   ++I R   GLG  ++
Sbjct: 62  GCFFL--GRLGDMYGRRIAIIVASIIFVVGTVIQIAS--VKAWYQYMIGRIVAGLGCGII 117

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             +   LI  +  P  L+  MV S    M  +G  LG
Sbjct: 118 AISSPMLISEV-SPKHLRGAMV-SCYQLMITMGIFLG 152

>Smik_12.5 Chr12 (12023..13618) [1596 bp, 531 aa] {ON} YLL055W
           (REAL)
          Length = 531

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 8/133 (6%)
 Frame = +1

Query: 388 ILVIWSLITGLS--GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY---KPGTLKKN 552
           +L  W+++  LS   Y+ SG+  +  R F GL  S+V+P ++  +GM +   +    +  
Sbjct: 130 LLATWTILIFLSCTAYNFSGV--VALRFFLGLTESVVIPILITTMGMFFDASERAAAQPF 187

Query: 553 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 732
              + +G+  P G    G+    +A  S   W           FI T I     PNN P 
Sbjct: 188 FFAACMGSPIPTGFIAYGVLH--IANPSISLWKIFTIIIGGLTFIMTIIVILWFPNN-PA 244

Query: 733 NVNRLSMD---WI 762
           +    S++   WI
Sbjct: 245 DAKFFSLEERVWI 257

>SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 533

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 1/159 (0%)
 Frame = +1

Query: 244 LTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 423
           +    H S  + V  ++ +    G   L    L ++YG K   ++   + ++W ++T  S
Sbjct: 117 IIEHFHISHEVSVLGISLYIFGLGFGPLFLSPLSEMYGRKITFVMSLSMSIVWQVLTVWS 176

Query: 424 GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP-IGATL 600
             +  G+FF   R   G   S  L    G+I  I+   T ++  +   V   SP +G  L
Sbjct: 177 P-TIVGMFF--GRFLAGFFGSSFLSVAGGVISDIF---TRQEIGIPMTVYTTSPFLGPAL 230

Query: 601 GGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
           G + SG +      S+ W F A  +A+ +   +  +++P
Sbjct: 231 GPVVSGALYGV---SYKWTFIALLIASGVCLVLIAFTVP 266

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 3/130 (2%)
 Frame = +1

Query: 352 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVLPNVLGLIGM 522
           YG   ++ L  +   IW +   L G + +    I+AR   GL   G S+ L    G++  
Sbjct: 121 YGRWIVMQLSLLFSNIWQI---LGGKAPNFGAIIVARGLCGLSQAGGSVTL----GVVAD 173

Query: 523 IYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFIS 702
           ++ P   +    ++ +   S  G+ LG +F GL+  +   SW W F+   +   ++  + 
Sbjct: 174 LWDPS--EHGYAVAYIVLASVGGSVLGPVFGGLM--QEHLSWHWNFWIQLIFNGVSQILH 229

Query: 703 YYSIPNNIPT 732
           ++ +P    T
Sbjct: 230 FFLVPETRAT 239

>SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily expression is induced by
           low levels of glucose and repressed by high levels of
           glucose
          Length = 572

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%)
 Frame = +1

Query: 286 LVASFPLVSGSFILVSGRLGDIYGLK---KMLILGYVILVIWSLITGLSGYSHSGIFFII 456
           +VA F +      L  GRLGDIYG +     ++  YV+ +I  + TG   Y      + I
Sbjct: 123 IVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCVVCVYVVGIIIQIATGDKWYQ-----YFI 177

Query: 457 ARAFQGLGI 483
            R   GLG+
Sbjct: 178 GRIISGLGV 186

>AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR273C
           (TPO4)
          Length = 573

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 46/202 (22%), Positives = 87/202 (43%), Gaps = 8/202 (3%)
 Frame = +1

Query: 82  ANDESPSMELKNSSLRNPDYFNSTTQEYAFIF----SCMLSQLLNLA---GTTQTLSIMN 240
           A++E  + E+   SL   D F+        ++    + M+S LL LA   G++  +  + 
Sbjct: 40  ASEELQNTEVDAKSLDWDDRFDPANPHNWPLWKKWSTAMVSALLCLAVTMGSSLYMGAVP 99

Query: 241 VLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGL 420
            L ++   + +L    ++ + L  G   +V   L +++G K + ++   I +++SL  GL
Sbjct: 100 TLVKEYGVNQTLACAGLSLYLL--GLATVVGAPLSEVFGRKPVYLISLPISLLFSLGVGL 157

Query: 421 SGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP-IGAT 597
           S    + I  +  R F G+  S  L    G I  I+    +   M +     M+P +G  
Sbjct: 158 SNGRMAVI--LPMRLFSGIFASPALSVASGTIVDIFDVDEVSVAMSLF---CMAPFLGPV 212

Query: 598 LGGLFSGLVATESEGSWPWAFY 663
           +  +  G  A    G W W  +
Sbjct: 213 ISPIMGGYAA--ENGGWRWVVW 232

>NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 32.3 bits (72), Expect = 3.8
 Identities = 30/125 (24%), Positives = 47/125 (37%), Gaps = 9/125 (7%)
 Frame = +1

Query: 376 LGYVILVI---WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLG---LIGMIYKPG 537
           L YV+  +   WSL+T  + Y +S       R F G   +   P+ L    L G  YK  
Sbjct: 208 LNYVLPCLDLCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGCFYKHD 264

Query: 538 TLKKNMVISIVGAMSPI---GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 708
            + +       G    I   G     +F+ L        W W F    + + +   I +Y
Sbjct: 265 EMVRRSAFYYFGQYIGILSSGGIQSAVFTSLDGVNGMSGWRWNFIIDAIISVVVGIIGFY 324

Query: 709 SIPNN 723
           S+P +
Sbjct: 325 SLPGD 329

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 32.3 bits (72), Expect = 3.8
 Identities = 31/127 (24%), Positives = 49/127 (38%), Gaps = 9/127 (7%)
 Frame = +1

Query: 370 LILGYVILVI---WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLG---LIGMIYK 531
           L L YV+  +   WSL+T  + Y +S       R F G   +   P+ L    L G  YK
Sbjct: 201 LPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYK 257

Query: 532 PGTLKKNMVISIVGAMSPI---GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFIS 702
              + +      +G    I   G     ++S L        W W F    + + +   I 
Sbjct: 258 HDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIG 317

Query: 703 YYSIPNN 723
           +YS+P +
Sbjct: 318 FYSLPGD 324

>TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.723
           YOR273C
          Length = 637

 Score = 32.3 bits (72), Expect = 3.8
 Identities = 47/226 (20%), Positives = 102/226 (45%), Gaps = 1/226 (0%)
 Frame = +1

Query: 4   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 183
           D DL++    VS  +A  ++R++  +  D           + NP  + +  + YA + + 
Sbjct: 24  DVDLERLASHVSGNLA--SLRANEDEPIDPRTLDWDGPDDMANPHNWPAWKKWYATMVAA 81

Query: 184 MLSQLLNLAGTTQTLSIMNVLTR-QLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 360
           +L  ++ +  +     +  ++ R Q++ + +L      +F L+ G   ++   L +++G 
Sbjct: 82  LLCLVVTMGSSLYVSGVPELVLRYQINQTLALAG---LTFYLL-GLTTVIGAPLSEVFGR 137

Query: 361 KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 540
           K + ++   I +++++  GLSG  H  I   + R F G+  S  L    G I  ++    
Sbjct: 138 KPIYLISLPISMLFTMGVGLSG-GHMRIILPL-RFFSGVFGSPALSVGSGTILDVFDMDE 195

Query: 541 LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLA 678
           +   M +  +     +G  +  + +G  ATE +G W WA +   +A
Sbjct: 196 VPMAMAMFCLAPF--LGPIISPVMAGF-ATEKQG-WRWAEWIQLIA 237

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] {ON}
            Anc_7.411 YER113C
          Length = 670

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +1

Query: 1006 IWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCG 1125
            +++ YY  F+LN+R +S      S FI V  GT+  I CG
Sbjct: 612  VYSLYYVFFILNIRGFS------SIFISVCYGTLFNIMCG 645

>AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 500

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +1

Query: 145 NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNV--LTRQLHSSDSLKVWLVASFPLVSGS 318
           N   + + FI S  L+  L +  T   L  +NV  +   LH  +    W +    +    
Sbjct: 38  NVKLKTWLFIASAFLA--LTVEATDFFLVSLNVVKIAEDLHVREDKVTWGITVALMTRTI 95

Query: 319 FILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL 477
             +V G +GD +G +   ++   ++ +  L+T   G++ S  +F+  RA+ G+
Sbjct: 96  GAIVYGYVGDRFGQRTSFLINIGMISVLQLVT---GFATSFPYFLACRAYFGV 145

>YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON}
           MCH5Plasma membrane riboflavin transporter; facilitates
           the uptake of vitamin B2; required for FAD-dependent
           processes; sequence similarity to mammalian
           monocarboxylate permeases, however mutants are not
           deficient in monocarboxylate transport
          Length = 521

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 5/203 (2%)
 Frame = +1

Query: 16  KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ 195
           K  +IE   +  E T  +  SD  ++S      N  + +  +     + +   F C L  
Sbjct: 66  KGTDIESQPHWGENTSSTHDSDKEEDS------NEEIES--FPEGGFKAWVVTFGCFLGL 117

Query: 196 LLNLAGTTQTLSIMNVLTRQLHSSDSLKV--WLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           +        T  I + L     SS+S+    WL + F  V  +  ++SG   D  G + +
Sbjct: 118 IACFGLLNSTGVIESHLQDNQLSSESVSTIGWLFSLFLFVCSASCIISGTYFDRNGFRTI 177

Query: 370 LILGYVILVIWSLITGLS-GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY--KPGT 540
           +I+G V  V     T  S  Y H  + F I     G G  +VL  ++ +    +  + GT
Sbjct: 178 MIVGTVFHVAGLFATANSTKYWHFILSFAIV---CGFGNGIVLSPLVSVPAHYFFKRRGT 234

Query: 541 LKKNMVISIVGAMSPIGATLGGL 609
                      AM+ IG ++GG+
Sbjct: 235 AL---------AMATIGGSVGGV 248

>SAKL0B02112g Chr2 complement(202102..203685) [1584 bp, 527 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260w TNA1 High affinity nicotinic acid
           plasma membrane permease, responsible for uptake of low
           levels of nicotinic acid; expression of the gene
           increases in the absence of extracellular nicotinic acid
           or para- aminobenzoate (PABA)
          Length = 527

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 5/127 (3%)
 Frame = +1

Query: 385 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY--KPGTLKKNMV 558
           +I+  W +I+  +G   S    +  RA  G   +    + L  +   Y  K   L+ +++
Sbjct: 149 IIMSAWGVISTCTGAVTSYGGLLAIRALLGFVEAGFFGSCLYYLSCWYTRKELALRNSIL 208

Query: 559 IS---IVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 729
            S   I GA +  G    G+  G+   +   +W W F        +   ++YY +P+N P
Sbjct: 209 YSGSLISGAFA--GLISAGIIEGMDNVKGLRAWRWCFIIEGALTIVTVPLAYYILPDN-P 265

Query: 730 TNVNRLS 750
           +N   LS
Sbjct: 266 SNSKMLS 272

>YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putative
           hexose transporter, expressed at low levels and
           expression is repressed by glucose
          Length = 546

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 6/99 (6%)
 Frame = +1

Query: 325 LVSGRLGDIYGLK---KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GIS 486
           L  GRLGDIYG K     +IL YV+ ++  + +    Y      + I R   G+   G++
Sbjct: 115 LTLGRLGDIYGRKIGLMCVILVYVVGIVIQIASSDKWYQ-----YFIGRIVSGMGVGGVA 169

Query: 487 LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           ++ P ++  I   +  GT      +S    M  +G  LG
Sbjct: 170 VLSPTLISEISPKHLRGT-----CVSFYQLMITLGIFLG 203

>AEL057C Chr5 complement(528384..530057) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR023C
          Length = 557

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 36/148 (24%), Positives = 64/148 (43%), Gaps = 2/148 (1%)
 Frame = +1

Query: 283 WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 462
           WL + F L      +  G   + YG K  LILG +      L+ G +G  +     ++AR
Sbjct: 65  WLGSVFALCQVVSAMNWGHFAERYGRKWALILGQLGTCCSLLLLGFAGNYYQA---LLAR 121

Query: 463 AFQGL--GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES 636
           +  GL  G + V+  V+G +    +     + +  S +  +   GA LG +  G ++   
Sbjct: 122 SLMGLLNGNAGVVRTVVGELASQER----HQALAFSTMQLLWQFGAVLGPMIGGYLSFPK 177

Query: 637 EGSWPWAFYAYTLAAFINTFISYYSIPN 720
             +    +Y   L+  ++ F   YS+PN
Sbjct: 178 GQNKIPEWYPPWLSKMVSLF--PYSLPN 203

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 30/97 (30%), Positives = 48/97 (49%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           G F L  GRLGD+YG +  +I+  +I ++ ++I   S    +   ++I R   GLG  ++
Sbjct: 128 GCFFL--GRLGDMYGRRIAIIVASIIFIVGTVIQIAS--VKAWYQYMIGRIVAGLGCGII 183

Query: 493 LPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             +   LI  +  P  L+  MV S    M  +G  LG
Sbjct: 184 AISSPMLISEV-SPKHLRGAMV-SCYQLMITMGIFLG 218

>TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {ON}
           Anc_5.396 YHR096C
          Length = 570

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 17/171 (9%)
 Frame = +1

Query: 22  KNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLL 201
           K++E  S   E +     S++ +ES   E  N      +  N  T    ++F C+   ++
Sbjct: 12  KSLETISTETENSNNLHTSNSKEESYEEEYTNEVSHTEEILNPNTGSGVYVFVCVCCVMV 71

Query: 202 NLAG-----TTQTLSIMNVLT---RQLHSSDS--------LKVWLVAS-FPLVSGSFILV 330
              G      T T+S     T   R+  S  +        +++ L+ S F +      +V
Sbjct: 72  AFGGFIFGWDTGTISGFVAQTDFVRRFGSKHADGTPYLSKVRMGLIVSIFNIGCAIGGIV 131

Query: 331 SGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGI 483
             ++GD+YG +KM +   V++ I  ++  ++       +F I R   GLG+
Sbjct: 132 LSKVGDVYG-RKMGLTTVVLIYIVGIVIQIASIDKWYQYF-IGRIISGLGV 180

>ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]
           {ON} similar to uniprot|P43581 Saccharomyces cerevisiae
           YFL011W HXT10 Putative hexose transporter expressed at
           low levels and expression is repressed by glucose
          Length = 616

 Score = 32.0 bits (71), Expect = 5.0
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 20/172 (11%)
 Frame = +1

Query: 148 STTQEYAFIFSCML---------------SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV 282
           S T  ++ I SC++               S  +N+    +     +    +   S++   
Sbjct: 111 SVTNHWSIICSCLMIAFGGFVFGWDTGTISGFINMTDFKRRFGHWDSTNEEFQLSEARMG 170

Query: 283 WLVASFPL--VSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFII 456
            +V+ F +    G F L  GRLGDIYG ++ L+   ++ V+  ++   S  +    FF  
Sbjct: 171 LIVSVFNVGCAIGGFTL--GRLGDIYGRREGLMCSVLVYVVGIVVQIASINTWYQYFF-- 226

Query: 457 ARAFQGLGI---SLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
            R   GLG+   S++ P ++  I      GT      +S    M  +G  LG
Sbjct: 227 GRILSGLGVGSLSVLSPTLISEISPKQLRGT-----CVSFYQLMITLGIFLG 273

>Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 32.0 bits (71), Expect = 5.1
 Identities = 40/183 (21%), Positives = 83/183 (45%)
 Frame = +1

Query: 130 NPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLV 309
           NP  + S  + YA + S  L  ++ + G++  +S +  L  + H + +L +  +  + L 
Sbjct: 82  NPHNWPSWKKWYATMTSAFLCLVVTM-GSSLYVSSVPELVAKYHVNQTLALAGLTFYLL- 139

Query: 310 SGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISL 489
            G   ++   L +++G K + +    I +++++  GLS   H  I   + R   G+  S 
Sbjct: 140 -GLSTVIGAPLSEVFGRKPIYLFSLPISMLFTMGVGLSN-GHMRIILPL-RFLSGVFASP 196

Query: 490 VLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAY 669
            L    G I  I+    +   M   ++     +G  L  + +G  AT+++G W W+ +  
Sbjct: 197 ALSVGSGTILDIFDVDQVSVAMTYFVLSPF--LGPVLSPIMAGF-ATQAKG-WRWSEWIQ 252

Query: 670 TLA 678
            +A
Sbjct: 253 LIA 255

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 22/82 (26%), Positives = 35/82 (42%)
 Frame = +1

Query: 1126 FLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 1305
            +   KIR   L+   M+   + C+ F+ T V   YF N   T      GM++    +SII
Sbjct: 331  YFTSKIRELPLVRGFMIAIGMFCVGFTQTCVLHQYFLNTFNT------GMNVKSALTSII 384

Query: 1306 LSDNLPNQHQGMAGSLVNTVIN 1371
             +  L    +  A S    ++N
Sbjct: 385  YNKALVLSREASATSSTGDIVN 406

>TBLA0C02250 Chr3 (528050..533305) [5256 bp, 1751 aa] {ON} Anc_3.441
            YGR098C
          Length = 1751

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 9/65 (13%)
 Frame = +1

Query: 1225 TYFRNILGTMIILPLGMDLSFPASSIILSDNL-PNQHQGMA---GSLVNTVINYS----- 1377
            T+FRN+  +++I P     S+P SS IL  NL  N++Q +      ++N+ + YS     
Sbjct: 1063 THFRNLFDSVLITP---SCSYPVSSKILPHNLMNNKNQSLTTPKRKIINSSLPYSYTPNC 1119

Query: 1378 NSLFL 1392
            NS+FL
Sbjct: 1120 NSIFL 1124

>ADL095W Chr4 (515206..516693) [1488 bp, 495 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOL119C
          Length = 495

 Score = 31.6 bits (70), Expect = 6.3
 Identities = 32/131 (24%), Positives = 53/131 (40%), Gaps = 5/131 (3%)
 Frame = +1

Query: 139 YFNSTTQEYAFIFSCMLSQLLN-----LAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFP 303
           Y    T+ +   F  ML  L       +AGT +     + L    H S S   W+ + + 
Sbjct: 61  YPEGGTKAWLVTFGAMLGILPTWGIFFVAGTIENYIAHHQLA---HESTSTISWIFSVYN 117

Query: 304 LVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGI 483
            +  S  ++SG   D+ G ++ L LG  I V   + T  +   H   F +      G+G 
Sbjct: 118 CLVLSSGIISGLYFDVAGAQQPLALGTAIFVCGLIAT--ANCHHVWSFVLAFGVLTGIGS 175

Query: 484 SLVLPNVLGLI 516
            +V   +LG +
Sbjct: 176 GIVTSPMLGSV 186

>Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score = 31.6 bits (70), Expect = 6.4
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 6/99 (6%)
 Frame = +1

Query: 325 LVSGRLGDIYGLK---KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GIS 486
           L  GRLGDIYG K     +IL YV+ ++  + +    Y      + I R   G+   G++
Sbjct: 115 LTLGRLGDIYGRKIGLMFVILVYVVGIVIQISSTDKWYQ-----YFIGRIISGMGVGGVA 169

Query: 487 LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           ++ P ++  I   +  GT      +S    M  +G  LG
Sbjct: 170 VLSPTLISEISPKHLRGT-----CVSFYQLMITLGIFLG 203

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 21/60 (35%), Positives = 33/60 (55%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           G F L  GRLGD+YG +  LI+  VI ++ ++I   S    +   ++I R   G+G  L+
Sbjct: 130 GCFFL--GRLGDMYGRRIGLIVAAVIFIVGNIIQIAS--IRAWYQYMIGRIVAGVGAGLI 185

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 30/149 (20%), Positives = 55/149 (36%)
 Frame = +1

Query: 136 DYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSG 315
           D F       A ++S M+  L  L G    +  M+ L  ++  S+   V    +  +V G
Sbjct: 340 DLFRIPRNRRALVYSVMMVSLGQLTGINAIMYYMSTLMGRIGFSEKRSV----AMSMVGG 395

Query: 316 SFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVL 495
           +                 L+LG +  ++W    G   +S + + F +     G+G  + L
Sbjct: 396 A----------------ALLLGTIPAILWMDRFGRRTWSMTIVLFSLGLVLVGVGYQIDL 439

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMS 582
              L     +Y  G +  NM      A++
Sbjct: 440 ETNLPAAEGVYLTGQILYNMAFGSYSALT 468

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +1

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVL 495
           L+  RLGDIYG +K L+   V+ ++  LI  ++       +F I R   G+   GI++  
Sbjct: 135 LLFSRLGDIYGRRKALVFVTVVYMV-GLIISIASIDKWYQYF-IGRIISGMGVGGIAVYS 192

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           P ++  +   +  GTL     +S    M  +G  LG
Sbjct: 193 PLLISEVSPKHVRGTL-----VSCYQLMITLGIFLG 223

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score = 31.6 bits (70), Expect = 6.6
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 5/67 (7%)
 Frame = +1

Query: 646 WPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGS--FTGVLGLILFNFV--WN 813
           W WA +     A+I  F+S   I N +P NV   S  W  S     + GLI+ +F+  W 
Sbjct: 212 WAWAEHV-PKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWG 270

Query: 814 QAP-ADG 831
             P +DG
Sbjct: 271 GGPKSDG 277

>Suva_4.272 Chr4 (482764..482811,482874..483662) [837 bp, 278 aa] {ON}
            YBR040W (REAL)
          Length = 278

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 910  YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 1014
            Y   P LP ++I NR L+++  A+   WG   +WT
Sbjct: 159  YVTVPKLPFKLIVNRFLLLLSPALVLTWGLGAMWT 193

>YNL327W Chr14 (24048..27173) [3126 bp, 1041 aa] {ON}
           EGT2Glycosylphosphatidylinositol (GPI)-anchored cell
           wall endoglucanase required for proper cell separation
           after cytokinesis, expression is activated by Swi5p and
           tightly regulated in a cell cycle-dependent manner
          Length = 1041

 Score = 31.6 bits (70), Expect = 7.1
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 9/107 (8%)
 Frame = +1

Query: 40  SYIAEETIRSDCSDANDESPSMELKNSSLR---------NPDYFNSTTQEYAFIFSCMLS 192
           SY++  T  S  S       S  L N+++          NP Y +++T   A   + +  
Sbjct: 481 SYVSNSTTLSSSSVLESVISSPYLANTTVSGASSASQSTNPPYVSNSTTSSATQLATIAP 540

Query: 193 QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVS 333
             +N+ GT+ + SI N  +    +S       V++  + SGS+IL +
Sbjct: 541 FAINITGTSISSSITNTSSVSSTTSSLSSGPFVSNTTVASGSYILTT 587

>KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar to
           uniprot|Q03730 YML018C Saccharomyces cerevisiae
          Length = 414

 Score = 31.2 bits (69), Expect = 7.8
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 17/168 (10%)
 Frame = +1

Query: 76  SDANDESPSMELKNSSLRNPDYFNST-------TQEYAFIFSCMLSQLLNLAGTTQTLSI 234
           SD +D + ++  ++SSL + D  + T       T + +  F C+L  L NL  T  +LS 
Sbjct: 107 SDDDDTAATVVDEHSSLVSKDSSDPTIKLPLRSTIKLSAQF-CILWFLANLV-TNASLSY 164

Query: 235 MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 414
            +V ++ + SS S       SF      F L+   L  +  + K+ +LG ++  I  ++ 
Sbjct: 165 TSVASQTILSSTS-------SF------FTLLVSALCHVESVNKIKVLGSIVSFIGIIMV 211

Query: 415 GLSGYSH---SGIFFIIARAFQG-------LGISLVLPNVLGLIGMIY 528
             S YS+   S I F I   F           +++++ N+L L G ++
Sbjct: 212 TKSDYSYVTASKIHFAIPYKFHNGIDYDNTSPVTIIIGNILALAGALF 259

>Kwal_56.24191 s56 complement(897583..897867) [285 bp, 94 aa] {OFF}
            [contig 165] FULL
          Length = 94

 Score = 29.3 bits (64), Expect = 7.9
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = +3

Query: 1395 YCWHSRTTLQ*KWNRSFTWIQRSSIFWYRMFWCCC---FNCR 1511
            Y W SR+      +RS++W  R S   +R  W CC   ++CR
Sbjct: 2    YDWSSRSP----HHRSWSWSYRRSCHCHRTSWSCCRTSWSCR 39

>Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 35/176 (19%), Positives = 67/176 (38%)
 Frame = +1

Query: 190 SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 369
           S ++ +  +  TL   +++    H S  +    +  +    G   L    L ++YG +  
Sbjct: 83  SMVITMVSSCWTLPSTHII-EHFHISHEVSTLGITLYVFGLGIGPLFLSPLSELYGRRTT 141

Query: 370 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 549
            I    + V+W  +T +   + +G+ F   R   G   S  L    G I  I+    +  
Sbjct: 142 FIYALTLSVVWQCLT-IWSKTITGVMF--GRFLSGFFGSAFLSVAGGAIADIFDKDQIGV 198

Query: 550 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 717
            M I    A   +G +LG +  G +  E   ++ W F    + +     +   +IP
Sbjct: 199 PMAIYTTSAF--LGPSLGPIIGGALYHE---NYKWTFITLLITSGCCLVVIMLTIP 249

>Smik_15.488 Chr15 complement(839667..841235) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 51/182 (28%), Positives = 74/182 (40%), Gaps = 18/182 (9%)
 Frame = +1

Query: 118 SSLRNPDY----FNSTT--------QEYAFIFSCMLSQ-----LLNLAGTTQTLSIMNVL 246
           SS  N D+    FN  T        Q +   F C L       LLN  G  ++    N L
Sbjct: 81  SSTHNSDHEEDNFNEETESFPEGGLQAWVVTFGCFLGLVACFGLLNSTGVLESHLQDNQL 140

Query: 247 TRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS- 423
             +   S S   WL + F  V  +  ++SG   D  G + ++I+G V  V     T  S 
Sbjct: 141 ASE---SVSTIGWLFSLFLFVCFASCIISGTYFDRNGFRTIMIVGTVFHVAGLFATANST 197

Query: 424 GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
            Y H  + F I   F G GI ++ P V       YK    ++   +    AM+ IG ++G
Sbjct: 198 KYWHFILSFAIVCGF-GNGI-ILSPLVSVPAHYFYK----RRGTAL----AMATIGGSVG 247

Query: 604 GL 609
           G+
Sbjct: 248 GV 249

>YLL055W Chr12 (30109..31704) [1596 bp, 531 aa] {ON}
           YCT1High-affinity cysteine-specific transporter with
           similarity to the Dal5p family of transporters; green
           fluorescent protein (GFP)-fusion protein localizes to
           the endoplasmic reticulum; YCT1 is not an essential gene
          Length = 531

 Score = 31.2 bits (69), Expect = 8.4
 Identities = 34/133 (25%), Positives = 56/133 (42%), Gaps = 8/133 (6%)
 Frame = +1

Query: 388 ILVIWSLITGLS--GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVI 561
           +L  W+++  LS   Y+ SG+  +  R F GL  S+V+P ++  +GM +           
Sbjct: 130 LLATWTILIFLSCTAYNFSGV--VALRFFLGLTESVVIPILITTMGMFFDASERAAAQPF 187

Query: 562 SIVGAM-SPIGATLGGLFSGLVATESEGSWPWAFYAYTLA--AFINTFISYYSIPNNIPT 732
                M SPI    G +  G++   +     W  +   +    FI T +     PNN P 
Sbjct: 188 FFAACMGSPI--PTGFIAYGVLHITNPSISLWKIFTIIIGGLTFIMTVVVILWFPNN-PA 244

Query: 733 NVNRLSMD---WI 762
           +V   S+    WI
Sbjct: 245 DVKFFSIQERVWI 257

>AGL026W Chr7 (664329..665969) [1641 bp, 546 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR260W (TNA1)
          Length = 546

 Score = 31.2 bits (69), Expect = 8.4
 Identities = 29/127 (22%), Positives = 46/127 (36%), Gaps = 5/127 (3%)
 Frame = +1

Query: 385 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 564
           V++ +W  I+     +HS     + R   G+  S      L  +   Y    L     I 
Sbjct: 169 VLMTLWGGISACCAAAHSFASLAVLRVLIGVVESGFFVCCLYYLSCWYTKKELTFRNAIL 228

Query: 565 IVGAMSPIGATLGGLFSGLVATESEG-----SWPWAFYAYTLAAFINTFISYYSIPNNIP 729
             G++  +   L  L +  +    EG      W W F    L   +    SY  +P+N P
Sbjct: 229 FSGSL--LSGALSXLLASAIIRGMEGVGGLQPWRWCFLLEGLLTVVTVPFSYIVLPDN-P 285

Query: 730 TNVNRLS 750
           +N   LS
Sbjct: 286 SNTRFLS 292

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +1

Query: 313 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 492
           GSF L  GRLGD+YG +  LI+   I ++ ++I   S    +   ++I R   G+G  ++
Sbjct: 123 GSFFL--GRLGDMYGRRIGLIIATTIFIVGTIIQVAS--VKAWYQYMIGRIVAGVGCGVI 178

>Smik_8.170 Chr8 complement(263829..265556) [1728 bp, 575 aa] {ON}
           YDR342C (REAL)
          Length = 575

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +1

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVL 495
           ++  +LGD+YG K  LI+  VI +I  +I   S   +    + I R   GL   GI+++ 
Sbjct: 136 IILAKLGDMYGRKMGLIVVVVIYIIGIIIQIAS--INKWYQYFIGRIISGLGVGGIAVLS 193

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           P ++  +   +  GTL     +S    M  +G  LG
Sbjct: 194 PMLISEVSPKHIRGTL-----VSCYQLMITLGIFLG 224

>Suva_15.287 Chr15 complement(489708..491438) [1731 bp, 576 aa] {ON}
           YHR096C (REAL)
          Length = 576

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 3/109 (2%)
 Frame = +1

Query: 286 LVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARA 465
           +VA F +      ++  RLGD+YG K  LI+  VI +I  +I   S        + I R 
Sbjct: 124 IVAIFNIGCAVGGILLARLGDMYGRKMGLIVVVVIYIIGIIIQIAS--IDKWYQYFIGRI 181

Query: 466 FQGL---GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
             GL   GI+++ P ++  +   +  GTL     +S    M  +G  LG
Sbjct: 182 ISGLGVGGIAVLSPMLISEVSPKHIRGTL-----VSCYQLMITLGIFLG 225

>Skud_8.153 Chr8 complement(261078..262808) [1731 bp, 576 aa] {ON}
           YHR096C (REAL)
          Length = 576

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
 Frame = +1

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVL 495
           ++  RLGD+YG K  LI+  VI +I  +I   S   +    + I R   GL   GI+++ 
Sbjct: 137 IILARLGDMYGRKMGLIVVVVIYIIGIIIQIAS--INKWYQYFIGRIISGLGVGGIAVLS 194

Query: 496 PNVLGLIGMIYKPGTL 543
           P ++  +   +  GTL
Sbjct: 195 PMLISEVSPKHIRGTL 210

>YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}
           HXT4High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 576

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +1

Query: 325 LVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL---GISLVL 495
           ++  +LGD+YG K  LI+  VI +I  +I   S   +    + I R   GL   GI+++ 
Sbjct: 137 IILAKLGDMYGRKMGLIVVVVIYIIGIIIQIAS--INKWYQYFIGRIISGLGVGGIAVLS 194

Query: 496 PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 603
           P ++  +   +  GTL     +S    M  +G  LG
Sbjct: 195 PMLISEVSPKHIRGTL-----VSCYQLMITLGIFLG 225

>CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some
           similarities with uniprot|Q12300 Saccharomyces
           cerevisiae YDL138w RGT2 or uniprot|P10870 Saccharomyces
           cerevisiae YDL194w SNF3
          Length = 762

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 27/101 (26%), Positives = 44/101 (43%)
 Frame = +1

Query: 499 NVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLA 678
           N L L+G   +P  L+  M+ + VG    +G  L G  +GL+ + ++  +     A   +
Sbjct: 99  NNLQLLG---QPLPLRSTMMTTFVGLFVAVGGFLYGYDTGLINSITDMKYVKEHIAPNHS 155

Query: 679 AFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFN 801
            F  T IS      ++ T V  L   WI    G    I+F+
Sbjct: 156 FFTTTQISMLVSFLSLGTFVGALIAPWISDIYGRKSTIIFS 196

>YDR022C Chr4 complement(488072..488662) [591 bp, 196 aa] {ON}
           CIS1Autophagy-specific protein required for
           autophagosome formation; may form a complex with Atg17p
           and Atg29p that localizes other proteins to the
           pre-autophagosomal structure; high-copy suppressor of
           CIK1 deletion
          Length = 196

 Score = 30.4 bits (67), Expect = 9.1
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 7/117 (5%)
 Frame = +1

Query: 22  KNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLL 201
           KN++   Y  EE I+++   +ND+ P+   ++ S    DY    T    +IF     +L+
Sbjct: 10  KNVK---YRLEENIKNNKGPSNDDQPAYNNESKSTDGSDYAMFPT-NIKYIFEDNNDELV 65

Query: 202 NLAGTTQTLSI-------MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 351
           + +    T  I        NV+  QL  S SL+        L+S  + L+S R   +
Sbjct: 66  DSSDAALTAGIDKVGDELENVIIVQLDESGSLE-----DITLISDQYELLSHRTNSL 117

>AGR202W Chr7 (1132104..1138922) [6819 bp, 2272 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YPL085W (SEC16)
          Length = 2272

 Score = 31.2 bits (69), Expect = 9.8
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = -3

Query: 1072 HQPTMENNFLSLIQMRNSKRSKYQKNP 992
            +QP  + N+LSL+   NS+ S  Q+NP
Sbjct: 784  YQPNFDGNYLSLVDAVNSRTSSVQQNP 810

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 148,234,714
Number of extensions: 3434098
Number of successful extensions: 10205
Number of sequences better than 10.0: 209
Number of HSP's gapped: 10074
Number of HSP's successfully gapped: 216
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)