Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_541.168.843ON52852826710.0
YML116W (ATR1)8.843ON54252416040.0
Skud_13.258.843ON53752715720.0
Smik_13.188.843ON54551015670.0
TBLA0D032708.843ON55052515660.0
TDEL0B005508.843ON53749715490.0
NDAI0E002808.843ON54953615410.0
Suva_13.278.843ON55349315380.0
KLTH0C03806g8.843ON52551315340.0
TPHA0C047908.843ON55652815320.0
SAKL0D01386g8.843ON52151815130.0
CAGL0B02343g8.843ON53750315120.0
TBLA0D03280singletonON58051615050.0
Kwal_27.102458.843ON51550214930.0
KNAG0J002608.843ON55051014730.0
NCAS0B002908.843ON54251614710.0
NCAS0A02540singletonON53951514690.0
NDAI0K004008.843ON55349214690.0
NCAS0C004008.843ON51750414570.0
Suva_13.4678.843ON54351714460.0
KNAG0G034308.843ON54251714310.0
YMR279C8.843ON54052514230.0
Skud_13.4518.843ON53952114210.0
CAGL0M03003g8.843ON55852314220.0
KAFR0B03930singletonON55551614070.0
Smik_13.4928.843ON54352514040.0
KAFR0B039408.843ON54751814020.0
KAFR0A028408.843ON52050612951e-174
TBLA0C01160singletonON60052413001e-174
Smik_15.560na 1ON5165299131e-117
YOR378Wna 1ON5155308931e-114
Suva_8.435na 1ON5155328911e-113
Skud_15.545na 1ON5165248851e-112
KLTH0C10560gna 1ON5155128631e-109
Kwal_23.6547na 1ON5115058371e-105
TDEL0G04950singletonON5125198321e-105
KLLA0B00352gna 1ON4984708171e-102
KNAG0D00130na 1ON5655165395e-61
KAFR0C04860na 1ON5345345016e-56
NCAS0A05720na 1ON5635444764e-52
CAGL0L02519gna 1ON5294944657e-51
SAKL0C06116gsingletonON1851904049e-46
NDAI0K02730singletonON6045724293e-45
Smik_6.24na 2ON5445151662e-11
Suva_10.11singletonON5405001553e-10
KLLA0C18931gna 3ON5535211537e-10
Skud_6.16na 2ON5494791482e-09
SAKL0F00440gsingletonON5445221384e-08
ZYRO0C01430g8.272ON5903781296e-07
Kwal_34.15746na 3ON5184871232e-06
TDEL0F039908.272ON6313951233e-06
Kpol_543.448.272ON6434071215e-06
AGR076C8.272ON6864011215e-06
KLLA0F13684g2.473ON5711031101e-04
YPR198W (SGE1)singletonON5431451082e-04
Kwal_56.237548.272ON5894511054e-04
KLTH0C10120gsingletonON6511321054e-04
KLTH0C10142gsingletonON5731321046e-04
SAKL0A00726gsingletonON5982121037e-04
SAKL0E02992g2.473ON570119980.003
Skud_16.503singletonON543145980.003
NDAI0D010202.242ON592204980.003
Smik_13.2722.473ON561113970.004
NCAS0A078102.473ON568192960.004
TDEL0G03260singletonON612224960.004
TDEL0A024902.473ON55478960.005
Ecym_73992.473ON56394960.005
NCAS0C03460na 4ON630237960.005
Smik_17.11singletonON544128950.006
KLTH0G09372g2.242ON551258950.006
YKR105C (VBA5)singletonON582147940.007
Skud_13.2442.473ON562113940.008
NCAS0G029902.242ON581174940.009
YMR088C (VBA1)2.473ON562113930.011
TBLA0F030408.272ON906301910.019
KAFR0J009302.242ON566239910.020
KLTH0D16962gsingletonON571132900.021
Smik_16.81na 4ON625231900.021
Suva_13.2652.473ON561113900.023
NDAI0H022002.473ON571131900.025
SAKL0H16808g8.272ON657473890.029
CAGL0J01375g2.473ON564131890.031
SAKL0A08228gsingletonON569146870.055
TDEL0D06610singletonON49794860.069
Kwal_23.48242.242ON553177850.086
KLTH0B00594gsingletonON618131850.087
KLLA0F03311g2.242ON542233840.11
SAKL0C05588gsingletonON677127840.11
KLTH0B10054gsingletonON503118840.11
KLTH0E00462gsingletonON503118840.11
SAKL0E08756g2.242ON565145840.12
ZYRO0E10230gsingletonON558185830.15
CAGL0B02079gna 4ON624180830.16
TDEL0C045902.242ON529178830.17
KLTH0G13464g8.272ON593455820.20
KLTH0G19668gsingletonON508113800.33
Kpol_467.242.473ON370130800.35
SAKL0D11000g1.451ON657148790.54
TBLA0B00840singletonON63760790.56
TBLA0F016207.33ON61559780.65
NCAS0I00110na 5ON45271770.71
KLTH0H16214gsingletonON551197770.78
Smik_18.10singletonON531114770.88
Kwal_27.12832singletonON508117770.89
KNAG0E025602.473ON578127770.91
Kwal_14.782na 6ON491118760.98
TBLA0G025502.242ON613109761.1
Kwal_47.186155.530ON549162761.1
YGR224W (AZR1)na 4ON613155761.3
KLTH0D05434g2.473ON57697751.4
Smik_11.370singletonON44048751.6
Skud_18.3singletonON590145751.6
KLLA0D19941gsingletonON61193751.6
ZYRO0G03234g2.473ON56279751.6
SAKL0D04510gna 7ON53148751.7
NDAI0B037702.242ON571217741.7
Smik_11.368singletonON580145741.9
TDEL0G04740singletonON60188742.0
TBLA0B046406.155ON482135732.3
ZYRO0A00330gsingletonON576282732.4
TBLA0A03500singletonON57360732.7
KLLA0A04631g8.272ON57947732.9
Kpol_513.33singletonON62686723.6
TBLA0D030001.155ON51692714.0
TBLA0A033905.394ON57482714.1
CAGL0G08624g2.242ON583215714.2
KLLA0E24113g8.570ON575107714.5
TBLA0A03470singletonON57860714.9
Ecym_42988.272ON678306715.1
NCAS0A11500singletonON614176705.4
TBLA0A03460singletonON56860705.7
Skud_7.560na 4ON642207705.7
Skud_18.6singletonON61050705.8
SAKL0E04246gna 8ON565121706.1
Skud_15.4748.783ON522209696.6
TBLA0E01970singletonON57877697.1
KLLA0F17776gna 8ON55368697.5
KLTH0B10142gsingletonON568401697.7
ZYRO0G00352gsingletonON49491698.1
TBLA0F013801.311ON14579668.9
Kwal_56.226233.105ON30845689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_541.16
         (528 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...  1033   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   622   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   610   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   608   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   607   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   601   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      598   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   597   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   595   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   594   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   587   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   587   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   584   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   579   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   572   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      571   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   570   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               570   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      565   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   561   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   555   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   552   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   551   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   552   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   546   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   545   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   544   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   503   e-174
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   505   e-174
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   356   e-117
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   348   e-114
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   347   e-113
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   345   e-112
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   337   e-109
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   327   e-105
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   325   e-105
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   319   e-102
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   212   5e-61
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     197   6e-56
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            187   4e-52
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   183   7e-51
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   160   9e-46
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   169   3e-45
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    69   2e-11
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    64   3e-10
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    64   7e-10
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    62   2e-09
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    58   4e-08
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    54   6e-07
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    52   2e-06
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    52   3e-06
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    51   5e-06
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    51   5e-06
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    47   1e-04
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    46   2e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    45   4e-04
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    45   4e-04
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    45   6e-04
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    44   7e-04
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    42   0.003
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    42   0.003
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    42   0.003
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    42   0.004
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    42   0.004
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               42   0.004
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    42   0.005
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    42   0.005
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    42   0.005
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    41   0.006
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    41   0.006
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    41   0.007
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    41   0.008
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    41   0.009
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.011
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    40   0.019
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    40   0.020
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    39   0.021
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    39   0.021
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    39   0.023
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    39   0.025
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    39   0.029
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    39   0.031
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    38   0.055
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    38   0.069
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    37   0.086
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    37   0.087
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.11 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    37   0.11 
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    37   0.11 
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    37   0.11 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    37   0.12 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    37   0.15 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    37   0.16 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    37   0.17 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    36   0.20 
KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weak...    35   0.33 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    35   0.35 
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    35   0.54 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    35   0.56 
TBLA0F01620 Chr6 complement(404095..405942) [1848 bp, 615 aa] {O...    35   0.65 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         34   0.71 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    34   0.78 
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    34   0.88 
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    34   0.89 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    34   0.91 
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    34   0.98 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    34   1.1  
Kwal_47.18615 s47 complement(898425..900074) [1650 bp, 549 aa] {...    34   1.1  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    34   1.3  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   1.4  
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    33   1.6  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    33   1.6  
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    33   1.6  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    33   1.6  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    33   1.7  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    33   1.7  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    33   1.9  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    33   2.0  
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    33   2.3  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    33   2.4  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    33   2.7  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    33   2.9  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    32   3.6  
TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {O...    32   4.0  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    32   4.1  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    32   4.2  
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    32   4.5  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     32   4.9  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    32   5.1  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    32   5.4  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     32   5.7  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    32   5.7  
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    32   5.8  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    32   6.1  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    31   6.6  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    31   7.1  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    31   7.5  
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    31   7.7  
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    31   8.1  
TBLA0F01380 Chr6 (341570..342007) [438 bp, 145 aa] {ON} Anc_1.31...    30   8.9  
Kwal_56.22623 s56 complement(209946..210872) [927 bp, 308 aa] {O...    31   9.0  

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/528 (96%), Positives = 511/528 (96%)

Query: 1   MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60
           MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS
Sbjct: 1   MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60

Query: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 120
           CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL
Sbjct: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 120

Query: 121 KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 180
           KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT
Sbjct: 121 KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 180

Query: 181 LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 240
           LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN
Sbjct: 181 LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 240

Query: 241 NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIY 300
           NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWN                 FGIY
Sbjct: 241 NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIY 300

Query: 301 ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY 360
           ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY
Sbjct: 301 ELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY 360

Query: 361 FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII 420
           FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII
Sbjct: 361 FIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMII 420

Query: 421 LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD 480
           LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD
Sbjct: 421 LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD 480

Query: 481 LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ 528
           LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ
Sbjct: 481 LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENCEQ 528

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/524 (59%), Positives = 382/524 (72%), Gaps = 5/524 (0%)

Query: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 61
           +T+L  K     + I E    +  + + DE   M   N   +NP+YF    QEY FIF+C
Sbjct: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDE---MVDSNQKWQNPNYFKYAWQEYLFIFTC 75

Query: 62  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 121
           M+SQLLN AGTTQTLSIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLK
Sbjct: 76  MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLK 135

Query: 122 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 181
           KML++GYV+++IWSLI G++ YS S  FFII+RAFQGLGI+ VLPNVLG+IG IY  GT 
Sbjct: 136 KMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTF 195

Query: 182 KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 241
           +KN+VIS VGAM+PIGATLG LF+GL+ TE    WPWAFYAY++AAFIN  +S Y+IP+ 
Sbjct: 196 RKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST 255

Query: 242 IPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 301
           IPTN++  SMDWIGS  GV+GLIL NFVWNQAP  GWN                 F IYE
Sbjct: 256 IPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYE 315

Query: 302 LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 361
           +R+A+ PLLP  +I++R +I I+ A+ FGWGSFGI+TFYYF F LN+R Y+ LWAGG+YF
Sbjct: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375

Query: 362 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 421
           +F+I G I A+  GF +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL
Sbjct: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435

Query: 422 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 481
             GMDLSFPASSII SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   N +G  L
Sbjct: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495

Query: 482 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR--KEKDC 523
           L+GYRGA Y GI  + +A +I+GLYMVE+     + R   E DC
Sbjct: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDC 539

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/527 (55%), Positives = 381/527 (72%), Gaps = 8/527 (1%)

Query: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDES--------PSMELKNSSLRNPDYFNSTTQ 53
             + ++ + E  +       +S   D N+E+          M +     +NP+YF ++  
Sbjct: 9   SAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWH 68

Query: 54  EYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGR 113
           EY FIF+CM+SQLLN AGTTQTLSIMN++     S+++ + WL+ASFPLVSGSFIL+SGR
Sbjct: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128

Query: 114 LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 173
           LGDIYGLKKML +GYV+++IWSLI GL+ YS S  FFII+RAFQGLGI+ VLPNVLG+IG
Sbjct: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188

Query: 174 MIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFI 233
            IY  GT +KN+VIS+VGAM+P+GATLG LF+GL+ T++   WPWAFYAYT+ + IN  +
Sbjct: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248

Query: 234 SYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXX 293
           S YSIPNNIPTN+   SMDWIGS  GV+GL+L NFVWNQAP  GW+              
Sbjct: 249 SVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVF 308

Query: 294 XXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSP 353
              F IYE R+A++PLLP  ++++R +I I+ A+ FGWGSFGI+TFYYF F LN+R+YS 
Sbjct: 309 LVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368

Query: 354 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413
           +WAGG+YF+F+I G I A+  G  +KK+ P+V L  SM+ FN+G I+ SVTPVH+TYFR 
Sbjct: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428

Query: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH 473
            LGTMIIL  GMD SFPASSII SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE H
Sbjct: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488

Query: 474 CNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE 520
            + +G  +L+GYRGA Y GI  + +A +I+GLYMVE I   +K +  
Sbjct: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/510 (59%), Positives = 380/510 (74%), Gaps = 6/510 (1%)

Query: 17  AEETIRSDC-SDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 75
           +EET+R    ++  DE   M   N   +NP YF    QEY FIF+CM+SQLLN AGTTQT
Sbjct: 36  SEETLRGTAFTNLEDE---MVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92

Query: 76  LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 135
           LSIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLKKML++GYV+++IWS
Sbjct: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152

Query: 136 LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 195
           LI G++ YS S  FFII RAFQGLGI+ VLPNVLG+IG IY  GT +KN+VIS VGAM+P
Sbjct: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212

Query: 196 IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIG 255
           IGATLG LF+GL+ TE+   WPWAFYA+++A+ IN  +S Y+IPNNIPTN++  SMDWIG
Sbjct: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272

Query: 256 SFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEII 315
           S  GV+GLIL NFVWNQAP  GW+                 F IYE+ +A++PLLP  +I
Sbjct: 273 SVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVI 332

Query: 316 RNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCG 375
           ++  +I I+ A+ FGWGSFGI+TFYYF F LN+R+Y+ LWAGG+YF+F+I G I A+  G
Sbjct: 333 KDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVG 392

Query: 376 FLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 435
           F +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL  GMDLSFPASSII
Sbjct: 393 FTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 452

Query: 436 LSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIAC 495
            SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   + +G  LL+GYRGA Y GI  
Sbjct: 453 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGL 512

Query: 496 SGVAVLIAGLYMVETIFDSYKDRK--EKDC 523
           + +A +I+GLYMVE+  + +K +   E DC
Sbjct: 513 ASLACMISGLYMVESFINDHKAKAATENDC 542

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/525 (57%), Positives = 387/525 (73%), Gaps = 15/525 (2%)

Query: 8   KNIEVSSYIAE---ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLS 64
           KNI+  S +     + + +D +D NDES       SS +NPDYF +  QE+ FIFS M+ 
Sbjct: 33  KNIDSRSSLNSSLTQVLSTDTAD-NDES-------SSYQNPDYFKNKYQEFGFIFSGMIG 84

Query: 65  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 124
           QLL+ AG TQTLSIMNVL ++L S+ S + WL++SFPL  GSFILVSGRLGDIYGLKK+L
Sbjct: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144

Query: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184
           + GY+I  +WS+I GLS Y+H+  FFI ARAFQGLG++  LPN++GLIG IY+PG  +KN
Sbjct: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204

Query: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244
           M+ISI+GAMSP GATLGGLF+GL     + +WPW+FYA+ L +F+N  IS+Y IPN+IPT
Sbjct: 205 MIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264

Query: 245 NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY 304
           N++ L MDW+GS  GV GLI+ NFV+NQAP  GW                  F +YE++Y
Sbjct: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324

Query: 305 AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 364
           A+ PL+P  I  NR ++MIL ++  GWGSFGIWTFYYFSF LNLR+YSPLWAG SYFIFV
Sbjct: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384

Query: 365 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 424
           ISG+  AI CG  +KKI+P+VL   SM+GF  G IIF+ TPV+QT+FRN+LG M +LPLG
Sbjct: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444

Query: 425 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 484
           MD SFPASSIILSD+LP Q+QGMAGSLVNTVINYS S+ LG+AGTVE   N +G DLL G
Sbjct: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504

Query: 485 YRGALYFGIACSGVAVLIAGLYMVETIFD----SYKDRKEKDCEN 525
           YR A+YF I  +G+AV ++G YM+E ++     S ++ K+ D E+
Sbjct: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIES 549

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/497 (58%), Positives = 365/497 (73%), Gaps = 1/497 (0%)

Query: 29  NDESPS-MELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLH 87
             E+P  +E   S  ++P+YF     E  F+ SCM+ QLLN AG+T TLS M VL R+L 
Sbjct: 37  EKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELD 96

Query: 88  SSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 147
           SS +   WL+ASFPLVSGSFIL+SGRLGDIYGLKKML+LGY+ L IWSLI GLS +SH+ 
Sbjct: 97  SSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHND 156

Query: 148 IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 207
            FFI +RAFQGLGIS VLPN+LG++G IYKPGT +KN+VIS++G  +PIGAT GGLF+G+
Sbjct: 157 TFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGV 216

Query: 208 VATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFN 267
           V    +  WPWAFYAYT+AAF+ T ISY+ IPN+IP NVN+ +MDWIGS  GV GL+LFN
Sbjct: 217 VVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFN 276

Query: 268 FVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAM 327
           FVWNQ+   GW                  F I+E++YA+ PLLP E+  +R +IMIL ++
Sbjct: 277 FVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASL 336

Query: 328 TFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLL 387
             GWGSFGIW FYYF FVL LRNYSP+WAGG++F+  I G I A++ GF +K++ PAVLL
Sbjct: 337 MAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLL 396

Query: 388 TFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGM 447
            FSM+ F  G II SVTPVH+TYFR+ LG M+IL  GMDLSFPA+SIILSD L  Q+QGM
Sbjct: 397 FFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGM 456

Query: 448 AGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYM 507
           AGSLVNTV+NYS SLFLGI GT+E+  NK+G  LL G+R ALYF I    + +LI+G+++
Sbjct: 457 AGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFV 516

Query: 508 VETIFDSYKDRKEKDCE 524
           ++      K RKE + E
Sbjct: 517 LQKELMRSKSRKENELE 533

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/536 (54%), Positives = 385/536 (71%), Gaps = 18/536 (3%)

Query: 8   KNIEVSSYIAEET---IRSDCSD---------ANDESPSMELKNSSL------RNPDYFN 49
           KN+E    I + T   I  +CS          + DE PS E +++++      +NPDYF 
Sbjct: 11  KNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQ 70

Query: 50  STTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFIL 109
           +  QEY FIFSCM+SQLLN A T QTLSIMN++T    S    + WL+ASFPLVSGSFIL
Sbjct: 71  NKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFIL 130

Query: 110 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           +SGR+GDIYGLKK LI GY+  +IWSLI+G + YSH+ IFFII+RAFQGLGI+ +LPNV+
Sbjct: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190

Query: 170 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFI 229
           G++G IYKP T +KN+VIS++GA +PIGA +G LF+GL+ TE+   WPWAFYA+ +A+ I
Sbjct: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAI 250

Query: 230 NTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXX 289
           N  IS YSIPNNIPTN++  +MDWIGS   V+GLIL NFVWNQ P  GW           
Sbjct: 251 NLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLII 310

Query: 290 XXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLR 349
                  F  YE++YA++P+LP E+ +NR +IMIL A+  GWGSFGI++FYYFSF+LNLR
Sbjct: 311 SIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLR 370

Query: 350 NYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQT 409
           +YS LWAG +YF+F I GT+ A+  G  +K+I  +V+L FSM+ FN+G I+ SVTPV QT
Sbjct: 371 HYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQT 430

Query: 410 YFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGT 469
           YFR  LGTMIIL  GMD+SFPA++IILSD L  Q+QGMAGSL NT++NYS SL LG+  T
Sbjct: 431 YFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTT 490

Query: 470 VEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCEN 525
           VE+  NK+G ++L+GYR A Y G+  +G+ ++I+G+YM E ++   K+R   + ++
Sbjct: 491 VERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDH 546

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/493 (58%), Positives = 369/493 (74%), Gaps = 4/493 (0%)

Query: 29  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 88
           N E   M+ K    +NP+YF    QEY FIF+CM+SQLLN +GTTQTLSIMN+L     S
Sbjct: 55  NSEDEVMKTKQK-WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS 113

Query: 89  SDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGI 148
             + + WL+ASFPLVSGSFIL+SGR+GDI+GLK ML++GYV+++IWSLI GL+ YS S  
Sbjct: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173

Query: 149 FFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLV 208
           FFI++RAFQGLGI+ VLPNVLG+IG +Y  GT +KN+VIS +GAM+PIGATLG  F+GL+
Sbjct: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233

Query: 209 ATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNF 268
            T +   WPWAFYAYT+ A IN  +S Y+IPNNIPTNV+R SMDWIGS  GV+GL+L N 
Sbjct: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNL 293

Query: 269 VWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMT 328
           VWNQAP  GWN                 FG+YE+ +A++PLLP  ++++R +I I+ ++ 
Sbjct: 294 VWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLF 353

Query: 329 FGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLT 388
           FGWGSFGI+TFYYF F LN+R+Y+PLWAGGSYF+F+I G I A+  GF +K++ P+V L 
Sbjct: 354 FGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLF 413

Query: 389 FSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMA 448
           F+MV FN+G I+ SVTPVH+TYFR  +GTMIIL  GMDLSFPASSII SD LP ++QGMA
Sbjct: 414 FAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMA 473

Query: 449 GSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMV 508
           GSLVNTV+NYS SL LG+  TVE   + +G  +L+GYRGA Y GI  + +A +I+GLYMV
Sbjct: 474 GSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533

Query: 509 ETIFDSYKDRKEK 521
           E      KD + K
Sbjct: 534 ECYI---KDHRAK 543

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/513 (56%), Positives = 375/513 (73%), Gaps = 8/513 (1%)

Query: 16  IAEETIRSDCS----DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAG 71
           ++++   SD S    D +++S  +    S L+NPDYF+   +EY F+ S MLSQLLN A 
Sbjct: 8   VSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAA 67

Query: 72  TTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVIL 131
             Q   + ++L+  L +  S + WL+ASFPLVSGSFILVSG++GDIYGLKK L+ GY ++
Sbjct: 68  ALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVV 127

Query: 132 VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVG 191
           VIWSLI GLS Y+H+  FFI+AR+FQGLGI+ VLPNV G++G IYKP T  KNMV S++G
Sbjct: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIG 187

Query: 192 AMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 251
           A +PIGATLG LFSGL+ TESE +W W FYAYT+ A +N  I++Y IP+NIPTNV++  M
Sbjct: 188 ACAPIGATLGCLFSGLIGTESE-AWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKM 246

Query: 252 DWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLP 311
           DW+GSF GV GLI+FNFVWNQAP DGW+                 F I+E R+A+ PLLP
Sbjct: 247 DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLP 306

Query: 312 SEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 371
             ++ NR+L+MIL ++  GWGSFGIWT+YY +FVLNLR+Y+PLWAGGSYF+F I GTI A
Sbjct: 307 RAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAA 366

Query: 372 ISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPA 431
              G  + K  PA++L  S++ F++GCI+ SVTPV QTYFR  LGTM+IL  GMDLSFPA
Sbjct: 367 FLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPA 426

Query: 432 SSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYF 491
           SSIILSD LP+Q+QGMAGSLVNT+INYS SL LG++GT E+  NK+GTDLL+GYR ALY 
Sbjct: 427 SSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYV 486

Query: 492 GIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524
           GI  + V + ++G Y +E   D +  R+E+   
Sbjct: 487 GIGLASVGIFVSGAYAIE---DWWTRRRERSVR 516

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/528 (53%), Positives = 375/528 (71%), Gaps = 4/528 (0%)

Query: 2   DTDLKKKNIEVSSYI--AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIF 59
           D+D     +  S  I  +E+ + +D         S E  + S + P YF+S   E+AFIF
Sbjct: 23  DSDSDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIF 82

Query: 60  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYG 119
           +C++ QLLN AGTTQ++SIMN++     S  S + WL ASFPLVSGSFILV GR GDIYG
Sbjct: 83  TCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYG 142

Query: 120 LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 179
           LKKML+LGY IL IWS+I GL+ Y+HS  FFI+A+AFQGLG+S +LPN++GL+G IY+PG
Sbjct: 143 LKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPG 202

Query: 180 TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 239
           ++KKN+ IS +GAM+P+GAT GGLFSG+V  + + +WPW FYA+ + +F+     Y+ +P
Sbjct: 203 SMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVP 262

Query: 240 NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 299
           +N+PTN N L MDWIGS  GV+GL+LF+FVWNQAP DGW+                 F I
Sbjct: 263 DNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFI 322

Query: 300 YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 359
           YE+ YAE PLLP  I  NR +IMIL A+  GWG+FGIW+FYYFSF LNLR++SP+W GG+
Sbjct: 323 YEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGA 382

Query: 360 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 419
           YF F++SG   A   GFL+K IRP+++L  S+ GF +G +IF+VTP  QTY+RN  G M+
Sbjct: 383 YFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMML 442

Query: 420 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 479
           +LPLGMDLSFPASSIILSD LP ++QGMAGSLVNT++NYS S  LG+A TVE+  N +G 
Sbjct: 443 LLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGD 502

Query: 480 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE--KDCEN 525
           DLL+GYR A Y G+    + + IA LYM ET +  YK++ +   D E+
Sbjct: 503 DLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLANDIES 550

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 378/518 (72%), Gaps = 3/518 (0%)

Query: 6   KKKNIEVSSYIAEETIRSDCSDANDESPSMELKN-SSLRNPDYFNSTTQEYAFIFSCMLS 64
           K+ N  VSS   E   +S  +        ++ K   S+++P YF++  +EY FIF+ M+S
Sbjct: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63

Query: 65  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 124
           QLLN AGTTQTLS++N+L++   SS S + WL+ASFPLVSGSFILVSG++GDIYGLKK L
Sbjct: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123

Query: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184
           ++GYV+ +IWSLI GL+ Y+ S  FFII+RAFQGLGI+ +LPN++G++G IY  GT +KN
Sbjct: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183

Query: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244
           MVIS++GA +PIGAT+G LFSGL+ T SE  W W FYAYT+ A IN  +S + IPN IPT
Sbjct: 184 MVISLIGACAPIGATMGVLFSGLIGTLSE-RWAWTFYAYTITAAINMGLSIWVIPNTIPT 242

Query: 245 NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY 304
           NV   SMDWIGS  G+LG+ILFNFVWNQ P  GW+                 F +YE +Y
Sbjct: 243 NVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKY 302

Query: 305 AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 364
           A +PL+P   + N +L+M L A+ FGWGSFGIWTFYYF FVLNLR Y+PLWAGGSYF+F+
Sbjct: 303 ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFL 362

Query: 365 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 424
           I G I AIS G+ +K+I P+++L  SM+ F+ GCI+ SVTPV QTYFR ILG MIIL  G
Sbjct: 363 IWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFG 422

Query: 425 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 484
           MDLSFPASSIILSD LP ++QGMAGSLV+T+INYS S+ LGIAGTVE   NKNG DLL+G
Sbjct: 423 MDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKG 482

Query: 485 YRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
           YR ALY GI  + + V I+ L+M+E  +   + R  K+
Sbjct: 483 YRAALYLGIGLASLGVFISALFMLEN-YLRMRRRNVKE 519

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/503 (56%), Positives = 368/503 (73%), Gaps = 4/503 (0%)

Query: 22  RSDCSDANDESPSMELK---NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78
           + D +D  DE          N   +NP+YF+ST +EY F+ SC +SQLLN AG  QT  I
Sbjct: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86

Query: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138
           MN++   L S +  + WL+A+FPL+SGSFIL+SGR+GDIYGLKK L++GY+ L++WSLI 
Sbjct: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146

Query: 139 GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 198
           GL+ Y+HS  FFI++RAFQGLGISL+LPN+LG++G IY  G+ +KNMVIS++G M+PIGA
Sbjct: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206

Query: 199 TLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFT 258
           TLG +FSGL+ TE    WPWAFY+Y + A IN  +S + IPN IPTNV+   MDWIGS  
Sbjct: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266

Query: 259 GVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAE-NPLLPSEIIRN 317
           GV+GLI+ NFVWNQAP DGW+                 F IYEL +   NPLLP E++++
Sbjct: 267 GVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKS 326

Query: 318 RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377
            + I++L A+ FGWGSFGI++FYYF+F LNLR+Y+PLWAGG+YF+F+I G + A+  GF 
Sbjct: 327 PKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386

Query: 378 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 437
           +KK+ P+++L  SMV FN G II SVTP+HQTYFRN LG MIIL  GMDLSFPASSI+LS
Sbjct: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446

Query: 438 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSG 497
           D LP Q+QGMAGSLVNT++NYS S  LG+AG VEQH N +G D+L+GYRGA Y GI  + 
Sbjct: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLAS 506

Query: 498 VAVLIAGLYMVETIFDSYKDRKE 520
           +A +I+G  M+  I    K+ K+
Sbjct: 507 MACIISGALMLSEIIQGRKNEKD 529

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/516 (54%), Positives = 375/516 (72%), Gaps = 3/516 (0%)

Query: 7   KKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQL 66
           + N  ++  I   +  S+ SD N E+   E K   + +P YF + T EY FI SCM+SQ 
Sbjct: 54  QTNTSMNEVIGSISSVSNDSDINSENLQSENK---VLSPKYFKNRTHEYLFIISCMVSQF 110

Query: 67  LNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLIL 126
           ++ AG TQ LSIMN+L  +L++  S + WL+ASF L  GSFILVSGRLGDIYGLKK+L+ 
Sbjct: 111 MSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLG 170

Query: 127 GYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMV 186
           GY IL IWSLI G S YSH+  FFI +RAFQGLG++ VLPN LGLIG+IY+PG++KKNM+
Sbjct: 171 GYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMI 230

Query: 187 ISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNV 246
           I  +GAMSPIGATLGGLF+G++ T+    WPW+FY++ + +F N  +S+YSIPNNIPTN+
Sbjct: 231 IGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNI 290

Query: 247 NRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAE 306
             LSMDWIG+  G+ GL++ NFV+NQAP  GW                  F +YE++YA+
Sbjct: 291 YNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 350

Query: 307 NPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVIS 366
            PL+P  I  NR ++MIL A+  GWG+FG WTFYYFSFVLN+R Y+  WAGGSYFIF++S
Sbjct: 351 TPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVS 410

Query: 367 GTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMD 426
           G   A  CGF+MKK+ P+V+L  SM+GF  GC++ +VTP+HQ+YF+NILG M +LP+G+D
Sbjct: 411 GCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGID 470

Query: 427 LSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYR 486
           LSFPA+SIILSD LP Q+QGMAGSLV T+ NYS S+ LG+AG+VE + N NG ++L+GYR
Sbjct: 471 LSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYR 530

Query: 487 GALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
            A+ F  A +G+ ++++G+YMV  +    ++ K  +
Sbjct: 531 NAMIFADALAGLGIIVSGIYMVINLITIRENSKSTN 566

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/502 (56%), Positives = 367/502 (73%), Gaps = 3/502 (0%)

Query: 19  ETIRSDCSDANDESPSMEL--KNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTL 76
           E ++S  +   +     E     S L+NPDYF+   +EY F+ S MLSQLLN A TTQT 
Sbjct: 13  EKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTN 72

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
            + +VL++ L++  S + WL+ASFPLVSGSFILVSG++GDIYGLKK L+ GYV++VIWSL
Sbjct: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132

Query: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 196
           I GLS Y+H+  FF++AR+FQGLGI+ VLPNV+G++G IYKP T  KN+V S++GA +PI
Sbjct: 133 ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPI 192

Query: 197 GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGS 256
           GATLG +FSGL+   ++  W W FYAY + A +N  ++ + IPNNIPTNVN   MDWIGS
Sbjct: 193 GATLGCVFSGLIGARTD-LWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGS 251

Query: 257 FTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIR 316
             GV GLILFNFVWNQAP  GW                  F  YE+R+A+ PLLP  ++ 
Sbjct: 252 AIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLF 311

Query: 317 NRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGF 376
           NR+L+MIL+++ FGWGSFGIWTFYY SF+LNLR+YSPLWAGG+YF+F I G + ++  G+
Sbjct: 312 NRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGY 371

Query: 377 LMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIIL 436
            + K  PAV+L  SMV F+ GCI+ +VTPVHQTYFR  LG MIIL  GMDLSFPA+SIIL
Sbjct: 372 TIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIIL 431

Query: 437 SDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACS 496
           SD LP+Q+QGMAGSLV+T+I+YS SL LGI+GT E   NKNG DLL+GY+ ALY GI  +
Sbjct: 432 SDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLA 491

Query: 497 GVAVLIAGLYMVETIFDSYKDR 518
            + V+I+G +M+E  + S + R
Sbjct: 492 SLGVVISGAFMIEDWWTSRRKR 513

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/510 (54%), Positives = 360/510 (70%), Gaps = 5/510 (0%)

Query: 3   TDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCM 62
           T   + N+E     + E+    CS++          ++  +NP YF +  QEYAFI +CM
Sbjct: 28  TKNDQTNVEEKKNCSTESEAEWCSESEFTD-----NDTPWQNPTYFANRWQEYAFISTCM 82

Query: 63  LSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKK 122
           L+QLLN AG  Q  + MN+L    +SS   + WL+ASFPLVSGSFILVSGR+GDIYGLKK
Sbjct: 83  LAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKK 142

Query: 123 MLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLK 182
            LI GY++++IWSLI G + Y+H+  FFI+ RAFQGLGI+ +LPNV+GLIG IYK  TL+
Sbjct: 143 TLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLR 202

Query: 183 KNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 242
           KN VIS VG  +PIGA LGG++SGL+A E+   WPW FYAY +   IN  ++ YSIP+ +
Sbjct: 203 KNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTV 262

Query: 243 PTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYEL 302
           PTN++   MDW GS  GV+G+ILFNFVWNQ P DGWN                 F IYE+
Sbjct: 263 PTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEI 322

Query: 303 RYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFI 362
           ++A++PLLP E+I+NR + MIL A+  GWGSFGIWTFYY++F LNLR+YS +WAGG++F+
Sbjct: 323 KFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFM 382

Query: 363 FVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILP 422
           FVI GTI A      +K++ P+VLL FSM GF +GCI+ SVTPVHQ+Y++  LG  IIL 
Sbjct: 383 FVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILS 442

Query: 423 LGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLL 482
            GMDLSFPASSIILSD LP+Q+QGMAGSLVNT++NYS SL LG+  T E   NKNGTD L
Sbjct: 443 FGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKL 502

Query: 483 RGYRGALYFGIACSGVAVLIAGLYMVETIF 512
           +GYR ALY GI      +L+A  Y+ E ++
Sbjct: 503 KGYRAALYVGIGLGACGMLVAFCYLFEVLW 532

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/516 (55%), Positives = 369/516 (71%), Gaps = 3/516 (0%)

Query: 11  EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLA 70
           E +S I    I     D   ++ + +L++S  +NPDYF +  QEY FIFSCM+SQLLN A
Sbjct: 25  EETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQA 84

Query: 71  GTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVI 130
            T QTLSIMN++T   +S    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK L+ GY+ 
Sbjct: 85  ATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIF 144

Query: 131 LVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV 190
            +IWS+I+GL+ YSHS  FFI++RAFQGL I+ +LPNV+G++G IYKP + +KN+VIS++
Sbjct: 145 FIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMI 204

Query: 191 GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS 250
           GA +PIGA  G LF+GL+ TE    WPWAFYA+ +A+  N  IS YSIPN++PTNV+  +
Sbjct: 205 GASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFA 264

Query: 251 MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 310
           MDWIGS   V+GLIL NFVWNQ P  GW                  F  YE++YAE+PLL
Sbjct: 265 MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLL 324

Query: 311 PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 370
           P E+ +NR +IMIL A+  GWGSFGI++FYYFSF+LNLR+YS LWAG +YF+F I GT+ 
Sbjct: 325 PVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVA 384

Query: 371 AISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFP 430
           A+  G  +KKI  A +L  SMV FN+G I+ SVTPV QTYFR  LGTMIIL  GMD+SFP
Sbjct: 385 AVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 444

Query: 431 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALY 490
           A++IILSD L  Q+QGMAGSL NT++NYS SL LG+  TVE+  NK+G DLL+GYRGA Y
Sbjct: 445 AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEY 504

Query: 491 FGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCENC 526
            GI  +G+ ++I  +Y+ E +   +  RK+    N 
Sbjct: 505 LGIGLAGLGIIITAIYLGEIL---WGKRKQHLAANV 537

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/515 (53%), Positives = 368/515 (71%), Gaps = 14/515 (2%)

Query: 6   KKKNIEVSSYIAEETIRSDCSDA--NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCML 63
           + KNI  +    E+ + S+ +D+  +D+SP         +NP+YF+S  +EY FIF+CM+
Sbjct: 24  EDKNISHN----EKEVYSNSTDSVLDDDSP--------WQNPNYFSSKYKEYFFIFTCMV 71

Query: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123
           + LLN AG TQ LS MNV++   HS    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK 
Sbjct: 72  ANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKT 131

Query: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 183
           +I GY+ ++IWSL+ G + ++H+  FFI+ RAFQGLGIS +LPNV+GLIG IYK GTL+K
Sbjct: 132 MIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRK 191

Query: 184 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 243
           N+VIS++G  +P GA +G L+ GL+ TE+   WPW FYAY L   +N  ++ YS+PN IP
Sbjct: 192 NIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIP 251

Query: 244 TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELR 303
           TNV+  +MDWIGS  GV+GLILFNFVWNQ P  GW+                 F +YEL+
Sbjct: 252 TNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELK 311

Query: 304 YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF 363
           Y  +PLLP E+ +N Q++ IL+ +  GWG+FGIWTFYYF+F LNLR+YSP+W GG+YF+F
Sbjct: 312 YPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMF 371

Query: 364 VISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 423
           +I GTI A+   F +KK+ PA+LL FS +GF +G ++ SVTP+HQ Y+R  LG  IIL  
Sbjct: 372 IIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCF 431

Query: 424 GMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR 483
           GMDLSFPASSIILSD+LP Q+QGMAGSLVNTVINY+ SL LG+  TVE+  NK+G DLL+
Sbjct: 432 GMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLK 491

Query: 484 GYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 518
           GYR ALY  +   G+   IA + +  T++   +DR
Sbjct: 492 GYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDR 526

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 358/492 (72%)

Query: 35  MELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV 94
           ++  NSS +NPDYF+S+ +EY F+ +CM++ LLN AG +Q LS MNV++   HSS   + 
Sbjct: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WL+ASFPLVSGSFIL+SGRLGDIYGLK+M+I G++ ++IWSLI G + Y+HS  FFI+AR
Sbjct: 116 WLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVAR 175

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
           AFQGLGIS +LPNV+GL+G IYK GTL+KN+VIS++G M+P G+  G L+ GL+ TE+  
Sbjct: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235

Query: 215 SWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAP 274
            WPW FYAY +AA +   + YY++P+NIPTNVN  +MDWIGS  GV+GLILFNFVWNQ P
Sbjct: 236 QWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295

Query: 275 ADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSF 334
             GW                  F +YE++YA+ PLLP  + +N  ++ ILT +  GWGSF
Sbjct: 296 IVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355

Query: 335 GIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGF 394
           GIWTFYYF+F LNLR YSP+W+GG++F+F+I GT+ A +    +KK+ PA+LL FS +GF
Sbjct: 356 GIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGF 415

Query: 395 NLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNT 454
             G II SVTPVHQTY+RN  G  IIL  GMDL FPASSIILSD LP Q+QGMA SLVNT
Sbjct: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475

Query: 455 VINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDS 514
           ++NYS SL LG+  TVE+  NK+G DLL+GYR ALYFG+  +G+   IA L +   I+  
Sbjct: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535

Query: 515 YKDRKEKDCENC 526
              +  KD + C
Sbjct: 536 RNAKDPKDLQRC 547

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/504 (53%), Positives = 357/504 (70%), Gaps = 3/504 (0%)

Query: 18  EETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLS 77
           +E I S          S+   ++  +N  YF S  +EY FIF+CM + LLN AG TQ LS
Sbjct: 4   KEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLS 63

Query: 78  IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 137
            MNV++   HS    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK +I GY+ ++IW+L+
Sbjct: 64  TMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123

Query: 138 TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 197
            G + Y+HS  FFI+ RAFQGLGIS +LPN++GL+G IYK GTL+KN+VIS++G  +P G
Sbjct: 124 CGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTG 183

Query: 198 ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSF 257
           A +G L+ GL+ATES   WPW FYAY LAAF+N  ++ YS+P N+PTNV+  +MDW+G+ 
Sbjct: 184 ACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAI 243

Query: 258 TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 317
            GV+GLILFNFVWNQ P +GW                  F IYEL++  +PLLP E+ +N
Sbjct: 244 IGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKN 303

Query: 318 RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377
            Q++ IL  +  GWGSFGIWTFYY++F LNLRNYSPLWAG ++F+F+I G+I A   GF 
Sbjct: 304 GQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFT 363

Query: 378 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 437
           + ++ PAVLL FS +GF +G ++ SVTP+HQTY+R  +G  IIL  GMDLSFPASSIILS
Sbjct: 364 INRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILS 423

Query: 438 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSG 497
           D+LP Q+QGMAGSLVNT+INYS SL LG+  TVE+  NK G +LLRGYR ALY  +   G
Sbjct: 424 DHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGG 483

Query: 498 VAVLIAGLYMVETIFDSYKDRKEK 521
           +   +A L +    +D ++ RK +
Sbjct: 484 LGACVAFLNLC---YDLWRKRKSR 504

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/517 (53%), Positives = 367/517 (70%), Gaps = 1/517 (0%)

Query: 5   LKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIFSCML 63
           + K +++    +   +   D +     + S ++ N S  ++P YF+S  +E  FI +CML
Sbjct: 19  IDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCML 78

Query: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123
           +QLLN AG T  L+IMNVL++  +S    + WL+ASFPLV+GSFIL+SGRLGDIYGLKKM
Sbjct: 79  AQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKM 138

Query: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 183
           L++GYV +++WSLI GLS YS++  FFI  RAFQGLGI+ +LPNV+GL+G +YK G+ +K
Sbjct: 139 LMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRK 198

Query: 184 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 243
           N+VIS +GA +P G   GGLF GL+  E    WPW FYA+ +A F+N  +++YSIPNNIP
Sbjct: 199 NLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIP 258

Query: 244 TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELR 303
           TNV+  SMDW GS   V+GLILFNFVWNQAP  GW                  F +YE++
Sbjct: 259 TNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVK 318

Query: 304 YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF 363
           YA+ PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+YF+F
Sbjct: 319 YAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVF 378

Query: 364 VISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 423
           VI GTI A      +K++ PA LL F++V F++G I+FSV PV Q++++   G   IL  
Sbjct: 379 VIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCF 438

Query: 424 GMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR 483
           GMDLSFPASSIILSD LP ++QGMAGSLVNTVINYS SL LG+  TVE   NKNG DLL+
Sbjct: 439 GMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLK 498

Query: 484 GYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE 520
           GYRGA+Y G+  + + VLI+  YM+ET +++ +DR++
Sbjct: 499 GYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 366/517 (70%), Gaps = 3/517 (0%)

Query: 11  EVSSYIAEETIRSDCSDANDESPSMELK---NSSLRNPDYFNSTTQEYAFIFSCMLSQLL 67
           EVSS    E   SD   + +E+ +       N   ++  YF +  QEY F+ +CM+SQLL
Sbjct: 22  EVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLL 81

Query: 68  NLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILG 127
           N A   QTLS+MN+LT+  HS+   + WL+ASFPLVSGSFIL+SGR+GDIYGLK  L+ G
Sbjct: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141

Query: 128 YVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVI 187
            +  +IW+LI+G + Y+HS  FFI++R+FQGLG++ +LPNV+G +G IYKP T +KN+VI
Sbjct: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201

Query: 188 SIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVN 247
           S++GA +P+GA +G  F+GL+ T++   WPW+FYA  +A+ +    + YSIPN+IPTNV+
Sbjct: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261

Query: 248 RLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAEN 307
             SMDWIGS   V+GLIL NFVWNQ P DGW                  F IYE+ YA +
Sbjct: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAAS 321

Query: 308 PLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISG 367
           PLLP  I +NR ++MIL A+  GWGSFGI++FYYF+F+LNLR+YS +WAGG+YF+F I G
Sbjct: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381

Query: 368 TITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDL 427
            + ++  G  ++KI  +++L FSM+ F++G I+ SVTPV QTYFR  LGTMIIL  GMD+
Sbjct: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441

Query: 428 SFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRG 487
           SFPA++IILSD+LPNQ+QGMAGSL NT++NYS SL LG+  TVE   N+NG DLL+GYR 
Sbjct: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501

Query: 488 ALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524
           A Y GI  + +AV+++ +YM E ++   K+R E   E
Sbjct: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSE 538

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/525 (51%), Positives = 374/525 (71%), Gaps = 2/525 (0%)

Query: 2   DTDLKKK-NIEVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIF 59
           D+++ +K  ++    +   T   + +     + S ++ N S  ++P YF+S  +E  FI 
Sbjct: 15  DSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIA 74

Query: 60  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYG 119
           +CML+QLLN AG T  L IMNVL++  +S  + + WL+ASFPL +GSFIL+SGRLGDIYG
Sbjct: 75  TCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYG 134

Query: 120 LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 179
           LKKMLI+GYVI+++WS+I+GLS YS+S  FFI +RAFQG+GI+ +LPN++GL+G +YK G
Sbjct: 135 LKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVG 194

Query: 180 TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 239
           + +KN+VIS +GA +P G   GGLF GL+ TE    WPW FYA+ +A F++  +++YSIP
Sbjct: 195 SFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIP 254

Query: 240 NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 299
           NN+PTN++ LSMDW GS   ++GLILFNFVWNQAP  GW+                 F +
Sbjct: 255 NNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFV 314

Query: 300 YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 359
           YE +YAE PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+
Sbjct: 315 YESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 374

Query: 360 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 419
           YF+FVI G++ A    F +K++ PA+LL FS++ F+ G I+FSV PV Q+Y++       
Sbjct: 375 YFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQA 434

Query: 420 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 479
           IL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL LG+ GTVE   NK+G 
Sbjct: 435 ILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGN 494

Query: 480 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524
           DLL+GYR A+Y G+  + + V+I+  YM+E +++ ++  +++  E
Sbjct: 495 DLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/521 (52%), Positives = 369/521 (70%), Gaps = 5/521 (0%)

Query: 4   DLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCML 63
            +K+++  + S   E T  +  S +N  S      +S  ++P YF+S  +E  FI +CML
Sbjct: 23  SMKEEDKVIVSTDEEVTTVASSSKSNQIS-----NDSPWQDPTYFSSFGKELMFIGTCML 77

Query: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123
           +QLLN AG T  L IMNVL++   S  + + WL+ASFPL +GSFIL+SGRLGDIYGLKKM
Sbjct: 78  AQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKM 137

Query: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 183
           L++GYVI+++WS+I+GLS YS++  FFI  RAFQG+GI+ +LPN++GL+G +YK G+L+K
Sbjct: 138 LMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRK 197

Query: 184 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 243
           N+VIS++GA  P GA  GG+F GL+ TE    WPW FYA+ +A FI+  +++YSIPNN+P
Sbjct: 198 NLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVP 257

Query: 244 TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELR 303
           TNV+ LSMDW GS   V+GLILFNFVWN+AP  GW+                 F +YE++
Sbjct: 258 TNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIK 317

Query: 304 YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF 363
           YAE PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+YF+F
Sbjct: 318 YAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVF 377

Query: 364 VISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 423
            I GTI A    F +K++ PA+LL F+++ F+ G I+FSV PV Q+Y++       +L  
Sbjct: 378 AIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCF 437

Query: 424 GMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR 483
           GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL LG+  TVE   NK+G ++L 
Sbjct: 438 GMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLE 497

Query: 484 GYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524
           GYR A+Y GI  + + VLI+  YM+ET+++  K  + K  E
Sbjct: 498 GYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 370/523 (70%), Gaps = 13/523 (2%)

Query: 17  AEETIRSDCSDANDESPSMELK------------NSSLRNPDYFNSTTQEYAFIFSCMLS 64
            EE   SD   +N +  S+  K            +S  +NP+YF +  +E  FI SCM++
Sbjct: 36  CEECSSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVA 95

Query: 65  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 124
           QLLN AG TQ+LS MNVL     S+ S + WL+ASFPLVSGSFIL+SGRLGDIYGLKK L
Sbjct: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155

Query: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184
            +GY+I+ +WS+I GL+ Y++S  FFI+ R+FQGLGI+ +LPN++GL+G IYK GTL+KN
Sbjct: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKN 215

Query: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244
           +VIS +G M+P GA LG LF GL+ TE    WPW FYA+ +A+F+N  ++ YSIPNN+PT
Sbjct: 216 IVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPT 275

Query: 245 NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY 304
           N+N L+MDWIGS  GV GL+L N VWNQAP  GW                  F +YE++Y
Sbjct: 276 NLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKY 335

Query: 305 AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 364
           A +PLLP  ++ N++++MIL A+ FGWGSFGIWT+YY++F LNLR Y+PLWAGG++F+FV
Sbjct: 336 ATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFV 395

Query: 365 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 424
           I GT+ A      +KK+ PAVLL FSMV F+ G I+ SVTPVHQTY+R  +G  IIL  G
Sbjct: 396 IWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFG 455

Query: 425 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 484
           MDLSFPASSIILSD LP Q+QGMAGSLVNTV+NYS SL LG+  TVEQ  N +G DLL+G
Sbjct: 456 MDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKG 515

Query: 485 YRGALYFGIACSGVAVLIAGLYMV-ETIFDSYKDRKEKDCENC 526
           YR ALY  I  +   V ++ +++V + I   ++ R E +CE+C
Sbjct: 516 YRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC 558

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/516 (53%), Positives = 360/516 (69%), Gaps = 9/516 (1%)

Query: 9   NIEVSSYIAEETIRSDCSDANDESPSMEL---KNSSLRNPDYFNSTTQEYAFIFSCMLSQ 65
           N + S+ ++E+T  S  S     SP  E     N+  +NP YF+S  +EY FI +CMLS 
Sbjct: 35  NYDSSTSVSEKT--SAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSN 92

Query: 66  LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLI 125
           LLN AG TQ  S MNV+    ++  S K WL+ASFPLVSGSFILVSGR+GDIYGLK+ +I
Sbjct: 93  LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMI 152

Query: 126 LGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 185
            G ++++IWSLI G + YS S  FFII RAFQGLGI+ VLPNV+GL+G IYK G+L+KN+
Sbjct: 153 GGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNI 212

Query: 186 VISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTN 245
           VIS +G  +P GA  G  ++GL+AT++E  WPW FYAY  A  +N  ++ YSIP+ +P N
Sbjct: 213 VISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN 272

Query: 246 VNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 305
           V+  SMDW GS  GV+GLILFNFVWN+AP  GW                  F IYE+++A
Sbjct: 273 VHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFA 332

Query: 306 ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 365
           ++PLLP  +  N  +IMIL+AM  GWGSFGIWTFYY++F+LNLR Y+PL AG S+ +F++
Sbjct: 333 KSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFIL 392

Query: 366 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 425
            GTI A +  F +K++ P+VLL  SMV F +G I+ S+TPVHQTY++   G  IIL  GM
Sbjct: 393 WGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGM 452

Query: 426 DLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGY 485
           DLSFPASSIILSD LP ++QGMAGSLVNT++NYS SL LG+  T E   NKNGTDLL+GY
Sbjct: 453 DLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGY 512

Query: 486 RGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 521
           R ALY GI    V V+IA L++    F+S + ++ +
Sbjct: 513 RAALYVGIGLGVVGVIIAALFL----FESLRQKRGR 544

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/525 (53%), Positives = 374/525 (71%), Gaps = 2/525 (0%)

Query: 2   DTDLKKKNI-EVSSYIAEETIRSDCSDANDESPSMELKNSS-LRNPDYFNSTTQEYAFIF 59
           D  +  K I +V   +   T   + +     + S ++ N S  ++P YF+S  +E  FI 
Sbjct: 15  DYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIA 74

Query: 60  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYG 119
           +CML+QLLN AG T  L IMNVL++  +S  + + WL+ASFPL +GSFIL+SGRLGDIYG
Sbjct: 75  TCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYG 134

Query: 120 LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 179
           LKKML++GYVI++IWS+I+GLS YS+S  FFI  RAFQGLGI+ +LPN++GL+G +YK G
Sbjct: 135 LKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVG 194

Query: 180 TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 239
           +L+KN+VIS++GA +P G   GG+F GL+ TE    WPW FYA+++A FI+  +++YSIP
Sbjct: 195 SLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIP 254

Query: 240 NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 299
           NN+PTNV+ LSMDW GS   VLGLILFNFVWNQAP  GW                  F +
Sbjct: 255 NNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFV 314

Query: 300 YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 359
           YE++YAE PLLP  + +NR +IMIL A+  GWGSFGIWTFYY SF LNLR+YSP+W GG+
Sbjct: 315 YEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 374

Query: 360 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 419
           YF+FVI G+I A    F +K++ PA+LL F+++ F+ G I+FSV PV Q+Y++       
Sbjct: 375 YFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQA 434

Query: 420 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 479
           IL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL LG+  TVE+  NK+G 
Sbjct: 435 ILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQ 494

Query: 480 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524
           +LL+GYR A+Y GI  + + +LI+  YM+E  ++ +K+ ++K  E
Sbjct: 495 NLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLE 539

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/518 (51%), Positives = 352/518 (67%), Gaps = 2/518 (0%)

Query: 11  EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLA 70
           + S  +  ++++ D     D+  S    NS  ++P YF S+ QEY FI +CML+ LLN A
Sbjct: 30  QTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQA 89

Query: 71  GTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVI 130
           G TQTLS MNVL   L+S  + K WL+ASF L SGSFILVSGR+GDIYGLK   I G +I
Sbjct: 90  GQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNII 149

Query: 131 LVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV 190
             IWS++ G+S Y+ +  FFII RAFQGLG++ VLPNV+GL+G IY  G+++KN+VIS +
Sbjct: 150 FCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFI 209

Query: 191 GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS 250
           G M+P+G T GG++ GL+   ++  WPW F+A  +A FIN  +  YSIPN++PTN+  L 
Sbjct: 210 GCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLK 269

Query: 251 MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 310
           MDWIGS  GV+GLIL NFVWNQAP  GW+                 F IYEL+ AE+PLL
Sbjct: 270 MDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLL 329

Query: 311 PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTIT 370
           P E+ +NR ++ I+ ++  GWG+FGIWTFYY++F LNLR++SPLWAG ++F+F+I G++T
Sbjct: 330 PPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLT 389

Query: 371 AISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFP 430
           AI+  F + K+ P+VL   S +GF  G IIFSVT   QTY+RN LG  IIL LGMDLSFP
Sbjct: 390 AITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFP 449

Query: 431 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALY 490
            SSIILSD LP Q+QGM+GSLVNT+ NY+ SL LG+  T E   N  G D+L+GYR ALY
Sbjct: 450 GSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALY 509

Query: 491 FGIACSGVAVLIAGLYMVETIFDSYKDRK--EKDCENC 526
             I    +    +  YM E ++  Y+ R+  EK  + C
Sbjct: 510 VAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKEDKC 547

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  503 bits (1295), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 352/506 (69%), Gaps = 3/506 (0%)

Query: 18  EETIRSDCS---DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQ 74
           +E I+SD S    +N++   +  + S  ++P YF ++ QEY F+ SCM +QLLN A T Q
Sbjct: 10  KEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQ 69

Query: 75  TLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIW 134
           TLSIMNVL+   +SS S + WLVASFPLV+GSFIL+SGR+GDIYGLKK LI GY+ L+IW
Sbjct: 70  TLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129

Query: 135 SLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMS 194
           SLI G + YS S  F IIARAFQGLGI+  LPNV+G IG IY  G+L+KNMVIS++ A +
Sbjct: 130 SLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189

Query: 195 PIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWI 254
           P+GA +GG F+GL+ TES   WPW+FYA+ +A   N  IS YSIP+NIPTNVN   MDWI
Sbjct: 190 PVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWI 249

Query: 255 GSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEI 314
           GS   V GLILFNF WNQ P  GW+                 F  YE+ +A +PL+  EI
Sbjct: 250 GSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREI 309

Query: 315 IRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISC 374
             +R +I+ +  +  GWGS+GIW+FYYFSFVLNLR+YSP+WAGGSYFIF I G + +   
Sbjct: 310 THSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFV 369

Query: 375 GFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSI 434
           G  +KKI   V+L FSMV F +G  + SV PV Q+YF+  L  M IL +G+D SFPA++I
Sbjct: 370 GISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATI 429

Query: 435 ILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIA 494
           ILSD LP ++QGMAGSL  T++NYS SL LG+  TVE+  NK+G D+L+GYR A Y GI 
Sbjct: 430 ILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIG 489

Query: 495 CSGVAVLIAGLYMVETIFDSYKDRKE 520
            SG+ +L+A + +++ +   Y+++  
Sbjct: 490 LSGLGLLLACILVIDKLVAKYRNKNS 515

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  505 bits (1300), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 246/524 (46%), Positives = 347/524 (66%), Gaps = 3/524 (0%)

Query: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 61
           DT  K +N+   + +   +  S  S    ++     ++ +LR PD F +  QE+ F+   
Sbjct: 70  DTMPKDQNLVCQNIMQFASFESSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVG 129

Query: 62  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 121
           ++ Q L+  G TQ LS MN+L  +LH++   + WL+A+FPL  G  IL+SGRLGDI+GLK
Sbjct: 130 VIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLK 189

Query: 122 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 181
           K+L+LGY+I  IW+LI G S Y+HS   FI++R FQGLG++  LPN+  LIG+IYKP   
Sbjct: 190 KVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCF 249

Query: 182 KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 241
           KKNM+  I+GAMSPIGATLGG+F+GL    +  +WPW+FY++ + AF+N  I+++ IPN+
Sbjct: 250 KKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPND 309

Query: 242 IPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYE 301
           I  N   L MDWIGS  G+ GL++ NFV+NQ P DGW+                 F IYE
Sbjct: 310 IEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYE 369

Query: 302 LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 361
           L  A  PL+P  I  N +LI+IL  +  GWG F IWTFYYF+F LNLR+YSPLWA  S F
Sbjct: 370 LTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNF 429

Query: 362 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 421
           + +ISGTI  I C   +++++P +LL FSM+GF  G I+F+VTP+HQT+FRN+ G+M + 
Sbjct: 430 VLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLF 489

Query: 422 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 481
           PLGM  SFP++S++ ++ LP  ++ MAGSLVN  INY+ S+ +G+AG+   + N +G DL
Sbjct: 490 PLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDL 549

Query: 482 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCEN 525
           L G+R A Y  I  SG +V ++GLYM+ +I   + DR +K  EN
Sbjct: 550 LHGFRAASYLAIGLSGFSVFLSGLYMIGSI---WTDRNQKMKEN 590

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  356 bits (913), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/529 (37%), Positives = 303/529 (57%), Gaps = 26/529 (4%)

Query: 1   MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60
           + + + ++N++++     ET++ D    +DE    E K  SL           E AF+  
Sbjct: 3   LSSPVTEENLDMNV----ETLKKDDEVLSDEFDVQEEKPESL---------LWESAFVGV 49

Query: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYG 119
              +QL+  AG  Q+L+ ++++     +++  ++ W  +++ L  G+FIL++GRLGDI+G
Sbjct: 50  LCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFG 109

Query: 120 LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 179
            KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YKPG
Sbjct: 110 HKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG 168

Query: 180 TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 239
             +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     YY IP
Sbjct: 169 R-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW--WPWAYWLMGIACFLLAVAGYYLIP 225

Query: 240 NNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXX 293
           +    N +  S      +D+ GS TGV+GLILFNF WNQ P  GW               
Sbjct: 226 HTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVF 285

Query: 294 XXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSP 353
              F   E R A  PLLP   + +     +L+ +  GW SFGIW FY + F+ + R  +P
Sbjct: 286 LIIFAFIESR-AAFPLLPFAALSSDT-AFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTP 343

Query: 354 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413
           L +   +    ISG   A+  GFL+    P+ ++ F+M  F +G I+ +  PVHQTY+  
Sbjct: 344 LLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQ 403

Query: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH 473
              ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E +
Sbjct: 404 TFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESN 463

Query: 474 CNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
            N  G ++L+GYR + Y GI  SG  + +A  Y V T   S K   EK 
Sbjct: 464 VNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/530 (36%), Positives = 299/530 (56%), Gaps = 31/530 (5%)

Query: 2   DTDLKKKNIEVSSYI--AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIF 59
            + + +KN++ ++     E+ + S+  D  DE P                S   E AF+ 
Sbjct: 4   SSSVTQKNLDTNAEALKKEDKVLSEF-DIQDERP---------------KSLLWESAFVG 47

Query: 60  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIY 118
               +QL+  AG  Q+L+ ++++     ++++ ++ W  +++ L  G+FIL++GRLGDI+
Sbjct: 48  VLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIF 107

Query: 119 GLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKP 178
           G KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YKP
Sbjct: 108 GHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 166

Query: 179 GTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSI 238
           G  +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     Y+ I
Sbjct: 167 GR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW--WPWAYWIMGIACFVLAVAGYFVI 223

Query: 239 PNNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXX 292
           P+    + +  S      +D+ GS TGV+GLILFNF WNQ P  GW              
Sbjct: 224 PHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTF 283

Query: 293 XXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYS 352
               F   E R A  PLLP   + +     +L+ +  GW SFGIW FY + F+ + R  +
Sbjct: 284 FLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQT 341

Query: 353 PLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFR 412
           PL +   +    ISG   A++ GFL+    P+ ++ F+M  F +G I+ +  PVHQTY+ 
Sbjct: 342 PLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWA 401

Query: 413 NILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQ 472
               ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E 
Sbjct: 402 QTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES 461

Query: 473 HCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
             N  G   L+GYR + Y GI  SG+ + +A  Y   T   S K   EK 
Sbjct: 462 RVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQ 511

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/532 (37%), Positives = 300/532 (56%), Gaps = 38/532 (7%)

Query: 4   DLKKKNIEVSSYIAEETIRSDCS------DANDESPSMELKNSSLRNPDYFNSTTQEYAF 57
            + +KN+E S+    ET ++D        +  DE+P                S   E AF
Sbjct: 6   SVTQKNLETSA----ETTKTDDEVLLNQFELQDETP---------------GSLVWEAAF 46

Query: 58  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGD 116
           +     +QL+  AG  Q+++ ++++     +++  ++ W  +S+ L  G+FIL++GRLGD
Sbjct: 47  VGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGD 106

Query: 117 IYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY 176
           I+G +K  ILG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  Y
Sbjct: 107 IFGHRKFFILGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAILGRTY 165

Query: 177 KPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 236
           KPG  +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     Y+
Sbjct: 166 KPGK-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW--WPWAYWIMGIACFLLAVAGYF 222

Query: 237 SIPN-NIPT----NVNRLS-MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXX 290
            IP+  +P+    + N L  +D+ GS TGV+GLILFNF WNQ P  GW            
Sbjct: 223 VIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVG 282

Query: 291 XXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRN 350
                 F   E R A  PLLP   + +     +L  +  GW SFGIW FY + F+   R 
Sbjct: 283 TVFLGVFVFIESR-AAYPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRK 340

Query: 351 YSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTY 410
            SPL +   +    ISG   A++ GFL+     + ++ F+M  F +G I+ +  PVHQTY
Sbjct: 341 QSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTY 400

Query: 411 FRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470
           +     ++I++P GMD+SFPA++I+LS+++P++HQG+A SLVNTV+NYS S+ LGIAGT+
Sbjct: 401 WAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460

Query: 471 EQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
           E   N  G + L+GYR + Y GI  SG+ + +A +Y   T   S K   EK 
Sbjct: 461 ESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQ 512

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  345 bits (885), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/524 (36%), Positives = 293/524 (55%), Gaps = 28/524 (5%)

Query: 6   KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ 65
           K  +    +   ++ +  D  D  DE+P                S   E AF+     +Q
Sbjct: 10  KDFDTNTGTLKKDDEVVLDEFDIQDETP---------------GSLLWETAFVGVLCSAQ 54

Query: 66  LLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKML 124
           L+  AG  Q+L+ ++++ +   +++  ++ W  +++ L  G+FIL++GRLGDI+G KK  
Sbjct: 55  LMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFF 114

Query: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184
           +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YK G  +KN
Sbjct: 115 VLGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKN 172

Query: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244
           MV S+ GA +P G  LG +FS L+   +   WPWA++   +A F      Y+ IP+    
Sbjct: 173 MVFSLFGACAPGGFVLGAVFSSLLGQLAW--WPWAYWIMGIACFFLAIAGYFIIPHTAMP 230

Query: 245 NVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFG 298
           + +  S      +D+ GS TGV+GLILFNF WNQ P  GW                  F 
Sbjct: 231 SRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFA 290

Query: 299 IYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGG 358
             E R A  PLLP   + +     +L+ +  GW SFGIW FY + F+ + R  +PL +  
Sbjct: 291 FIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 348

Query: 359 SYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTM 418
            +    +SG   A++ G+L+ +  P+ ++ F+M  F  G I+ +  PVHQTY+     ++
Sbjct: 349 QFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSI 408

Query: 419 IILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNG 478
           I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E + N  G
Sbjct: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGG 468

Query: 479 TDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522
              L+GYR + Y GI  SG+ + +A +Y   T   S K   EK 
Sbjct: 469 AKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  337 bits (863), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/512 (37%), Positives = 287/512 (56%), Gaps = 14/512 (2%)

Query: 18  EETIRSD--CSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 75
           EE  + D   +  +      EL            S   E AF+     +QL+  AG  Q+
Sbjct: 7   EENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLGQS 66

Query: 76  LSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIW 134
           ++ ++++     + +  ++ W  A++ L  G+FIL++GRLGD+YG KK  I+G+    +W
Sbjct: 67  IAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALW 126

Query: 135 SLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMS 194
           SL+ G S YS+  IFF   RAFQG+G +L+LPN + ++G  Y PG  +K M++S+ GA +
Sbjct: 127 SLLAGFSVYSNQ-IFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFGATA 184

Query: 195 PIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN----NIPTNVNRLS 250
           P G  LG +FS +    +   WPWA++A  +  F         IP      + T+V+   
Sbjct: 185 PAGFVLGAVFSSIFGQLTW--WPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQ 242

Query: 251 -MDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPL 309
            +D  GS TGV+GL+L NF WNQ P  GW                  F   E R A +PL
Sbjct: 243 RLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPL 301

Query: 310 LPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTI 369
           LP   + +     +L  +  GW SFGIW +Y++ F+  LR +SPL     +    ISG  
Sbjct: 302 LPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLC 360

Query: 370 TAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSF 429
            A++ GF++ ++R ++++ F+M  F +G I+ +  PV Q Y+     ++I++P GMD+SF
Sbjct: 361 AALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSF 420

Query: 430 PASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGAL 489
           PA++I+LSD++P++HQG+A SLVN V+NYS S+ LG+AGTVE   N  G +LL+GYRGA 
Sbjct: 421 PAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAW 480

Query: 490 YFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 521
           Y GI  SG  +LIA +Y   T   S K   EK
Sbjct: 481 YMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/505 (36%), Positives = 287/505 (56%), Gaps = 18/505 (3%)

Query: 29  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 88
           N+E  S++L  S +  P    S  +E  F+     +QL+  AG  Q+++ + ++      
Sbjct: 17  NEEGESLQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73

Query: 89  SDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 147
           S+  ++ W  A++ L  G+FIL++GRLGD++G KK+ ++G++   +WSL+ G S YS+  
Sbjct: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ- 132

Query: 148 IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 207
           IFF   RA QG+G + +LPN + ++G  Y PG  +K MV SI GA +P G  LG +FS +
Sbjct: 133 IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSI 191

Query: 208 VATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLS-----MDWIGSFTGVLG 262
            +  +   WPWA++A   A  +        IP   P  ++  +     +D  G+ TG+LG
Sbjct: 192 FSQLAW--WPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILG 249

Query: 263 LILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIM 322
           L L NF WNQ P  GW                  F + E R A  PLLP   + +  L  
Sbjct: 250 LALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAAL-STDLAY 307

Query: 323 ILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIR 382
           +L  +  GW SFGIW FY++ F+ + R+ SPL     +    ISG   A++ G+++  + 
Sbjct: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367

Query: 383 PAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 442
              ++  +M+ F +G ++ +  P++QTY+     ++II+P GMD+SFPA++I++S+ +P+
Sbjct: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427

Query: 443 QHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLI 502
           +HQG+A SLVNTV+NYS SL LG AGT+E   N  G + L GYRGA Y GI  SG+ VL+
Sbjct: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLV 487

Query: 503 AGLYMVETIFDSYKDRK--EKDCEN 525
           A +Y   T+   +K+ +  EK   N
Sbjct: 488 AIVYAWSTL-KKFKEEQLSEKSSNN 511

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 302/519 (58%), Gaps = 15/519 (2%)

Query: 5   LKKKNIEVSSYI--AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCM 62
           + KK+ +   Y+  +E T RS     N ES        S      F+   +EYAF+F+ +
Sbjct: 1   MNKKHDKEDQYVFFSECTERSI--SCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGV 58

Query: 63  LSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKK 122
           ++Q  N AG T  L ++NVL+   H       +L+ S+P+V GSF+L+ GRLG+++G K+
Sbjct: 59  MAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKE 113

Query: 123 MLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK--PGT 180
            L+ GY+IL++ SL+ GLS YS S IF++I RAFQG+G++L+LPN        Y+     
Sbjct: 114 TLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKA 173

Query: 181 LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 240
            +K ++ +I+G  +  GA LG   SG+  T SE +W WA+Y YT+AA +   +SYYS+P+
Sbjct: 174 HRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPD 233

Query: 241 NIPTNVNRLSMDWIGSFTG-VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGI 299
           NI T  N+  ++ +G F+    GL++ N   N A     N                 F +
Sbjct: 234 NI-TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLV 292

Query: 300 YELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 359
           +EL+++E+P+   E+  N  + ++L ++ FGWG++GIW+ Y+F F+LNLRNYSPL AG +
Sbjct: 293 FELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGST 352

Query: 360 YFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMI 419
           Y   VI G +  I    L+K+  P + L FS +GF    II SVTP+HQ+YFR+ LG+MI
Sbjct: 353 YLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMI 412

Query: 420 ILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGT 479
            L LG+D SFP+S+IIL + LP+++  M   L N + NY+ S + GI  +  +  + +  
Sbjct: 413 FLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALR--SLSSI 470

Query: 480 DLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 518
           +L++ YR   YF I  S + +  AG+ +       Y+ +
Sbjct: 471 ELIKYYRYVYYFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/470 (36%), Positives = 272/470 (57%), Gaps = 17/470 (3%)

Query: 27  DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQL 86
           ++++E  S+ L+NS     ++ +   + +A +  C  +QL+  AG  Q++  + ++    
Sbjct: 7   NSHEEQDSLLLQNSR----EWTSLLKEGFAIMVLCS-AQLMTQAGLAQSIVPLQIIGDSF 61

Query: 87  HSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH 145
              +  ++ W  ++F L  G+FIL++GRLGD +G KK  ++G++   +WS++ G S YS+
Sbjct: 62  GIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN 121

Query: 146 SGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFS 205
             IFF   RAFQG+G +  LPN + +I   Y+PG  K+NM+ S+ GA +P G  +G +FS
Sbjct: 122 Q-IFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFS 179

Query: 206 GLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRL-----SMDWIGSFTGV 260
            L++  +   WPWA++   +  F+     Y  IP++ P + +        +D  GS TGV
Sbjct: 180 SLLSEFAW--WPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237

Query: 261 LGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQL 320
           +GLILFNF WNQ P  GW                  FG  E R A++PLLP   + +   
Sbjct: 238 VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSS-DT 295

Query: 321 IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKK 380
           I ++  +  GW SFGIW +Y +  + NLR+  PL +   +    ISG   A+S  FL+ +
Sbjct: 296 IFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTR 355

Query: 381 IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNL 440
             P+ ++  +M+ F +G I+ +  PV QTY+     ++I++P GMD+SFPA++IILS  +
Sbjct: 356 TSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAM 415

Query: 441 PNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALY 490
           P  HQG+A SLVNT+INYS S+ LG AGT+E   +    DLL+GYRGA Y
Sbjct: 416 PASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  212 bits (539), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 148/516 (28%), Positives = 249/516 (48%), Gaps = 22/516 (4%)

Query: 24  DCSDANDESPSMELKNSSLRNPDYF--NSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNV 81
           + SD N  +P+ E  +      +     S   E  F+     SQ+L LAG  Q +  M+V
Sbjct: 46  NVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDV 105

Query: 82  LT---RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138
           +    +  H SDS   W    +    GSF+L++G++GD+ G K M ++GY  L +WSL+T
Sbjct: 106 IVEWFKLTHPSDS--GWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLT 163

Query: 139 GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 198
           G S Y  S  FF   RA QG+G +    + L ++G  Y P   +KN + S  GA    G 
Sbjct: 164 GFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGV 222

Query: 199 TLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI---PTNVNRLSMDWIG 255
            LG +FS L    +   W WA+++  +A  +   +S + IP ++       N    D++G
Sbjct: 223 VLGMVFSALFTQLAH--WSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNVFYFDYLG 280

Query: 256 SFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEII 315
           +F  V GL+LF+  WNQAP  G+                    +Y     ++PLLP   I
Sbjct: 281 AFLFVTGLVLFSVAWNQAPTYGFG-RTYVYVLLIVSVVILALAMYVETKVDDPLLPWTHI 339

Query: 316 RNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCG 375
               L  +L A+ F + SF +W  Y F F L  +  + L A        +SG   A+   
Sbjct: 340 SANTL-KVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSA 398

Query: 376 FLMK-KIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSI 434
            L+   ++  + +  S++ F +  I+ +     QTY+  +  T I++  G+D+SFP++++
Sbjct: 399 LLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATL 458

Query: 435 ILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH-C----NKNGTDLLRGYRGAL 489
           +LS+ +P++ +G+  SLV  V+NY+ +L    A +V ++ C       G    +      
Sbjct: 459 LLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIG 518

Query: 490 YFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCEN 525
           Y GI  +G+  L+A ++ V T +     +K +D ++
Sbjct: 519 YVGIGTAGLGTLVA-IFGVITEYPKVAGKKGEDRKH 553

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  197 bits (501), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 158/534 (29%), Positives = 261/534 (48%), Gaps = 30/534 (5%)

Query: 12  VSSYIAEETIRSDCSDANDESPSMELK-----NSSLRNPDYFNSTTQEYAFIFSCMLS-- 64
           +S + +EET+ S  S      P+  +K     N  L   D      Q    I   ++S  
Sbjct: 1   MSFHESEETLTS--SKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSG 58

Query: 65  QLLNLAGTTQTLSIMNVL--TRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLK 121
           Q ++L G  Q +  M  +  T  L    +L++ W  A++   + +F++++G+LGDI G K
Sbjct: 59  QFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHK 118

Query: 122 KMLILGYVILVIWSLITGLSGYSHS-GIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT 180
            M I GY  L +WSL+TG S Y+ +  +FF   R  QG+G + + P  L L+G  Y P  
Sbjct: 119 NMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCK 178

Query: 181 LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPN 240
            +KN V S  GA  P G   G +FS L    +  +W W +++  +   I T +SY  IP 
Sbjct: 179 -RKNYVFSFYGACGPFGIVAGSVFSALFTQLT--TWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 241 NIPTNVNR---LSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXF 297
           +      R    S D++G F G+ G+ILF+ VWNQAP   +                   
Sbjct: 236 DNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMA 295

Query: 298 GIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAG 357
            I + R  ++PL+P + + +  +I  L  + FG+  F IW FY + F L  +N S L A 
Sbjct: 296 LIIDSR-VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAA 353

Query: 358 GSYFIFVISGTITAISCGFLMKKIRPAVL-LTFSMVGFNLGCIIFSVTPVHQTYFRNILG 416
             +    ISG   A     L+ K  P  L L  ++  F +  I+ S   + +TY+ N   
Sbjct: 354 AKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFV 413

Query: 417 TMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAG-TVEQHCN 475
             +I+ +G+D++FP+++++LS+ + N+ QG+A +L  T +NY  +L  G+A   +   C+
Sbjct: 414 ATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCD 473

Query: 476 ----KNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCEN 525
               ++    +     A Y  I  +G+AV++A   +  +I + YK+R +   E 
Sbjct: 474 DCLARSDGRFVHAVHIAGYVAIGTAGIAVVVA---IFGSITEYYKERMDDLREK 524

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  187 bits (476), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 153/544 (28%), Positives = 259/544 (47%), Gaps = 31/544 (5%)

Query: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 61
           +TD    +   +S +  +  +  CS+        +L++    NP    S  +E  FI   
Sbjct: 22  NTDHYLPSNSTASSLHSQRTKEQCSNLQPAQAQDQLES---MNPPPGPSRLRECMFIVII 78

Query: 62  MLSQLLNLAGTTQTLSIMNVLTR--QLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIY 118
             SQ ++LA  +Q +  M+ +T   QL +  SL+  W  A+F +  G+FI+ +G+L D+ 
Sbjct: 79  ASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLI 138

Query: 119 GLKKMLILGYVILVIWSLITGLSGYSHSG--IFFIIARAFQGLGISLVLPNVLGLIGMIY 176
           G K + I GY    +WSL+ G+S Y+  G   FF   R  QG+G + + P+ L L+G  Y
Sbjct: 139 GSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYY 198

Query: 177 KPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 236
            P + KKN+V S+ G   P+G  +GG+FS +    +   W W +++  + +   T IS +
Sbjct: 199 PP-SCKKNIVFSLYGFCVPLGVVVGGVFSAIFTQLAH--WSWNYWSMAIVSAFFTLISCF 255

Query: 237 SIPNN--IPTNVNRLSMDW--------IGSFTGVLGLILFNFVWNQAPADGWNXXXXXXX 286
            IP +  I +   +    W        +G+F  V  L+LF   WNQA    +        
Sbjct: 256 YIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVT 315

Query: 287 XXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 346
                       I E  Y ++P++P+  I + Q I  L  + F + SF IW FY + +  
Sbjct: 316 LIVSLVCFVAMVIVEF-YVDDPIIPARKI-HPQTIKALLVVFFSYLSFTIWLFYLWKYFT 373

Query: 347 NLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA-VLLTFSMVGFNLGCIIFSVTP 405
            +RN + L     +    I+G I A+    L+    P  + L      F L  I+F    
Sbjct: 374 VVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLS 433

Query: 406 VHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLG 465
             ++Y+     T+II+ +G+D+SFP+++++LS+ +P + +G++ +LV T +NY   +   
Sbjct: 434 RTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPP 493

Query: 466 IAGT-VEQHCNK-----NGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRK 519
           IA T +   C+K     +    ++    A   GI  SG+AV++ GLY   T +       
Sbjct: 494 IAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV-GLYGTVTEYSWETHSY 552

Query: 520 EKDC 523
            K C
Sbjct: 553 SKRC 556

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  183 bits (465), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 143/494 (28%), Positives = 243/494 (49%), Gaps = 25/494 (5%)

Query: 39  NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLH---SSDSLKVW 95
           ++S+R P    +  +E   +   + SQL+ L G  Q + I   L  +     +   L  W
Sbjct: 26  DTSIRLP---KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGW 82

Query: 96  LVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH-SGIFFIIAR 154
             AS+ L S   +L++G+LGD+ G K+M++ G++ L IWSLITG S Y   +  F+  AR
Sbjct: 83  ANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTAR 142

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
           A QG+G   ++PN L ++G  Y    LKK ++ SI G M+  G  +G  FS L A  ++ 
Sbjct: 143 ALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK- 201

Query: 215 SWPWAFYAYTLAAFINTFISYYSI-PNNIPTNVNRLSM----DWIGSFTGVLGLILFNFV 269
            W W ++A      + T  +   I P+NI    N   +    D++G+ TGV GL+LF+  
Sbjct: 202 -WAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVA 260

Query: 270 WNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIMILTAMTF 329
           + QA A GW+                     + R  ++PL+P + +R   +++IL  + F
Sbjct: 261 FTQASALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILICVYF 318

Query: 330 GWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF---IFVISGTITAISCGFLMKKIRPAVL 386
           G+ SF IW  +++ F   + N SPL          I  I   I  ++C  L   I+   +
Sbjct: 319 GFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTC--LQLNIKAPTM 376

Query: 387 LTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQG 446
           +  SMV F +  I+ +    + TY+     + II P  +D++ P ++++ SD++  + QG
Sbjct: 377 MVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQG 436

Query: 447 MAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR-GYRGALYFGIACSGVAVLIAGL 505
           +A SL+ TVI+Y+ S+       V  +    G D    G+  +L+    C    ++++G+
Sbjct: 437 IAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFIC---GIVLSGI 493

Query: 506 YMVETIFDSYKDRK 519
            +V  +     D K
Sbjct: 494 GLVTAVIAGLIDYK 507

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  160 bits (404), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 118/190 (62%), Gaps = 34/190 (17%)

Query: 62  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 121
           M+SQLLN  GTTQTL ++NVL+R   SS + +  LVAS PLVSGSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 122 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 181
             L+ GY  +++WS I GL+ Y+ S  FF+IARAFQGLG++ VLPNV+G +  +Y  G++
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 182 KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 241
           +KNMV                                  YAYT+A  +N  +  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 242 IPTNVNRLSM 251
           IPTNV   +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 439 NLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLL 482
           N+P   +G A      ++ YS  + LGIAGTVE   +K G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  169 bits (429), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 147/572 (25%), Positives = 262/572 (45%), Gaps = 76/572 (13%)

Query: 19  ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78
           ET++   S     S  + L+   L++P   NS   +  FIF    SQ + LA  +Q +  
Sbjct: 40  ETVQDQQSHKVTHSSLIRLQK--LQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQ 95

Query: 79  MNVLTR--QLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 135
           M+ L+   ++  + +L++ W+ ASF +  G+FI+++G+L DI   + + I GYV   +W+
Sbjct: 96  MDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWT 155

Query: 136 LITGLSGY-SHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY------------------ 176
           LITG + Y   + IF  I R  QG+G +L+ P+ L L+   Y                  
Sbjct: 156 LITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTS 215

Query: 177 --KPG--------------------------TLKKNMVISIVGAMSPIGATLGGLFSGLV 208
              P                              K++  S+ GA +P+G  +GG+FS + 
Sbjct: 216 APSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF 275

Query: 209 ATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP-----TNVNRL----SMDWIGSFTG 259
                 +WPW +++ ++   + + +SY+ +   IP     +N N L    + D++G   G
Sbjct: 276 T--QLATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 260 VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQ 319
           +  LILF   W+QA    +                    I+E  Y  NP++P   I    
Sbjct: 334 ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWE-YYFNNPIIPIRQIHPGT 392

Query: 320 LIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA-ISCGFLM 378
           +  +L    F + SF  W FY +     +++ SP+     +    ++G I+A  S   ++
Sbjct: 393 IKALLVVF-FSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIV 451

Query: 379 KKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSD 438
           K++   + L      F L  I+     +  +Y+     ++I + +G+D+SFP+++++L++
Sbjct: 452 KRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTN 511

Query: 439 NLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH----CNKNGTD---LLRGYRGALYF 491
            +P + QG+  +LV +V+NY  ++   IA T+ Q+    C  +  D    L+G   A   
Sbjct: 512 GIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAV 571

Query: 492 GIACSGVAVLIAGLYMVETIFDSYKDRKEKDC 523
           G+ CSG+AVLI G+Y   T +        K C
Sbjct: 572 GVGCSGIAVLI-GIYGTITEYSWKTKGFSKKC 602

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 108/515 (20%), Positives = 192/515 (37%), Gaps = 51/515 (9%)

Query: 28  ANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLH 87
           AN      E++N   ++P   N        IF      LLN+A     +S+++ L ++ +
Sbjct: 7   ANLTKALQEIRNKCQKSPYQLNVNV---GLIFLGCTFDLLNVA---SMISLIDDLAKKYN 60

Query: 88  SSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 147
            S +   W + S+ +    FI   GRLGDI G   +  +      I SL+  +     + 
Sbjct: 61  ISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFPA- 119

Query: 148 IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL--GGLFS 205
             F + RA QG+  + ++P    LI ++     ++K   I   G  S IG  L  GG F+
Sbjct: 120 --FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFA 177

Query: 206 GLVATESEGSWPWAFYAYTLAAFINTFISYY-----SIPNNIPTNVNRLSMDWIGSFTGV 260
                   G +   F   +L + I  F +Y        P  I    +  S+D+IGS   V
Sbjct: 178 A-TKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFV 236

Query: 261 LGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAE-------------- 306
            G IL      +   + WN                 F ++   YA+              
Sbjct: 237 AGSILIVVGLTEG-GESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSK 295

Query: 307 -----NPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 361
                  L+P +++  +  I I+ A            +    +       SPL AG    
Sbjct: 296 YFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLV 355

Query: 362 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLG----CIIFSVTPVHQTYFRNI-LG 416
             +I   +    C F   K++P V +    +GF+L      I+  +  +    F  I   
Sbjct: 356 PLIICMVVGNALCAFESTKLKPRVGVA---LGFSLALAGSIILIQLHLIKDNVFWKIFFS 412

Query: 417 TMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLGIAGTVEQ 472
           +  ++  G+ + +P +  I     P+Q +G+A  +  T     I  + S+   + G + +
Sbjct: 413 SQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINE 472

Query: 473 HCNKNGT--DLLRGYRGALYFGIACSGVAVLIAGL 505
              K     +   G++   YF +A   +  L+  +
Sbjct: 473 MKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAI 507

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 117/500 (23%), Positives = 198/500 (39%), Gaps = 80/500 (16%)

Query: 56  AFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLG 115
           A IF      LLN+A     +S+++ L ++   S +   W + S+ +    FI   GRLG
Sbjct: 32  ALIFLGCTFDLLNVA---SMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLG 88

Query: 116 DIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMI 175
           DI G   +  +      I SL+  +     +   F + RA QG+  + ++P    LI M+
Sbjct: 89  DIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPML 145

Query: 176 YKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISY 235
                ++K   I   G  S IG  LG +  G  A    G +   FY      F+ + +++
Sbjct: 146 APEEEVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKIG-YKGIFYLTFAVMFLISIVAF 202

Query: 236 Y--------SIPNNIPTNVNRL-SMDWIGSFTGVLGLILF-------NFVWNQAPAD--- 276
           +        S P       NR+ S+D+IGS   V G IL           WN+ PA    
Sbjct: 203 FFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNR-PATYVT 261

Query: 277 ------------GWNXXXXXXXXXXXXXXXXXFGIYELRYAENP--LLPSEIIRNRQLIM 322
                        WN                  GI   RY E    L+P +++  +  I 
Sbjct: 262 LVIGIILFFGFFFWNCSYARIVRGIRCC-----GIDTSRYFEKVQLLIPVDVLFMKNFIP 316

Query: 323 ILTAMTFGWGSFGIWTFYYFSFVLNLRNY-------SPLWAGGSYFIFVISGTITAISCG 375
           I+ A       F +     FS +  +  Y       SPL+AG      +I   I    C 
Sbjct: 317 IVLA-------FALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCA 369

Query: 376 FLMKKIRPAVLLTFSMVGFNL---GCIIFSVTPVH----QTYFRNILGTMIILPLGMDLS 428
           F   K++P V +   ++GF+L   G II  +T +H      +++    +  ++  G+ + 
Sbjct: 370 FESTKLKPKVGV---VLGFSLALAGSII--LTQLHLIKEDMFWKIFFSSQALVGFGVAIF 424

Query: 429 FPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLGIAGTVEQHCNKNGT--DLL 482
           +P +  I     P++ +G+A  +  T     I  + S+   + G ++    K+G      
Sbjct: 425 YPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFR 484

Query: 483 RGYRGALYFGIACSGVAVLI 502
            G++   YF +A   +  L+
Sbjct: 485 TGFQNCTYFTVAVGALGFLV 504

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 111/521 (21%), Positives = 209/521 (40%), Gaps = 51/521 (9%)

Query: 38  KNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLV 97
           K+ +      F+  T ++      +++  L+LA     + ++  +  + + S +   W +
Sbjct: 5   KSVTFPKGSLFHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWAL 64

Query: 98  ASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQ 157
            S+ +    FI   GR+GDI G   M+ +  VI  I+SL   L     + I F + RAFQ
Sbjct: 65  TSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSL---LCAVVPNFIAFTVFRAFQ 121

Query: 158 GLGISLVLPNVLGLIGMIYKPGTLKKNMVI--SIVGAMSPIGATLGGLFSGLVATESEGS 215
           G+  + ++P    L+  +++   L++   I  S++ AM+ +G  +GG F G  A   +  
Sbjct: 122 GMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAF-GETALGYKSF 180

Query: 216 WPWAFYA-YTLAAFINTFISYYSIPNNIPTNVNRL----SMDWIGSFTGVLGLILFNFVW 270
           + + F A    AA I   I Y  +  N  +   +      +D IG    + G IL     
Sbjct: 181 FYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGL 240

Query: 271 NQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA--------------------ENPLL 310
            Q   + WN                 F ++ L YA                     N L+
Sbjct: 241 TQG-GESWNDPTAYVPLAVSIVLLIIFFMWNLGYAVVLKLIKPISTHKGYAYMESVNLLI 299

Query: 311 PSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF------V 364
           P  ++ +   I +L A  F +  F +  +        + NYS    G S  +       +
Sbjct: 300 PKNLMFSHNFIPVLLATFFLFCGFMVVMYV-------IANYSATVEGNSMIVASIKIIPM 352

Query: 365 ISGTITAI-SCGFLMKKIRPA-VLLTFSMVGFNLGCIIFSVTPVHQTYFRNI--LGTMII 420
           ISG + A  +  +     +P   L+  S +    G     +  V    F  +  +G    
Sbjct: 353 ISGLVLANGTVAYKQDLFKPKNALVVGSFISILGGAFFVPIKYVDDNLFWKLFFMGGFFT 412

Query: 421 LPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTD 480
             LG    F     +   + P+Q++ +AG +V T   + N + L I  ++  +   +  D
Sbjct: 413 -GLGGAFFFCYMITMAIGDAPDQYKALAGGIVQTSGQFGNEVSLSIVISLLGNQTTDKAD 471

Query: 481 LLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEK 521
           L   ++ A Y  I  + ++ L++ L++V+   +S  D +++
Sbjct: 472 LRDRFQNASYIVITAATISTLVS-LFLVKGPLESSGDEEKQ 511

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 103/479 (21%), Positives = 179/479 (37%), Gaps = 50/479 (10%)

Query: 65  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 124
            LLN+A     +S+++ L +  + S +   W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184
            +      + SL+  +     +   F + RA QG+  + ++P    LI ++     ++K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 185 MVISIVGAMSPIGATLGGLFSGLVATES---EGSWPWAFYAYTLAAFINTFISY-----Y 236
             I   G  S IG  LG +  G  AT      G +   F   TL + I  F +Y      
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLN 212

Query: 237 SIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXX 296
             P     + +  S+D+IGS   V G IL      +   + WN                 
Sbjct: 213 KKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEG-GESWNRPVTYVTLVIGIILFFG 271

Query: 297 FGIYELRYAE-------------------NPLLPSEIIRNRQLIMILTAMTFGWGSFGIW 337
           F ++   Y +                     L+P +++  +  I I+ A           
Sbjct: 272 FFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFSC 331

Query: 338 TFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLG 397
            +    +       SPL AG      +I   I    C F   K+RP V +    +GF L 
Sbjct: 332 LYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVA---IGFFLA 388

Query: 398 ----CIIFSVTPVHQTYFRNI-LGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLV 452
                I+  +  V +  F  I      ++  G+ + +P +  I     P++ +G+A  + 
Sbjct: 389 LAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVA 448

Query: 453 NTV----INYSNSLFLGIAGTVEQHCNK-NGTDLLR-GYRGALYFGIACSGVAVLIAGL 505
            T     I  + S+   + G + +   K N     R G++   YF +A   +  L+  +
Sbjct: 449 QTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTAI 507

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 112/522 (21%), Positives = 198/522 (37%), Gaps = 64/522 (12%)

Query: 39  NSSLRNPDYFNSTTQEYAF-----IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLK 93
           N+ ++  D   S  Q  +F     +   M+S   +L   T  LS    +        +  
Sbjct: 3   NTIIKTRDSIRSNFQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTA 62

Query: 94  VWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIA 153
            W + ++ +    FI   GR+GDI G   + +    +  I SLI  +     +   F + 
Sbjct: 63  SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVF 119

Query: 154 RAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP--IGATLGGLFSGLVATE 211
           RA QG+  + ++P+   LI  +     ++    I   G  +   IG  +GG F     T 
Sbjct: 120 RALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAF-----TL 174

Query: 212 SEGSWPWAFYAYTLAAFINTFISYYSI---PNNIPTNVNR---------LSMDWIGSFTG 259
           +   +   FY       + + ISY+SI    N  P   +          LS+D+IGSF  
Sbjct: 175 TRIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMF 234

Query: 260 VLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRY---------AENP-- 308
           +   IL   V      + W                  F I+ + Y         A NP  
Sbjct: 235 ISSTILI-VVGLTEGGESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKV 293

Query: 309 ---------LLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGS 359
                    L+P +++  +  I I  A+   +G      +    +   +   SPL A   
Sbjct: 294 YNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVK 353

Query: 360 YFIFVISGTITAISCGFLMKKIRP--AVLLTFSMVGFNLGCIIFSVTPVH----QTYFRN 413
               V+S  I  +        I P  AV+L F ++   +G II  +  +H      Y++ 
Sbjct: 354 LLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIM--FIGSII--LIQLHLITDNLYWKI 409

Query: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLGIAGT 469
              +  ++  G  + FP S  IL    P++++G+A  ++ T     +  + S+   I G 
Sbjct: 410 FFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGN 469

Query: 470 VEQHCNKNGTDLLRGYR--GALYFGIACSGVAVLIAGLYMVE 509
           + +   K+G+  +   R     YF +A S V ++    ++ E
Sbjct: 470 INELSGKSGSAGIYKTRFQNCTYFTLASSVVGLISTAFFVKE 511

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 89/378 (23%), Positives = 158/378 (41%), Gaps = 43/378 (11%)

Query: 23  SDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVL 82
           +D    ++E  S +   SS   PD      +      S  L   L  A  T   +IM  +
Sbjct: 53  TDYGSIDNEDDSRDGVASSPVPPD------KLLVITLSMYLGIFLAAADGTLVSTIMAHI 106

Query: 83  TRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSG 142
             + +    +  W+  ++ L S +F  + G+L DI+G K +L+L  ++ ++  L+ GL+ 
Sbjct: 107 ASEFNELPRIS-WIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP 165

Query: 143 YSHSGIFFIIARAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 195
            S  G+  + AR   G+G        S+ + +++ L     +   L + M     G  + 
Sbjct: 166 -SFWGL--VGARFISGIGGGGVTSMCSITISDIVPL-----RDRALYQGMCNFFFGLGTA 217

Query: 196 IGATLGGLFSGLVATESEGSWPWAFY-AYTLAAFINTFIS-YYSIPN-----NIPTNVNR 248
            G  +GG FS     +  G W  AF     L+A  +  I+ +  +P      N P ++  
Sbjct: 218 CGGVVGGWFS-----DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKN 272

Query: 249 --LSMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYA 305
             LS+DWIG+   V+ L LF    +    +  +N                 F   EL  A
Sbjct: 273 KLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGA 332

Query: 306 ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFI 362
           ++P+LP   +RNR ++    +  F   +    ++Y   Y+S VLN+   +P   G     
Sbjct: 333 KDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---NPTRVGKRLMP 389

Query: 363 FVISGTITAISCGFLMKK 380
              S  + ++  G+ MK+
Sbjct: 390 NFFSTALGSLGAGYYMKR 407

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 98/487 (20%), Positives = 187/487 (38%), Gaps = 57/487 (11%)

Query: 59  FSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIY 118
           F C    LLN+AG    +  +    +  ++  S   W + S+ +    FI   GRLGDI 
Sbjct: 35  FGCTF-DLLNVAGVISVIEDLGETYKLGYTGAS---WALTSYAITFAGFIAFMGRLGDIV 90

Query: 119 GLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKP 178
           G   +  +   +  ++SL+  +     +   F + RA QG+  + ++P    LI ++ +P
Sbjct: 91  GNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQGISAAGIVPCGYALIPLLAEP 147

Query: 179 GTLKKNMVISIVGAMSPIGATL--GGLF-------SGLVATESEG----SWPWAFYAYTL 225
             ++K   I   G  S IG  L  GG F       +G+      G    S   +FY Y +
Sbjct: 148 QDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRI 207

Query: 226 AAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNXXXXXX 285
                  +    IP++ P      S+D++GS   V G +L      +   + W       
Sbjct: 208 EERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVSGSVLIVAGLTEG-GESWRRPVAYV 263

Query: 286 XXXXXXXXXXXFGIYELRYAE-------------------NPLLPSEIIRNRQLIMILTA 326
                      F I+   Y +                     L+P +++     I I+  
Sbjct: 264 PFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPII-- 321

Query: 327 MTFGWGSFGIWTFYYF--SFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA 384
           ++F   +  +++  Y    +   +   SPL AG      ++S  I   +C     ++RP 
Sbjct: 322 LSFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPK 381

Query: 385 VLLTFSMVGFNLGCIIFSV--TPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPN 442
           V +    +    G II     T  +  +++    + I + LG  + +P +  ++    P+
Sbjct: 382 VGVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPD 441

Query: 443 QHQGMAGSLVNTVINYSNSL-------FLGIAGTVEQHCNKNGTDLLRGYRGALYFGIAC 495
             +G+A  +  T   +   +        LG    V++  N   T   R ++   YF +A 
Sbjct: 442 GAKGIASGMTQTFAQFGVEVTFSVMVSVLGNITDVKETLNSQETFKDR-FQNCAYFSVAV 500

Query: 496 SGVAVLI 502
           + + +++
Sbjct: 501 AALGLIL 507

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 91/395 (23%), Positives = 165/395 (41%), Gaps = 34/395 (8%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+  S+ L S +F  + G++ DI+G K +L+   V  +I  L+ GL   S S  + +IAR
Sbjct: 150 WIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLVIAR 206

Query: 155 AFQGLG----ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 210
              G+G     S+    +  L+ +       ++ M   I      +G   GG+  G   +
Sbjct: 207 FVAGVGGGGLTSMSSITITDLVPL------RERAMYQGICNVFYGLGTACGGIVGGWF-S 259

Query: 211 ESEGSWPWAFYAYTLAAFIN--TFISYYSIPNNIPT-----NVNR--LSMDWIGSFTGVL 261
           +++G W  AF      + I+    I +  +P+   T     ++ R  L++DW+G+ T V+
Sbjct: 260 DNKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLVI 319

Query: 262 GLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQL 320
            L+LF    +    +  +                  F   ELR A +P+LP   +  R +
Sbjct: 320 FLVLFLLTASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSV 379

Query: 321 IMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377
           +    +  F   +    ++Y   YFS VLN+   SP   G        S    ++  G+ 
Sbjct: 380 LGSSLSNWFCMMATMTTSYYLPIYFSGVLNM---SPTDVGKRLMPNFFSVAFGSLGAGYY 436

Query: 378 MKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 435
           MKK R      L F  V       I  + P   T+ + IL  +++  +G  +    + + 
Sbjct: 437 MKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQYIL--LLVPGVGTSVLITVALLA 494

Query: 436 LSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470
           +   +P++HQ    S+     +   +L + I G +
Sbjct: 495 MIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 91/407 (22%), Positives = 167/407 (41%), Gaps = 38/407 (9%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+  ++ L S +F  + G++ DI+G K +LI   +   + SLI GLS        +++A 
Sbjct: 160 WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS----PSFEWLVAG 215

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
            F        + ++  +      P    + +   I      +G  LGG+  G  +  S G
Sbjct: 216 RFIAGIGGGGITSMSSITTSDIVP-LRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVG 274

Query: 215 SWPWAFYAYTLAAFINT--FISYYSIP------------NNIPTNVNRLS-MDWIGSFTG 259
            W  +F      AF +T   I +  +P            N   T   RLS +DWIG+ T 
Sbjct: 275 -WRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATT- 332

Query: 260 VLGLILFNFVWNQAPADG---WNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIR 316
            L L LF+F+   +       +                  FG  EL+ A++P+LP   ++
Sbjct: 333 -LVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLK 391

Query: 317 NRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAIS 373
           +R ++    +  F   +    ++Y   YF+ VLN++   P   G        S    ++ 
Sbjct: 392 DRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRIIPNFFSTAFGSLG 448

Query: 374 CGFLMKKIRPA--VLLTFSMVGFNLGCI-IFSVTPVHQTYFRNILGTMIILPLGMDLSFP 430
            G+ MKK       +++F ++  ++GC+ I  + P    + +  L  M I  LG  +   
Sbjct: 449 AGYYMKKTGKYYWFVISFCVLA-SIGCLQIVWIQPDISVFKQYTL--MFIPGLGASVLIT 505

Query: 431 ASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKN 477
            + + +   +P+ HQ +  S+     +   +L + I G + +    N
Sbjct: 506 VALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDN 552

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 87/401 (21%), Positives = 156/401 (38%), Gaps = 46/401 (11%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+  ++ L S +F  + G+L DI+G + +L+   ++  + +LI G+   S +    ++ R
Sbjct: 179 WIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGM---SKNLWVLVLGR 235

Query: 155 AFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 207
              G+G        S+   +++ L           + +   I      +G   GGL  GL
Sbjct: 236 FVAGIGGGGLTSMCSITTTDIVPL---------RSRALYQGICNVFFGLGTACGGLVGGL 286

Query: 208 VATESEGSWPWAFYAYTLAAFINT--FISYYSIPN-----------NIPTNVNRLSMDWI 254
            A  + G W  AF        ++T     + ++P            +IP       +DW 
Sbjct: 287 FADRAVG-WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWT 345

Query: 255 GSFTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEI 314
           G+ T V+ L  F  V +     G +                 F  +EL  A +P+LP   
Sbjct: 346 GTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRF 402

Query: 315 IRNRQLIMILTAMTF---GWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 371
           + NR ++    +  F   G  + G +   Y++ VLN+    P   G        S    +
Sbjct: 403 LENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPTDIGKRIVPSFFSTAFGS 459

Query: 372 ISCGFLMKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSF 429
           +  G+ MK+       LL F +VG      I  VTP   T+ +  L   +I   G  +  
Sbjct: 460 LGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCL--YMIPGFGSAVLL 517

Query: 430 PASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470
             + + L   +P +HQ    S+     +  ++L + I G +
Sbjct: 518 TVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAI 558

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 58  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 117
           ++S  +   L    +T   +IMN +  +   SD  K W+V SF L + +F  + G+L D+
Sbjct: 43  LYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDK-KQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 118 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
            G K  L++ +   ++  L T L   S + + F IARA  G+G
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTAL---SRNLVEFSIARAVCGMG 141

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 66/145 (45%), Gaps = 15/145 (10%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WLV  + L +  F+L+ GRL +I G K+ L++  ++  I SLI+ LS    + I   +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVA 106

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
            F G GI  +   V   I      G +   + IS V A   +G  +GG F+         
Sbjct: 107 GFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIA-EGVGPFIGGAFN------EHL 159

Query: 215 SWPWAFY--------AYTLAAFINT 231
           SW W FY        A+ + AF NT
Sbjct: 160 SWRWCFYINLPIGAFAFIILAFCNT 184

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 93/451 (20%), Positives = 172/451 (38%), Gaps = 54/451 (11%)

Query: 27  DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQL 86
           D    S   +L       P++  S+++    + S  L   L     T   +++  +  + 
Sbjct: 54  DRTATSARCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEF 113

Query: 87  HSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHS 146
           +S D +  W+  S+ L S +   + G+L D  G K +L+   V+  I  LI G+S    S
Sbjct: 114 NSLDKVS-WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---S 169

Query: 147 GIFFIIARAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGAT 199
             + ++ R   G+G        S+V+ +++ L     +   + + +   I G  +  G  
Sbjct: 170 IWWVVVGRFVSGIGGCGLTCLASMVISDLVPL-----RERAVYQGLCNFIFGLGTASGGL 224

Query: 200 LGGLFSGLVATESEGSWPWAFYAYTLAAFINT--FISYYSIPNNIPTNVNR------LSM 251
           +G  F           W  AF      +  +    +SY  +P     + +R        +
Sbjct: 225 VGAAFQ---------DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDL 275

Query: 252 DWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLL 310
           DW G  T V  L LF  V +    +  ++                 F   EL  A +P+L
Sbjct: 276 DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVL 335

Query: 311 PSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISG 367
           P   ++ R ++    A  F   S     +Y   Y++ VLN++   P   G        S 
Sbjct: 336 PIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMK---PTDIGKRSIPSFFSV 392

Query: 368 TITAISCGFLMKKIRPA--VLLTFSMVGFNLGC----IIFSVTPVHQTYFRNILGTMIIL 421
              ++  G  MK+       LL F  +G  LG     ++   TPV Q Y       ++++
Sbjct: 393 AFGSLGAGIYMKRTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQQYL------LLVV 445

Query: 422 P-LGMDLSFPASSIILSDNLPNQHQGMAGSL 451
           P  G+ +    + + +   +P++H     S+
Sbjct: 446 PSFGLSVLITVTLLAMISAVPHEHHAATTSI 476

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 60/132 (45%), Gaps = 17/132 (12%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WLV  + L S  F L+ GR+  + GLK  L+L  +I  I SLI  +   S+S    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAV---SNSMGMLIAGR 138

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVA 209
              G G S       G+  ++Y  GT       + MVI ++   + +G+  GG   G   
Sbjct: 139 VVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVL-TFAFVGSNAGGPILGGAL 190

Query: 210 TESEGSWPWAFY 221
            E   SW W F+
Sbjct: 191 NE-HASWRWCFF 201

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 58/132 (43%), Gaps = 17/132 (12%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WLV  + L +  F L+ GRL  I GLK  L    VI  I SLI  +   S+S    I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGR 102

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVA 209
              G G S       G+  +++  GT       + MVI+++G    +   +G +  G  A
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGG--A 153

Query: 210 TESEGSWPWAFY 221
                SW W FY
Sbjct: 154 FTENVSWRWCFY 165

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 89/212 (41%), Gaps = 16/212 (7%)

Query: 14  SYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTT 73
           S + + + +  C+ A   +  +  +N  + + D        YA + S  L+  L+     
Sbjct: 2   SALEDNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDIL 61

Query: 74  QTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVI 133
              +I+  ++R  +   S   WLV  + L +    LV GR   I G K  ++L  +I  +
Sbjct: 62  IVSTIIETVSRDFNEY-SKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEV 120

Query: 134 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIV--- 190
            SL++ L   ++S    I  R   G+G S +      +I  +    +  + M IS++   
Sbjct: 121 GSLVSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERS--RGMAISVLSCS 175

Query: 191 -GAMSPIGATLGGLFSGLVATESEGSWPWAFY 221
               S +G  LGG F+  V      +W W FY
Sbjct: 176 FAVASIVGPFLGGAFTTHV------TWRWCFY 201

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 5/119 (4%)

Query: 38  KNSSLRNPDY-FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWL 96
           KNSSL    +  N    +   +FS  +   L     T   +IMN +  +   SD  K W+
Sbjct: 33  KNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDK-KQWI 91

Query: 97  VASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARA 155
             SF L + +F  + G+L DI G K  L++ +    +  L+T    ++ +   F IARA
Sbjct: 92  ATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLT---CFARNVTEFSIARA 147

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 64/145 (44%), Gaps = 15/145 (10%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WLV  + L +  F+L+ GRL +I G  + L++  +I  + SLI+ LS    + I   +  
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIA 106

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
            F G GI  +   V   I      GT+   +  S V A   +G  +GG F+         
Sbjct: 107 GFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVIA-EGVGPFIGGAFN------EHL 159

Query: 215 SWPWAFY--------AYTLAAFINT 231
           SW W FY        A  + AF NT
Sbjct: 160 SWRWCFYINLPIGAFALIILAFCNT 184

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 90/204 (44%), Gaps = 11/204 (5%)

Query: 50  STTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFIL 109
           S  Q++  +F  ++    +  G+      +  L ++ +  ++     V  + L  G    
Sbjct: 96  SYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPT 155

Query: 110 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           VSG L D++G + +++ G VI V+ S+  GL+     G+   + R  Q +GIS  +    
Sbjct: 156 VSGGLADVFGRRPIILGGMVIYVVASI--GLACAPSYGVICFL-RCIQSIGISPTIAISS 212

Query: 170 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWA--FYAYTLAA 227
           G++G      TLK     + VGA S +   LG  F  L+       W W   F+   + +
Sbjct: 213 GVVGDF----TLKHERG-TFVGATSGL-VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGS 266

Query: 228 FINTFISYYSIPNNIPTNVNRLSM 251
            +   ++ +++P    T V  LS+
Sbjct: 267 GVALIVAAFTLPETKRTIVGNLSI 290

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 48  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 107
           +N    ++  +FS  L   L+    T   +IMN +  +  S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAF 87

Query: 108 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
             + G+L DI G K  L+  +    I  L+T    ++ +   F IARA  G+G
Sbjct: 88  QPLYGKLSDITGRKSALLTAHFFFGIGCLLT---CFARNVTEFSIARAICGIG 137

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 84/192 (43%), Gaps = 20/192 (10%)

Query: 27  DANDESPSMELKNSSLRNPDYFNSTTQEY----------AFIFSCMLSQLLNLAGTTQTL 76
           D  DE+ S+    SS+ + +  N   ++Y            + S  L   L+   +T   
Sbjct: 2   DPLDETSSLLPIRSSIEDGEEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVA 61

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +IMN +  +   SD  K W+  SF L + +F  + G+L DI G K  ++  +     + L
Sbjct: 62  NIMNKVAEEFEESDK-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSH---FFFGL 117

Query: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS----IVGA 192
              L+ ++ +   F IARA  G+G   V  N +  I +     T ++ +       + G 
Sbjct: 118 GCFLTCFAQNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGL 175

Query: 193 MSPIGATLGGLF 204
              +GA LGGLF
Sbjct: 176 GQLLGAPLGGLF 187

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 95/224 (42%), Gaps = 17/224 (7%)

Query: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAF-IFS 60
           D +++K  +E      +E      SD    S    ++    + P      T+   F +++
Sbjct: 3   DLEVQKNTVE------DEAAYLQSSDEQGSSSHSVIEKPQQQQPQEQLEQTRPTGFTLYA 56

Query: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSS--DSLKV-WLVASFPLVSGSFILVSGRLGDI 117
           C++S +L++      + I++ +   +     D  K  W+ A + L S    L+ GR+  +
Sbjct: 57  CVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAV 116

Query: 118 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYK 177
            G K  ++   +I  + SL+  L   ++S    I  R   GLG S +      +I  + +
Sbjct: 117 CGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVE 173

Query: 178 PGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 221
               K+ ++I+ +G+   I + +G    G   T    +W W F+
Sbjct: 174 ES--KRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFW 213

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 78  IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 137
           IMN +  +   SD  K W+  SF L + +F  + G+L D+ G K  L++ Y  LVI  L+
Sbjct: 58  IMNRVAEEFSESDK-KQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 138 TGLSGYSHSGIFFIIARA 155
           T L   + +   F +ARA
Sbjct: 117 TCL---ARNVTEFAVARA 131

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 69  LAGTTQTL--SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLIL 126
           LA   +T+  +IMN +T +   S  ++ W+  SF L S  F  + G+L D+ G + +L+L
Sbjct: 59  LASMDRTIIANIMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVL 117

Query: 127 GYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
            Y + ++  L+T    Y+ +   F   RA  G+G
Sbjct: 118 AYSLFLLGCLVT---AYARNIWEFAFGRAICGIG 148

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 100/237 (42%), Gaps = 35/237 (14%)

Query: 7   KKNIEV----SSYIAEETIRSDCSDANDESPS-MELKNSSLRNPDYFNSTTQEYAF---- 57
           KKN E+     S+  E ++       N+ES +  E+ N   + P+ FNS   + A     
Sbjct: 13  KKNPEILVSIDSFGIEPSMEIASHGINEESGTDAEVSNHVEKKPN-FNSKYGKNAMGEDL 71

Query: 58  -----IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS---SDSLKVWLVASFPLVSGSFIL 109
                +++C  S  L +      + I++ +   +     + S   W+ A + L +    L
Sbjct: 72  PSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLAL 131

Query: 110 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           + GR+  I G K  ++   +I  I SLI   SG ++S    I  R   G+G S       
Sbjct: 132 LWGRIASIIGFKSCMLAAIIIFEIGSLI---SGVANSMNMLIGGRVIAGVGGS------- 181

Query: 170 GLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFY 221
           G+  + +  G+      ++ ++I+ + +   + + +G    G   T +  +W W FY
Sbjct: 182 GIQSLAFVIGSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHA--TWRWCFY 236

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 61/128 (47%), Gaps = 9/128 (7%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WLV  + L +  F+L+ GRL +I G  + L++  VI  I SLI+ LS    + I   +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIA 106

Query: 155 AFQGLGI-SLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESE 213
            F G GI SL       ++   Y+ G +   + +S V A   +G  +GG F+        
Sbjct: 107 GFGGSGIESLAFVVGTSIVQENYR-GIMITALAVSYVIA-EGVGPFIGGAFN------EH 158

Query: 214 GSWPWAFY 221
            SW W FY
Sbjct: 159 LSWRWCFY 166

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 112/258 (43%), Gaps = 18/258 (6%)

Query: 1   MDTDLKKKNI--EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFN--STTQEYA 56
           ++ D  KK +  + +S +    +R   SD+ D   S  + NS L     F   S  Q++ 
Sbjct: 29  LEGDNTKKLLPQDAASRVTTREMRESSSDSRDRVESSGV-NSKLPQGAPFTLLSHGQKWF 87

Query: 57  FIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGD 116
            +     +   +  G+      +  L ++ + S+ +    V  + +  G    +SG L D
Sbjct: 88  MVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLAD 147

Query: 117 IYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIY 176
           +YG + ++++G +I V  S+  GL+     G+  +  R  Q  GIS ++    G++G   
Sbjct: 148 VYGRRPVILMGMLIYVCASI--GLACSQSYGV-IVFLRCLQSAGISPIIAINSGVVGDF- 203

Query: 177 KPGTLKKNMVISIVGAMSPIGATL-GGLFSGLVATESEGSWPWA--FYAYTLAAFINTFI 233
              TLK     + VGA+S  G TL G  F  L+      ++ W   F+  T+       I
Sbjct: 204 ---TLKHERG-TFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMII 257

Query: 234 SYYSIPNNIPTNVNRLSM 251
           ++  +P    T V  LS+
Sbjct: 258 NFLILPETKRTLVGNLSI 275

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 12/147 (8%)

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +I++V+  Q   + S   WLV  + L +    L+ GR   I G +  LIL  +I    SL
Sbjct: 59  TIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLG--LIGMIYKPGTLKKNMVISIVGAMS 194
           I  L+   +  IF  +     G G+   L  V+G  ++G   +P      +VISI+    
Sbjct: 118 IAALASSMNMLIFGRVVAGVGGSGLQ-TLCFVIGCTMVGERSRP------LVISILSCAF 170

Query: 195 PIGATLGGLFSGLVATESEGSWPWAFY 221
            + A +G +  G   T    +W W FY
Sbjct: 171 AVAAIVGPIIGGAFTTHV--TWRWCFY 195

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 48  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 107
           +N    ++  +FS  L   L+   +T   +IMN +     S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAF 87

Query: 108 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
             + G+L DI G K  L++      +  L+T    ++ +   F IARA  G+G
Sbjct: 88  QPLYGKLSDITGRKSALLIAQFFFGLGCLLT---CFARNVTEFSIARAICGIG 137

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 15/174 (8%)

Query: 84  RQLHSS---DSLKVWL-VASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITG 139
           RQL      D  KV + V  + L  G    +SG L D++G + ++++G +I V+ S+  G
Sbjct: 115 RQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI--G 172

Query: 140 LSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGAT 199
           L+     G+  +  R  Q +GIS  +    G++G      TLK     + VGA S +   
Sbjct: 173 LACAPSYGV-IVFLRIIQSIGISPTIAISSGVVGDF----TLKHERG-TFVGATSGL-VL 225

Query: 200 LGGLFSGLVATESEGSWPWA--FYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 251
           LG  F  L+      +W W   F+  T+    +  I++  +P    T V  LS+
Sbjct: 226 LGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 48  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 107
           +N    ++  +FS  L   L+   +T   +IMN +  +  S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAF 87

Query: 108 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
             + G+L DI G K  L+       +  L+T    ++ +   F IARA  G+G
Sbjct: 88  QPLYGKLSDITGRKSALLTAQFFFGLGCLLT---CFARNVTEFSIARAICGIG 137

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 121/301 (40%), Gaps = 28/301 (9%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+  S+ L S  F  + G+L DI+G K +LI   +I     +I G+   S+S    +  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGR 492

Query: 155 AFQGLG----ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 210
              G+G     S+    V  ++ +  +   + + +     G  +  G  +GG+F      
Sbjct: 493 FVAGIGGGGITSMTTITVSDIVPL--RSRAVYQGICNFFFGLGTAFGGVIGGIF-----V 545

Query: 211 ESEGSWPWAFYAYTLAAFINTFI--SYYSIP--NNIPTNVNR--LSMDWIGSFTGVLGLI 264
           + +  W   F++    + ++T +  S+  +P   N   ++ R  + +DW+GS + +L L 
Sbjct: 546 DHQYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGSISMILWLT 605

Query: 265 LFNFVWNQAPADGWNXXXXXXX--XXXXXXXXXXFGIYELRYAENPLLPSEIIRNRQLIM 322
            F  +         +                   F + EL  A +P+LP   + NR ++ 
Sbjct: 606 SFLLITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLG 665

Query: 323 ILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMK 379
                 F    F    FY   YF+ VL++   SP   G       +   + ++  G  MK
Sbjct: 666 ASLGNFFCVMGFMTICFYLPIYFASVLDI---SPTGIGKRMAPNFLCTALGSLGAGVYMK 722

Query: 380 K 380
           +
Sbjct: 723 Q 723

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 100/239 (41%), Gaps = 15/239 (6%)

Query: 16  IAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 75
           + ++   S+CS  +DE     +       P    +  Q++  +F   ++   +  G+   
Sbjct: 53  LGDDDTSSECS--HDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIY 110

Query: 76  LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 135
              +  L ++ +  ++     V  + L  G    +SG L D+YG + +++ G +I V+ S
Sbjct: 111 YPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVAS 170

Query: 136 LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 195
           +  G++     G+  +  R  Q +GIS  +    G++       T+K+    + VGA S 
Sbjct: 171 I--GIAKAPSYGV-IVFLRCIQSIGISPTIAISSGVVSDF----TVKRERG-TFVGATSG 222

Query: 196 ---IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 251
              IG  +G L   ++       W   F+  T+       I ++ +P    T V  LS+
Sbjct: 223 LVLIGQGIGPLLGAVITAALH--WRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 60/132 (45%), Gaps = 17/132 (12%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WL+A + L +  F+L+ GR+  + GLK  L+   VI    SL   ++G ++S    I AR
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSL---MAGAANSMGMLIGAR 102

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGAMSPIGATLGGLFSGLVA 209
              G G S       G+  ++Y  GT       +  VI+++G    +    G    G +A
Sbjct: 103 VISGFGGS-------GIESLVYGVGTSIVEEKHRARVITVLGIAYMLAEGAGPFVGGGLA 155

Query: 210 TESEGSWPWAFY 221
                SW W FY
Sbjct: 156 EHV--SWRWCFY 165

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 94/231 (40%), Gaps = 31/231 (13%)

Query: 1   MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60
           + +   K+  E     A +   +  S  +DE+    +   +++     +  +  Y  + +
Sbjct: 10  LHSKEAKQQHEQKRQFAVDQKFAHTSSEHDET---SIPEDNVKKNVELSKGSILYVSLVA 66

Query: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGL 120
             LS  L         +I+  + +QL S   +  WL   + L +   +L+ GR+    G 
Sbjct: 67  VALSLFLAALDVMIVSTIIEEVAKQLGSYSEIG-WLFTGYSLPNALLVLIWGRIATPIGF 125

Query: 121 KKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG------ISLVLPNVLGLIGM 174
           K  ++   VI  I SLI+ L+    S    I  R   G+G      +S V+ + L     
Sbjct: 126 KATMLFAIVIFEIGSLISALAS---SMNMLIGGRVIAGIGGCGIQSLSFVIGSTL----- 177

Query: 175 IYKPGTLKKNMVISIVGA----MSPIGATLGGLFSGLVATESEGSWPWAFY 221
                  K+ M+I+I+ +     S +G  LGG+F+  V      +W W FY
Sbjct: 178 ---VEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSV------TWRWCFY 219

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 48  FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSF 107
           +N    ++  +FS  L   L+   +T   +IMN +  +  S  S K W+  SF L + +F
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAF 87

Query: 108 ILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
             + G+L DI G +  L+       +  L+T    ++ +   F IARA  G+G
Sbjct: 88  QPLYGKLSDIIGRRPALLTAQFFFGLGCLMT---CFARNVTEFSIARAVCGIG 137

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 4/131 (3%)

Query: 30  DESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 89
           +E P  E + S  +     N +  +   + S  L    +   +T   +IMN +  +   S
Sbjct: 18  EEVPEGEYEISLEKKYHEHNLSLPKVPILSSLWLGSFFSSLDSTIVANIMNRVAEEFAES 77

Query: 90  DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 149
           D  K W+  SF L + +F  + G+L DI G K  ++  +    +  L+T    ++ +   
Sbjct: 78  DK-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLT---CFAQNVTQ 133

Query: 150 FIIARAFQGLG 160
           F IARA  G+G
Sbjct: 134 FSIARAICGMG 144

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 105/473 (22%), Positives = 187/473 (39%), Gaps = 65/473 (13%)

Query: 31  ESPSMELKNSSLRNPDYFNSTTQE-YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 89
           E+ S+E KN++  +P          Y  IF   L+ L N   +T    I +      H S
Sbjct: 111 ETSSIEAKNNTGLSPARIKIIMGSMYLGIF---LASLDNTIVSTLLAHIASEFNEMPHIS 167

Query: 90  DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 149
                W+  ++ L S +F  + G++ DI+G K +LI   V+  +  LI GLS     G++
Sbjct: 168 -----WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS----PGLW 218

Query: 150 FIIA-RAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 201
            ++A R   G+G        S+   +++ L     +   L + +     G  +  G  +G
Sbjct: 219 CLVAGRFIAGIGGGGLTSMSSITTSDIVPL-----RNRALYQGICNFFFGLGTACGGLVG 273

Query: 202 GLFSGLVATESEGSWPWAFYAYTLAAFINT--FISYYSIP-------------NNIPTNV 246
           G FS     E  G W  AF        I+    ++Y  +P             N I   +
Sbjct: 274 GWFS-----EHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKL 328

Query: 247 NRLSMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYELRYA 305
            R+  DW G+ + V+ L+LF    +    +  +                  F   E   +
Sbjct: 329 RRI--DWFGALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVS 386

Query: 306 ENPLLPSEIIRNRQLIMILTAMTFGWGS-FGIWTFYYF-----SFVLNLRNYSPLWAGGS 359
           ++P+LP   ++NR    IL +    W S  G+ T  YF     + VLN++   P   G  
Sbjct: 387 KDPILPVAFLKNR---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK---PTDMGKR 440

Query: 360 YFIFVISGTITAISCGFLMKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGT 417
                 S  + ++  G+ MKK      +L+ F  +       I  + P    + + IL  
Sbjct: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYIL-- 498

Query: 418 MIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470
           ++I   G+ +    + + +   +P++HQ    S+     +   +L + I G +
Sbjct: 499 LVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 30  DESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 89
           +++P    +++  +     N +  +   + S  L   L+    T   +IMN +  +   S
Sbjct: 12  EQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQES 71

Query: 90  DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 149
           D  K W+  S+ L + +F  + G+L D+ G K  ++  +    +  L+T    +++S   
Sbjct: 72  DK-KQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLT---CFANSVTQ 127

Query: 150 FIIARAFQGLG 160
           F IARA  G+G
Sbjct: 128 FAIARAICGVG 138

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 76  LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 135
           ++I+N +  + ++   +  WL+  + L +  F L+ GR   I+G K  L++  +I  I S
Sbjct: 41  VTILNTIADKFNAYSKIG-WLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 136 LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 195
           L+  +   S+S    I  R   G G S +   V  +   +    T  +  +++++     
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYA 154

Query: 196 IGATLGGLFSGLVATESEGSWPWAFY 221
           + + LG    G  A     +W W FY
Sbjct: 155 VASALGPYIGG--ALTEYVTWRWCFY 178

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 67  LNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLIL 126
           ++L   +  +S+++ L+ +   S +   W + S+ +    FI   GRLGDI G  ++  +
Sbjct: 40  IDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTV 99

Query: 127 GYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
                 I SL+ GL     +   F + RA QG+ 
Sbjct: 100 SCGCFAILSLLCGLMPNFEA---FAVMRALQGIA 130

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 12/133 (9%)

Query: 349 RNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNL---GCIIFSVTP 405
            N SPL AG      +IS  I    CG    ++RP   +T   +GF L   G II +   
Sbjct: 337 ENDSPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVT---LGFFLALSGSIILTQLR 393

Query: 406 V--HQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYS 459
              +  +++      +++  G+ + +P +  +     P++ +G+A  +  T     I  +
Sbjct: 394 AVKYDVFWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIA 453

Query: 460 NSLFLGIAGTVEQ 472
            S+   + G +E+
Sbjct: 454 FSIMASVLGNIEE 466

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138
           +  L +Q   S+ L    V  + +  G    +SG L D+YG + ++++G +I V  S+  
Sbjct: 110 LKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASI-- 167

Query: 139 GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 198
           GL+  +  G+  +  R  Q  GIS ++    G++G      T+K+    + VGA+S  G 
Sbjct: 168 GLACSNSYGV-IVFLRCLQSAGISPIIAINSGVVGDF----TVKQERG-TFVGAVS--GF 219

Query: 199 TL-GGLFSGLVATESEGSWPWA--FYAYTLAAFINTFISYYSIPNNIPTNVNRLSMD 252
           TL G  F  L+      ++ W   F+  T+       +++  +P    + V  +S+ 
Sbjct: 220 TLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMLVNFLLLPETKRSIVGNMSIK 276

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 54/131 (41%), Gaps = 7/131 (5%)

Query: 91  SLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFF 150
           S+  WLV  + L +    L+ GR G + G K  ++L  VI  + SLI   +  + S    
Sbjct: 110 SMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLI---AAAATSMTML 166

Query: 151 IIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 210
           I  R   G+G S +      +   +    T  +   ISI+     + +  G    G  AT
Sbjct: 167 IGGRVISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAVASVAGPFLGGAFAT 224

Query: 211 ESEGSWPWAFY 221
               +W W FY
Sbjct: 225 HV--TWRWCFY 233

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 99/233 (42%), Gaps = 26/233 (11%)

Query: 2   DTDLKKKNIEVSSYIAE--ETIRSDCSDANDESPSMEL----------KNSSLRNPD--Y 47
           DT+ KKKN + +   +    T+  +  D  D+  + E+          K   L   D  Y
Sbjct: 14  DTETKKKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPY 73

Query: 48  FNSTTQEYAFIFSCMLSQ-LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGS 106
              T ++  F+ + + S    +  G+      +  L  +   ++ L    V  + L  G 
Sbjct: 74  TLLTYRQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGI 133

Query: 107 FILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLP 166
              +SG L D+YG + +++LG +I VI S+    S  S+  + F+  R  Q  GIS ++ 
Sbjct: 134 APTISGGLADVYGRRPIILLGMLIYVIASIGLACSK-SYGAVVFL--RCLQSAGISPIIA 190

Query: 167 NVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATL-GGLFSGLVATESEGSWPW 218
              G+ G      T+K     + VGA+S  G TL G  F  L+      ++ W
Sbjct: 191 INSGVAGDF----TVKSERG-TFVGAVS--GFTLMGQAFGSLIGAALTAAYDW 236

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+V+ + L      L+ GR   I G K  L++  +I    SLI+ +   S+S    I  R
Sbjct: 157 WIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLISAI---SNSMNMLIGGR 213

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214
              G+G S +  ++  +I     P    + ++IS++     + A +G    G + T    
Sbjct: 214 VVAGIGGSGI-QSLCFVIASTLTPDR-SRVIIISVLSCSYAVAAVVGPFLGGALTTHV-- 269

Query: 215 SWPWAFY 221
           +W W FY
Sbjct: 270 TWRWCFY 276

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 129 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 188
           +++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K   I+
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKR--IA 191

Query: 189 IVGAMSPIGATLGGLF-SGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 242
                S +    GGL  +GL +  + G    W W +    L +   +F  ++ +P+N+
Sbjct: 192 FFFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 129 VILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVIS 188
           +++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K   I+
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKR--IA 191

Query: 189 IVGAMSPIGATLGGLF-SGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 242
                S +    GGL  +GL +  + G    W W +    L +   +F  ++ +P+N+
Sbjct: 192 FFFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 11/145 (7%)

Query: 110 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           +SG L D+YG + +++ G +I V+ S+  GL+  +  G+  +  R  Q  GIS ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLACSNSYGV-IVFLRCVQSAGISPLIAISS 208

Query: 170 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWA--FYAYTLAA 227
           G++G         K+   S VGA+S   A +G  F  L+      ++ W   F+  T+  
Sbjct: 209 GVVGDF-----TTKSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 228 FINTFISYYSIPNNIPTNVNRLSMD 252
                I+++ +P    T    LS+ 
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSIK 287

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 77/185 (41%), Gaps = 13/185 (7%)

Query: 58  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 117
           IF C LS   N +     LS+   ++++ H S          F +  G    +     + 
Sbjct: 86  IFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEE 142

Query: 118 YGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNV-LGLIGMIY 176
           YG + ++ L      IW ++ G +         II   F G GIS    +V LG++  ++
Sbjct: 143 YGRRNIMQLSLFFTNIWQILGGKA----PNFGTIIVARFLG-GISQAGGSVTLGVVADMW 197

Query: 177 KPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYY 236
           +P        ++ V   S +GA +G +F GL+  E   SW W F+   +   +   + ++
Sbjct: 198 QPQ--DHGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFGGVTQLLHFF 253

Query: 237 SIPNN 241
            +P  
Sbjct: 254 LVPET 258

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 83/180 (46%), Gaps = 28/180 (15%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           WL   + L +   +L+ GR+  + G K   +   VI  + SL++ L   ++S    I  R
Sbjct: 82  WLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---ANSMDMLIGGR 138

Query: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKN--MVISIV----GAMSPIGATLGGLFSGLV 208
              G+G S     V  L+ +I      ++N  ++I+++    G  S +G  LGG F+  V
Sbjct: 139 VIAGIGGS----GVQSLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHV 194

Query: 209 ATESEGSWPWAFY----AYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLI 264
                 +W W FY       LA F+  F+++Y+ P     N +    + +G+  G LGL+
Sbjct: 195 ------TWRWCFYINLPVGGLAFFL--FLTFYN-PEKWVVNKDTAEDEVVGN--GRLGLL 243

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 75/178 (42%), Gaps = 21/178 (11%)

Query: 84  RQLHSS---DSLKVWL-VASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITG 139
           RQL      D  KV + V  + L  G     SG L DIYG + ++++G +I V  S+  G
Sbjct: 88  RQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSV--G 145

Query: 140 LSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG---MIYKPGTLKKNMVISIVGAMSPI 196
           L+  +  G+  +  R  Q   IS  +    G +G   + ++ GT         VGA S  
Sbjct: 146 LACSNSYGV-LVFLRILQSACISPTIAISSGFVGDFTLKFERGTF--------VGATSGF 196

Query: 197 GATLGGLFSGLVATESEGSWPWA--FYAYTLAAFINTFISYYSIPNNIPTNVNRLSMD 252
            A LG  F  L+      +W W   F+   +   +   I +  +P    T V  LS+ 
Sbjct: 197 -ALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGVCMLIIFTLLPETKRTLVGNLSVK 253

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 86/455 (18%), Positives = 173/455 (38%), Gaps = 46/455 (10%)

Query: 19  ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78
            T +S  S  N+   +     +   + +++  +++    +FS  L   L     T   ++
Sbjct: 50  STTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTL 109

Query: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138
           +  +  + +S D    W+  S+ L S +   + G+L D  G K +L+    +  I  LI 
Sbjct: 110 LTHIGSEFNSLDKAS-WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLIC 168

Query: 139 GLSGYSHSGIFFIIA-RAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVISIV 190
           GLS    + I+ ++A R   G+G        ++++ +++ L     +   + + +   + 
Sbjct: 169 GLS----NSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL-----RDRAVYQGLCNFVF 219

Query: 191 GAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFIN--TFISYYSIP------NNI 242
           G  +  G  +G  F           W  AF      + ++    + Y  +P      N  
Sbjct: 220 GLGTASGGLVGAYFR---------DWRLAFILQCPISVLSGILIVVYLELPPRASASNKD 270

Query: 243 PTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPAD-GWNXXXXXXXXXXXXXXXXXFGIYE 301
             +     +DW G+ + +  L LF    +   +   +                  F   E
Sbjct: 271 CWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVE 330

Query: 302 LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGG 358
           LR A +P+LP   +R+R ++    A  F   S     FY   Y+S VL ++         
Sbjct: 331 LRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAM 390

Query: 359 SYFIFVISGTITAISCGFLMKKIRP--AVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILG 416
             F  V  G++ A   G  MK+       LL F ++       I  +TP    + + +L 
Sbjct: 391 PSFFSVAFGSLGA---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLL- 446

Query: 417 TMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSL 451
             ++   G+ +    + + +   +P++H     S+
Sbjct: 447 -QVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSI 480

>KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 508

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 6/113 (5%)

Query: 134 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 193
           WS+IT  SG+  S    I  R   G       P ++ L+ MIYKP    K   I+   + 
Sbjct: 144 WSIITLCSGFVKSYHSLIALRVLLGAFEGGYFPAMVLLVSMIYKPEEQAKR--IAFFFSC 201

Query: 194 SPIGATLGGLF-SGLVATESEG---SWPWAFYAYTLAAFINTFISYYSIPNNI 242
           + +    GGL  +GL      G    W W +    L +       Y+ +P ++
Sbjct: 202 AALAGAFGGLIATGLATVHGAGGLNGWRWLYIIEGLVSTTAAVWIYFGLPTDV 254

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 8/130 (6%)

Query: 30  DESPSM--ELKNSSLRNPDY--FNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQ 85
           DES  +  + ++    + +Y  +N +  ++  + S  L   L+   +T   +IMN +  +
Sbjct: 5   DESTRLLPDEQHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEE 64

Query: 86  LHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH 145
              S   K W+  SF L + +F  + G+L DI G K  L+       +   +T LS    
Sbjct: 65  FQESQE-KQWIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNIK 123

Query: 146 SGIFFIIARA 155
               F IARA
Sbjct: 124 Q---FAIARA 130

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 8/148 (5%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           +L ++F L      L  G+  D YG K  L +G       SLI G S   +  +F   AR
Sbjct: 106 YLSSTFALCQVLSSLQWGKFSDKYGRKPALFIGLCGTCASSLILGFSQNFYQALF---AR 162

Query: 155 AFQGL--GISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES 212
           +  GL  G   VL  V+G +    +   L  + +  +    S IG  +GG FS    +++
Sbjct: 163 SLMGLLNGNVAVLRTVIGEVASERRHQALAFSTMPLLFQFGSVIGPMIGGFFSFPKGSDN 222

Query: 213 EGSWPWAFYAYTLAAFINTFISYYSIPN 240
               P  +    +A  +  +   YS+PN
Sbjct: 223 NKEVP-KWLPKPIAKMVEKYP--YSMPN 247

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 105 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 164
           GSF L  GRLGDIYG +  LI+  VI +I ++I   S    +   ++I R   GLG  L+
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIAS--VKAWYQYMIGRIIAGLGCGLI 189

>TBLA0F01620 Chr6 complement(404095..405942) [1848 bp, 615 aa] {ON}
           Anc_7.33 YOR356W
          Length = 615

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 194 SPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMD 252
           SP+G  LG  +SGL +   +G  PW F  +   + + +    Y  P N P   N++S D
Sbjct: 455 SPVGNILGMCYSGLDSLILKGHAPWTFPLHESDSSVTSLAKNYK-PINYPKPDNKISFD 512

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 250 SMDWIGS--FTGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAEN 307
            +D IG+  FT  LG IL            WN                  G++E ++A +
Sbjct: 279 KLDIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWARD 338

Query: 308 PLLPSEIIRNR 318
           PL+P +++R+R
Sbjct: 339 PLIPYKLVRDR 349

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 82/197 (41%), Gaps = 20/197 (10%)

Query: 352 SPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIF-SVTPVHQT- 409
           SPL AG      +I+  I    C     K+RP + +    +    G II   +  V +  
Sbjct: 353 SPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENL 412

Query: 410 YFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTV----INYSNSLFLG 465
           Y++ +  + I++  G  + +P +  ++  + P+  +G+A  +  T     I  + S+ + 
Sbjct: 413 YWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVS 472

Query: 466 IAGTVEQ-HCNKNGTDLLR-GYRGALYFGIACSGVAVLIAGLYMVETIFD--SYKD---- 517
           + G + Q     +  +  R G++   YF +A     +++   ++    F   S KD    
Sbjct: 473 VLGNITQVKSRPDSFERFRDGFQKCTYFTLASGAFGLVLTTFFVRGPRFSNGSPKDATAL 532

Query: 518 ------RKEKDCENCEQ 528
                 + E +CE  EQ
Sbjct: 533 ENGSYSQTESNCEKKEQ 549

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 51/123 (41%), Gaps = 6/123 (4%)

Query: 56  AFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLG 115
           A IF      LLN+AG    +S++  L        +   W + S+ +     I   GRLG
Sbjct: 35  ALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLG 91

Query: 116 DIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMI 175
           DI G   +  +      ++ L+  +     +   F + RA QG+  + ++P    LI  +
Sbjct: 92  DIIGNSVLFTISGFFFSLFCLLCAVVTNFPA---FAVLRALQGIAAAGLVPCGYALIPTL 148

Query: 176 YKP 178
             P
Sbjct: 149 ADP 151

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 132 VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN---MVIS 188
           + W L+T  +G S S     I R F G+  +      + L G  +K G + +    M++ 
Sbjct: 160 ICWGLLTIGTGKSTSVRQIKILRFFTGVFEAPSYIAYMYLFGSFFKSGEVARRSGFMIVG 219

Query: 189 IVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 242
               +   GA    +F  L  +     W W F      + +   + +YS+P +I
Sbjct: 220 QYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGAISIVVALLGFYSLPGDI 273

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 14/117 (11%)

Query: 134 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 193
           WS+IT  +G+  S    I  R   G       P ++ L+ MIYKP    K + +   G  
Sbjct: 144 WSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIAL-FFGC- 201

Query: 194 SPIGATLGGLFSGLVAT--------ESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 242
               A L G F GL+AT             W W +    L +   +   Y+ +P +I
Sbjct: 202 ----AALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLISITASIWIYFGLPTDI 254

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 8/127 (6%)

Query: 29  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 88
           ND     +L+    R+    N    +   + S  L   ++    T   +IMN +  +   
Sbjct: 20  NDLPDDTKLEQEYHRD----NMALPKGPILLSLWLGSFVSALDGTVVANIMNSIAAEFAE 75

Query: 89  SDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGI 148
           SD  K W+  S+ L + +F  + G+L DI G K  +I  +    +  L+T    ++ +  
Sbjct: 76  SDK-KQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLLT---CFAQNVT 131

Query: 149 FFIIARA 155
            F IARA
Sbjct: 132 QFSIARA 138

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 130 ILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISI 189
           ++  WS+IT  SG+  S    +  R   G       P +  LI M+YKP    K   I+ 
Sbjct: 123 LVFCWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKR--IAF 180

Query: 190 VGAMSPIGATLGGLF-SGLVATES----EGSWPWAFYAYTLAAFINTFISYYSIPNNI 242
               S +    GGL  +GL + +S    EG W W +    L +   T   ++ +P+N+
Sbjct: 181 FFGSSALSGAFGGLIATGLASVKSTSGLEG-WRWLYIIEGLISVCATAWLFFGLPDNL 237

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 110 VSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           VSG L DIYG + +++ G ++ V+ S+  G++  +  G+  I  R  Q  GIS ++    
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASI--GIAACNSYGV-IIFLRCLQSTGISPLIAISS 209

Query: 170 GLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218
           G +G      T+K     + VGA+S +   +G  F  L+      ++ W
Sbjct: 210 GAVGDF----TVKAERG-TFVGAVSGL-VLMGQAFGSLIGAALAAAYNW 252

>Kwal_47.18615 s47 complement(898425..900074) [1650 bp, 549 aa] {ON}
           YCR098C (GIT1) - permease involved in the uptake of
           glycerophosphoinositol (GroPIns) [contig 192] FULL
          Length = 549

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 73/162 (45%), Gaps = 15/162 (9%)

Query: 19  ETIRSDCSDANDES-PSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLS 77
           E+I +  SDA+ +S  S E  N +     +   T +   +  +   + L +      ++S
Sbjct: 41  ESIETQVSDASHKSLESHEDANGTGEKAKFVADTKRNNYWAIATTGAGLFSDGYINNSIS 100

Query: 78  IMNVLTRQLHS---SDSLKVWLVASFPLVSGSFI--LVSGRLGDIYGLKKMLILGYVILV 132
            MNV    ++    ++S  +  V+S    +G+ +  L  G + D Y  K  +I+G  IL+
Sbjct: 101 TMNVCLSMIYKDQYTESHAIQNVSSIAF-AGTVVGQLSFGYISDTYSRKFAMIVGTSILI 159

Query: 133 IWSLI------TGLSGYSHSGIFFIIA--RAFQGLGISLVLP 166
           +++++       G +G    G+F  I   R F G+GI    P
Sbjct: 160 LFTVLGAGAWGVGTTGTQAGGLFAAITAYRFFLGIGIGSEYP 201

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 28/155 (18%)

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +I+  + +Q  S   +  WL   + L +    L+ GR+    G K+ ++   VI  I SL
Sbjct: 89  TIIEEVAKQFGSYSEIG-WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 137 ITGLSGYSHSGIFFIIARAFQGLG------ISLVLPNVLGLIGMIYKPGTLKKNMVISIV 190
           I+ L   ++S    I  R   G+G      +S V+ + L            ++ ++I+++
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTL--------VEESQRGILIAVL 196

Query: 191 GA----MSPIGATLGGLFSGLVATESEGSWPWAFY 221
                  S +G  LGG+F+      S  +W W FY
Sbjct: 197 SCSFAIASVVGPFLGGVFT------SSVTWRWCFY 225

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 4/97 (4%)

Query: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123
           S L+ L GT    ++MN +  +   SD  K W+  SF L + +F  + G+L D+   +K+
Sbjct: 50  SFLVALDGTI-VANVMNRIAEEFQESDK-KQWIATSFLLTNTAFQPLYGKLSDVATGRKL 107

Query: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLG 160
             L         LI  +S ++ +   F I RA  G+G
Sbjct: 108 ATLIAQFFFFLGLI--ISCFAQNVTQFAIGRAVCGIG 142

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 10/48 (20%)

Query: 297 FGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSF 344
           F  +E  YA NPLLP +++++R +          W   G+  F YF+F
Sbjct: 187 FMFWEASYAHNPLLPFKLLKDRGI----------WAPLGVAFFNYFTF 224

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 60/145 (41%), Gaps = 8/145 (5%)

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +I++V+ +Q   + S   WLV  + L +    L+ GR   I G +  LIL  +I    SL
Sbjct: 67  TIIDVVAKQF-GNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSL 125

Query: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 196
           +  L+   +     +I            L  +  +IG         + +VISI+     +
Sbjct: 126 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTMVDER-SRPLVISILSCAFAV 180

Query: 197 GATLGGLFSGLVATESEGSWPWAFY 221
            A +G +  G   T    +W W FY
Sbjct: 181 AAIVGPIIGGAFTTHV--TWRWCFY 203

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 48/93 (51%), Gaps = 11/93 (11%)

Query: 307 NPLLPSEIIRNRQLIM---ILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFI- 362
            P+L   ++ NR +++   +  A    +  + +++  +F  V+     S  W  G + I 
Sbjct: 344 RPMLVKGLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMG----SSAWNAGLHLIP 399

Query: 363 FVISGTITAISCGFLMKK---IRPAVLLTFSMV 392
            VI+  ++AI CG +MKK   ++P ++ T S++
Sbjct: 400 LVIASIVSAIICGGIMKKTGQVKPLMISTVSIL 432

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +IMN +  +   SD  K W+  SF L + +F  + G+L DI G +  L+  +    +  L
Sbjct: 55  NIMNRVAEEFEESDK-KQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCL 113

Query: 137 ITGLSGYSHSGIFFIIARA 155
           +T    ++ S   F +ARA
Sbjct: 114 LT---CFAQSVEQFALARA 129

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 112 GRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGL 159
           G +GD YG K   I+    +++  +ITG     H+  +F+IARAF G+
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF--IKHNFKYFLIARAFFGV 176

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 90/217 (41%), Gaps = 27/217 (12%)

Query: 19  ETIRSDCSDANDES--------PSMEL--KNSSLRNPDYFNS------TTQEYAFIFSCM 62
             +RS  +D +DES        P  +L    S+   PD  +       TT++   +  C 
Sbjct: 26  HKVRSYHNDDDDESVINISDINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCA 85

Query: 63  LSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKK 122
            +   +         +++V+  + + ++ +    V  + +  G    + G L D  G ++
Sbjct: 86  FTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMG-RR 144

Query: 123 MLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLK 182
            ++L  V++   + I GL+  SH+    I+ R  Q  GIS V+    G++G I      +
Sbjct: 145 PVVLSSVLVYCCACI-GLA-CSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRA--E 200

Query: 183 KNMVISIVGAMSPIGATLGGLF-SGLVATESEGSWPW 218
           +   +  V     IG+  G L  +GL AT     W W
Sbjct: 201 RGGYVGYVSGFQVIGSAFGALIGAGLSAT-----WSW 232

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 59/145 (40%), Gaps = 8/145 (5%)

Query: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136
           +I++V+  Q   + S   WLV  + L +    LV GR   I G +  LIL  +I    SL
Sbjct: 57  TIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 196
           +  L+   +     +I            L  +  +IG         + +VISI+     +
Sbjct: 116 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTM-VNERSRPLVISILSCAFAV 170

Query: 197 GATLGGLFSGLVATESEGSWPWAFY 221
            A +G +  G   T    +W W FY
Sbjct: 171 AAIVGPIIGGAFTTHV--TWRWCFY 193

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 299 IYELRYAENPLLPSEIIRNRQL---IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLW 355
           I+E +YA +PL P ++I++R +   ++I   + F W   G + F      +N  N S   
Sbjct: 315 IWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQR 374

Query: 356 AGGSY-FIFVISGTITAISCGFLMKKIR 382
               Y F+ VI+GT+     G ++ K+R
Sbjct: 375 ITSLYSFVSVITGTL----LGLVIVKVR 398

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 21/135 (15%)

Query: 95  WLVASFPL--VSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFII 152
           W+ + F L  + GSF   +G   D YG KK+ I   V++ I SL+     YS++ +  +I
Sbjct: 78  WITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSLVL---FYSNTYLQLLI 132

Query: 153 ARAFQGL--GISLVL-PNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVA 209
            R   G+  G+ LV+ P  +  I      G L         GAM+ +   LG L + L+A
Sbjct: 133 GRTIVGIACGVYLVITPLYINEIAPAQHRGAL---------GAMNQVAINLGILLTQLLA 183

Query: 210 TESEGS--WPWAFYA 222
                S  W W F+A
Sbjct: 184 LRYTDSFRWRWLFFA 198

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 115/282 (40%), Gaps = 27/282 (9%)

Query: 72  TTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVIL 131
           +T T S    +  + +  D L  W+ AS+ + S SF  + G   D+ G +K L    +I 
Sbjct: 84  STVTASTYQTIGNEFNHMD-LSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIF 142

Query: 132 VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVG 191
            I  L  G+   S + ++    RAF G+G   ++     ++     P T K+ +  +   
Sbjct: 143 SIGCLGCGI---SINILWLSFMRAFTGIGGGGLITLST-IVNSDMIP-TSKRGIFQAFQN 197

Query: 192 AMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNR--- 248
            +  +GA  G  F G++ T S G W W F      +     I +  + N       +   
Sbjct: 198 LLLGLGAICGASFGGVI-TSSIG-WRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKE 255

Query: 249 --------LSMDWIGSFTGVLGLILFNFVW----NQAPADG--WNXXXXXXXXXXXXXXX 294
                     +D+ G+F  ++GL L   V+    + A   G  W+               
Sbjct: 256 SSQTKEMLKHIDFSGAFLIIIGLTL-QLVYLSLGSAADESGNTWSSPGLSAVLVASFIVL 314

Query: 295 XXFGIYELRYAENPLLPSEIIRNRQLIMILT-AMTFGWGSFG 335
             F + E R +   ++PS+++R+    ++LT ++  G+ S+ 
Sbjct: 315 VLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFASYA 356

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 105 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 164
           G F L  GRLGDIYG +  LI+  VI +I S+I   S    +   ++I R   G+G  L+
Sbjct: 132 GCFFL--GRLGDIYGRRIGLIVASVIFIIGSVIQIAS--VKAWYQYMIGRIVAGIGCGLI 187

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 141
           W+  ++ L S +F  + G++ DI+G + ++I+  +  ++  LI GLS
Sbjct: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%)

Query: 297 FGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWA 356
           F  +EL++A NP+ P ++I++R +   +    F    + I + Y ++ ++   N S   A
Sbjct: 316 FLTWELKFASNPITPLDLIKDRGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSA 375

Query: 357 GGSYFIFVISGTITAISCGFLMKKIR 382
                +F     +TA   GF++ K+R
Sbjct: 376 TRITSLFTFVSVLTAFFLGFVVVKVR 401

>TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {ON}
           Anc_1.155 YCR028C
          Length = 516

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 7/92 (7%)

Query: 134 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 193
           W L+T    ++HS     + R FQ L  S        ++G  Y P  L     I     +
Sbjct: 119 WGLLTLGMSHAHSARDLCVLRFFQALFESCTFSGTHLILGAWYCPRELPLRSAIFTSSGL 178

Query: 194 SPIGATLGGLFSGLVATESEGS-----WPWAF 220
             +GA   G     +A E EG+     W W F
Sbjct: 179 --VGAIFSGFMQTAIAHELEGAGGMAGWRWLF 208

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 105 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 164
           G F L  GRLGD+YG +  +I+  +I V+ ++I   S    +   ++I R   GLG  ++
Sbjct: 133 GCFFL--GRLGDMYGRRMAIIIASIIFVVGTIIQIAS--VKAWYQYMIGRIVAGLGCGII 188

Query: 165 LPNVLGLIGMIYKPGTLKKNMV 186
             +   LI  +  P  L+  MV
Sbjct: 189 AISSPMLISEV-SPKHLRGAMV 209

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 40/215 (18%), Positives = 86/215 (40%), Gaps = 18/215 (8%)

Query: 11  EVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNS-------TTQEYAFIFSCML 63
           EV S   ++ I+++  +A  E       N +   PD  N+          + A +  C  
Sbjct: 32  EVDSEDNDKMIKTNEDEAVKEPIYRTRSNQT--EPDIANAPPYSRFDAKYKMALVLQCAY 89

Query: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123
           + L +         +++V+ +Q H ++ L    V  + +  G    + G L D  G + +
Sbjct: 90  TGLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPV 149

Query: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 183
           ++  + + V +    GL+  + +    ++ R  Q  GIS V+    G+IG +      ++
Sbjct: 150 VL--FAVTVYFGACIGLAC-AQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRA--ER 204

Query: 184 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218
              +  +     +G+  G L    +++     W W
Sbjct: 205 GGYVGYISGFQVLGSAFGALIGAGLSSR----WGW 235

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 115 GDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGM 174
            D  G K + I   +I +I +++        + ++  I R FQ +G S V+P  +G +  
Sbjct: 171 ADFGGRKFLYIFSLMIALIANVLLAAVPKHLAALY--ILRVFQAIGTSAVIPLGVGTVSD 228

Query: 175 IYKPGTLKKNMVISIVGA-MSPIGATLGGLFSGLVATESEGSWPWAF 220
           +  P    K +   ++G  M PI   LG +F GL+       W W F
Sbjct: 229 LISPMNRAKGVSYFMLGPNMGPI---LGPIFGGLILMNGN-QWRWLF 271

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 105 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 164
           GSF L  GRLGDIYG +  LI+  VI +  ++I   S    +   ++I R   GLG  L+
Sbjct: 137 GSFFL--GRLGDIYGRRIGLIVASVIFIAGTIIQIAS--IKAWYQYMIGRIVAGLGCGLI 192

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 66/306 (21%), Positives = 121/306 (39%), Gaps = 37/306 (12%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+ AS+ L +  F  + G+L DI+G K +L+   ++  +  L+ G    +   +++++A 
Sbjct: 191 WIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG----TAPTVWWLLAG 246

Query: 155 AF----QGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 210
            F     G G++ +   ++  I  +    + +    I  V     +G TLGG   G +A 
Sbjct: 247 RFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYV-----LGITLGGSMGGWLA- 300

Query: 211 ESEGSWPWAFYAYTLAAFIN-TFISYY------------SIPNNIPTNVNRLSMDWIGSF 257
              G W   F    +AA I+  FI  +            ++ N          MDW+G+F
Sbjct: 301 -EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTF 359

Query: 258 TGVLGLILFNFVWNQAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYAENPLLPSEIIRN 317
             V+ L       +       N                 F  +EL  A +P+L   ++ +
Sbjct: 360 CLVIFLASLTLTCSLVDL---NFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTD 416

Query: 318 RQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISC 374
           R ++    A  F   +  +  FY   YF+ VL +    P   G    I  +  +I +   
Sbjct: 417 RNVLASSLANFFCMLNDVLTIFYVPMYFASVLYM---GPKEIGKRTIISFLGTSIGSFGT 473

Query: 375 GFLMKK 380
           G+ +K+
Sbjct: 474 GYYIKR 479

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 72/176 (40%), Gaps = 6/176 (3%)

Query: 299 IYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGG 358
           I+EL+YA  PL P   I++R +   L    F   ++ +   Y  + +L     S   A  
Sbjct: 335 IWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAVGQSKKSATR 394

Query: 359 SYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYF---RNIL 415
               +   G +TA   GF++ K+R      F  +G  +  + F +   ++        I+
Sbjct: 395 IIKFYSFVGVLTAFFLGFVVAKVRRT--KEFIALGIGIWFVAFGLLEHYEGGLGARAGII 452

Query: 416 GTMIILPLGMD-LSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470
             + IL  G   L FP  + I +    +   G+A SL   V +   +    +AG +
Sbjct: 453 AAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAGGI 508

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 105 GSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLV 164
           GSF L  GRLGDIYG +  LI+   I ++ ++I   S    +   ++I R   GLG  L+
Sbjct: 127 GSFFL--GRLGDIYGRRIGLIVASFIFIVGTVIQIAS--VKAWYQYMIGRIVAGLGCGLI 182

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 88/207 (42%), Gaps = 30/207 (14%)

Query: 28  ANDESPSMELKNSSLRNPDYFNSTTQE----YAFIFSCMLSQLLNLAGTTQTLSIMNVLT 83
           A ++  +  L+N + ++    NS   +    YA + +  LS  L    T    +I+  + 
Sbjct: 45  AAEQDAASALENRNAKHSARENSALPKGFVLYASLTALALSLFLAALDTMIVSTIIEEVA 104

Query: 84  RQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGY 143
           +Q  S   +  WL   + L +    L+ GR+    G K+ ++   VI  + SLI+ L   
Sbjct: 105 KQFGSYSEIG-WLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISAL--- 160

Query: 144 SHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGT-----LKKNMVISIVGA----MS 194
           ++S    I  R   G+G         G+  + +  G+       + ++I+I+       S
Sbjct: 161 ANSMNVLIGGRVIAGVG-------GCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAIAS 213

Query: 195 PIGATLGGLFSGLVATESEGSWPWAFY 221
            +G  LGG+F+  V      +W W FY
Sbjct: 214 VVGPFLGGVFTSRV------TWRWCFY 234

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 10/50 (20%)

Query: 297 FGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVL 346
           F  +E  YA+NPLLP +++ +R +          W   G+  F YF+F +
Sbjct: 317 FVFWETAYAKNPLLPFKLLGDRGI----------WAPLGVAFFNYFTFFI 356

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 19  ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78
           + + + C     E P+ +    +  N      T +    + +  L   L+   TT   ++
Sbjct: 6   DLLLAPCLSPIPEIPTFDSSYDAAANHSVLTET-KTRIIVIALFLGSFLSALDTTIVSTL 64

Query: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138
           +  +   L +S  +  W+  S+ L   +F  + G+L DI+G K +L+   ++  I   + 
Sbjct: 65  LPTIASDLDASSQMS-WIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALC 123

Query: 139 G 139
           G
Sbjct: 124 G 124

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 87/209 (41%), Gaps = 32/209 (15%)

Query: 4   DLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCML 63
           + K  +IE   + +E T R+  SD+ +   + E +N       +     + +   F C L
Sbjct: 64  EHKTTDIEGRPHWSETTSRTHESDSEEGDSNGEAEN-------FPEGGLKAWVVTFGCFL 116

Query: 64  S-----QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIY 118
                  LLN  G  ++    N L  +   S S   WL + F  V  +  ++SG   D  
Sbjct: 117 GLIACFGLLNSTGVIESHLQDNQLANE---SVSTIGWLFSLFLFVCFASCIISGTYFDRN 173

Query: 119 GLKKMLILGYVILVIWSLITGLS-GYSHSGIFFIIARAFQ-GLGISLVLPNVLGLIGMIY 176
           G + ++I+G V  V     T  S  Y H    FI++ A   G G  +VL  ++ +    +
Sbjct: 174 GFRTIMIVGTVFHVAGLFATANSTKYWH----FILSFAIVCGFGNGIVLSPLVSVPAHYF 229

Query: 177 --KPGTLKKNMVISIVGAMSPIGATLGGL 203
             + GT           AM+ IG ++GG+
Sbjct: 230 FKRRGTAL---------AMATIGGSVGGV 249

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 112 GRLGDIYGLKKMLILGYVILVIWSL--ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVL 169
           G+LGDIYG +  LIL  +I VI  L  IT +  +      + I R   G+G+ L+     
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQ----YFIGRIIAGIGMGLIAVLSP 189

Query: 170 GLIGMIYKPGTLKKNMV 186
            LI  +  P  L+  MV
Sbjct: 190 MLISEV-APKELRGAMV 205

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 58  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDI 117
           +F+  +   L    TT   +++  +  +L +S+ +  W+  S+ L   +F  + G+L D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDASNQMS-WIATSYLLSCSAFQPLYGKLSDV 93

Query: 118 YGLKKMLI 125
           +G K +LI
Sbjct: 94  FGRKPLLI 101

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 86/401 (21%), Positives = 144/401 (35%), Gaps = 54/401 (13%)

Query: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154
           W+V  + L +  F L+  RL  + G +  ++   ++    SLI+ L+   +S    I  R
Sbjct: 83  WIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALA---NSMNMLIAGR 139

Query: 155 AFQGLGIS--LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATES 212
              G+G S    L  V+G   +  K   L  +++       S +G  LGG F+  V    
Sbjct: 140 VVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHV---- 195

Query: 213 EGSWPWAFY---------------------AYTLAAFINTF--ISYYSIPNNIPTNVNR- 248
             +W W FY                        L  F NTF  +S +      P  V + 
Sbjct: 196 --TWRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQ 253

Query: 249 --LSMDWIGSFTGVLGLILFNFVWN-QAPADGWNXXXXXXXXXXXXXXXXXFGIYELRYA 305
                D +   +   G +LF            WN                   +Y+ +  
Sbjct: 254 LLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVISFIIIGVLLIAISLVYDFKVF 313

Query: 306 EN--------PLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAG 357
           E         PLL  EI+ NR +++      F   ++ +   Y   F   +  +S  W  
Sbjct: 314 EQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSA-WKA 372

Query: 358 GSYFIFVISGTIT-AISCGFLMKK---IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413
           G + I ++  T+  +I+ G L KK   I+P  LL F      LG  + ++     T    
Sbjct: 373 GLHLIPILVSTVVFSIASGILTKKTGHIKP--LLVFGSAMGVLGGGLMTLLDNKSTKHTQ 430

Query: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNT 454
           I G +I+  + +    P++ I     L   +      L+ T
Sbjct: 431 I-GVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLET 470

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 6/91 (6%)

Query: 134 WSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAM 193
           WS+IT  SG+  S    +  R   G       P +  +I ++YKP    K   I+     
Sbjct: 130 WSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPAMTLIISIVYKPQEQAKR--IAFFFGS 187

Query: 194 SPIGATLGGLF-SGLVATESEG---SWPWAF 220
           S +    GGL  +GL + +  G    W W +
Sbjct: 188 SALSGAFGGLIATGLASVKDAGGLEGWRWLY 218

>TBLA0F01380 Chr6 (341570..342007) [438 bp, 145 aa] {ON} Anc_1.311
          YJL065C
          Length = 145

 Score = 30.0 bits (66), Expect = 8.9,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 6  KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ 65
          K  NI+      E  I  +  +   + P  ++K  +  +P+Y   TT   A+I + + ++
Sbjct: 14 KNSNIQNMDIAEEAQINLNLKNKTPKLPISKIKKIAKTDPEYM--TTSNLAYIATAITTE 71

Query: 66 LLNLAGTTQTLSIMNVLTR 84
          L   + T +TLS+  + T+
Sbjct: 72 LFIQSFTERTLSLNQIRTK 90

>Kwal_56.22623 s56 complement(209946..210872) [927 bp, 308 aa] {ON}
           YOL092W - 1:1 [contig 184] FULL
          Length = 308

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 222 AYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILF 266
           A  L  F++ +ISY S PN I    + L M+W+  F G L  +L+
Sbjct: 176 AVFLGGFLSWYISYVSDPNPIEKKPD-LHMNWMAQFFGYLSAVLY 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,375,885
Number of extensions: 2192858
Number of successful extensions: 8547
Number of sequences better than 10.0: 251
Number of HSP's gapped: 8640
Number of HSP's successfully gapped: 258
Length of query: 528
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 414
Effective length of database: 40,409,475
Effective search space: 16729522650
Effective search space used: 16729522650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)