Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_541.158.842ON49849825020.0
NCAS0B003008.842ON52352317360.0
YML115C (VAN1)8.842ON53548417370.0
Suva_13.288.842ON53041917280.0
ZYRO0G14234g8.842ON50948917060.0
NDAI0E002908.842ON52242016950.0
Skud_13.268.842ON53941216930.0
Smik_13.198.842ON53641016910.0
SAKL0D01430g8.842ON44742016790.0
TDEL0B005608.842ON50950816740.0
KAFR0A028308.842ON50750816730.0
KNAG0G034208.842ON51142216710.0
TBLA0B032708.842ON52051116680.0
KLLA0D01529g8.842ON50141916220.0
KLTH0C03828g8.842ON40440415950.0
CAGL0B02321g8.842ON51241316010.0
TPHA0C047808.842ON52551015940.0
Ecym_46138.842ON52449615510.0
ABL124W8.842ON48542815210.0
Kwal_27.102468.842ON33933713490.0
Ecym_35731.479ON4473629871e-129
KLTH0C03432g1.479ON4893599741e-127
NCAS0G041101.479ON4943599711e-126
Kwal_27.101571.479ON4763599671e-126
NDAI0B012501.479ON4463589601e-125
CAGL0L01331g1.479ON4473599591e-125
YEL036C (ANP1)1.479ON5003549631e-125
SAKL0D11792g1.479ON4833599611e-125
KNAG0I003001.479ON4573569591e-125
AFR357W1.479ON4343609511e-124
Skud_5.541.479ON4913519541e-124
Suva_5.331.479ON4953519551e-124
Smik_5.571.479ON4913519541e-123
NDAI0G003401.479ON5043519541e-123
KLLA0E22155g1.479ON4503599461e-123
KAFR0I027701.479ON4553599451e-123
TBLA0B021701.479ON5723599551e-123
Kpol_370.51.479ON6453549541e-122
TPHA0O004301.479ON5483509361e-120
TDEL0C026001.479ON4623609211e-119
ZYRO0F05170g1.479ON6083529241e-118
TPHA0L013708.500ON3923445309e-62
KLLA0E12849g8.500ON3923475114e-59
KLTH0E11616g8.500ON3943474984e-57
SAKL0H11110g8.500ON3933474881e-55
Smik_16.1868.500ON3953474774e-54
KNAG0A021508.500ON3963474767e-54
NDAI0E030208.500ON3963574741e-53
KAFR0H013908.500ON3983464697e-53
TBLA0H033408.500ON3933504671e-52
Kpol_1031.788.500ON3923464662e-52
CAGL0L12804g8.500ON3933524652e-52
ZYRO0F08492g8.500ON3963494635e-52
YPL050C (MNN9)8.500ON3953474601e-51
Kwal_27.118648.500ON4533494641e-51
TDEL0B013708.500ON3963474601e-51
Skud_16.2328.500ON3953474564e-51
NCAS0C023308.500ON3933524541e-50
Suva_16.2658.500ON3953474522e-50
Ecym_25508.500ON3903484461e-49
AGL259C8.500ON3893424363e-48
NCAS0B024408.500ON4003414364e-48
NDAI0C052508.500ON4023464076e-44
KNAG0A039908.500ON3571782288e-20
SAKL0H20438gsingletonON5652031491e-09
YCR019W (MAK32)1.440ON363136820.15
ZYRO0G12540g3.295ON95073790.49
KAFR0B007407.462ON90666723.5
Ecym_26753.295ON98688689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_541.15
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   968   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   673   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   673   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   670   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   661   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   657   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   656   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   655   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   651   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   649   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   649   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   648   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   647   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   629   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   619   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   621   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   618   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   602   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   590   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   524   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   384   e-129
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   379   e-127
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    378   e-126
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   377   e-126
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   374   e-125
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   374   e-125
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   375   e-125
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   374   e-125
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   374   e-125
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   370   e-124
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   372   e-124
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   372   e-124
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   372   e-123
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   372   e-123
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   369   e-123
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   368   e-123
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   372   e-123
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   372   e-122
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   365   e-120
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   359   e-119
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   360   e-118
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   208   9e-62
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   201   4e-59
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   196   4e-57
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   192   1e-55
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   188   4e-54
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   187   7e-54
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   187   1e-53
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   185   7e-53
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   184   1e-52
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   184   2e-52
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   183   2e-52
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   182   5e-52
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   181   1e-51
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   183   1e-51
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   181   1e-51
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   180   4e-51
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   179   1e-50
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   178   2e-50
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   176   1e-49
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   172   3e-48
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   172   4e-48
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   161   6e-44
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    92   8e-20
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    62   1e-09
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    36   0.15 
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    35   0.49 
KAFR0B00740 Chr2 (143264..145984) [2721 bp, 906 aa] {ON} Anc_7.4...    32   3.5  
Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {O...    31   9.3  

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/498 (94%), Positives = 469/498 (94%)

Query: 1   MDFLLNNKRQLKKKDELPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVFICQ 60
           MDFLLNNKRQLKKKDELPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVFICQ
Sbjct: 1   MDFLLNNKRQLKKKDELPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVFICQ 60

Query: 61  XXXXXXXXXXXXXHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLT 120
                        HTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLT
Sbjct: 61  NSFSSSSSNVVDSHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLT 120

Query: 121 PEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNI 180
           PEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNI
Sbjct: 121 PEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNI 180

Query: 181 MNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXX 240
           MNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEM            
Sbjct: 181 MNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDKDDSKKDSEKL 240

Query: 241 XXXXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRR 300
               MNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRR
Sbjct: 241 YLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRR 300

Query: 301 KLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFL 360
           KLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFL
Sbjct: 301 KLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFL 360

Query: 361 NSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDL 420
           NSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDL
Sbjct: 361 NSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDL 420

Query: 421 DGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEP 480
           DGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEP
Sbjct: 421 DGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEP 480

Query: 481 SDDDLLEIASKERENNRS 498
           SDDDLLEIASKERENNRS
Sbjct: 481 SDDDLLEIASKERENNRS 498

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/523 (61%), Positives = 401/523 (76%), Gaps = 25/523 (4%)

Query: 1   MDFLLNNKRQLKKKDE----LPIS--DSRWAPKSKYRHKFNPANSENFVKIN--AIITLI 52
           MD L+  K+ ++ K +    LP S  +S +  + + ++ F P   +    +    + +L+
Sbjct: 1   MDLLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLL 60

Query: 53  LFLVFICQXXXXXXXXXXXXXHTN------------EAKILEDNEYYDYDFKNFDEPLVK 100
           + +V+I                TN            + K L +NEYYD+DF++ +  +VK
Sbjct: 61  IIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVK 120

Query: 101 KFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHV 160
           KFD+G +HYLIS+YG++VLTP D   Y +ELQ +L  +V+ YDLS ++G+ NG  NR+H+
Sbjct: 121 KFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHL 180

Query: 161 LLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGT 220
           LLCVPLRDAE VLPLMFK++MNLTYPHELIDLAFLVSDC+EGD TL++L+AYS+HLQ+GT
Sbjct: 181 LLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGT 240

Query: 221 LAGLFQEMXXXXXXXXXXXXXXXX-----MNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275
           L+ +F EM                     MN DYLK+V+ ++    H++Y+KPFRS+Q+F
Sbjct: 241 LSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVF 300

Query: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM NALKPYHAWVYWRDAD+ELCPG+
Sbjct: 301 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGS 360

Query: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395
           VIEDLMSK++DV+VPNVWRPLPEFL+ EQPYDLNSW+ES+EALKLAK LDEDDVIVEGYA
Sbjct: 361 VIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYA 420

Query: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455
           EYPTWRVHLAYIR+  G+PN+VVDLDGVGGVSIL KAK+FRSG+ FPAFTFENHAETEAF
Sbjct: 421 EYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAF 480

Query: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498
           GKMA+KMGFRVGGLPHYT+WHIYEPSDDDL+EIA+KER+N R 
Sbjct: 481 GKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKRG 523

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/484 (65%), Positives = 380/484 (78%), Gaps = 10/484 (2%)

Query: 23  RWAPKSKYRHKFNPANSENFVKINAIITLILFLVFI------CQXXXXXXXXXXXXXHTN 76
           R+ P+S    KF    S   + I A+++L LF+ F+                       N
Sbjct: 50  RYQPRST-PSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSEN 108

Query: 77  EAKI-LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELL 135
              I LED EYYDYDF++ D  ++ KFDDG +HYLIS++GSEVLTP+D  +Y++EL  L 
Sbjct: 109 YKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLF 168

Query: 136 STTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFL 195
            +TV+ YDLS + G  NG++ R+H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFL
Sbjct: 169 DSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228

Query: 196 VSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXX--XXMNKDYLKMV 253
           VSDC+EGD TL++LIAYSRHLQ+GTL+ +FQE+                  M++ Y+  V
Sbjct: 229 VSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288

Query: 254 EDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTN 313
             A+SPPFH +Y+KPFRSVQIFQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  N
Sbjct: 289 HQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWME 373
           ALKPYH+WVYWRDADVELCPG+VI+DLMSKN+DV+VPNVWRPLP FL +EQPYDLNSWME
Sbjct: 349 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWME 408

Query: 374 SNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAK 433
           S EAL LAK LDEDDVIVEGYAEYPTWRVHLAYIR+  G+PN+ VDLDGVGGVSIL KAK
Sbjct: 409 SQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAK 468

Query: 434 LFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKER 493
           +FR+G+ FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIAS+ER
Sbjct: 469 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASRER 528

Query: 494 ENNR 497
           E  R
Sbjct: 529 EKRR 532

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/419 (72%), Positives = 361/419 (86%), Gaps = 2/419 (0%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           LED EYY+YDF++ D  +V KFDDG +HYLI+++GSEVLTP D  +Y++E+  LL +TV+
Sbjct: 110 LEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVE 169

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDL+ + G  NG++ R+H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+
Sbjct: 170 KYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 229

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXX--XXMNKDYLKMVEDAYS 258
           EGD TL++LIAYSR LQ+GTL+ +FQE+                  M++DY+  V  A+S
Sbjct: 230 EGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFS 289

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
           PPFH++Y+KPFRSVQ+FQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPY
Sbjct: 290 PPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 349

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRDADVELCPG+VI+DLMSKN+DV+VPNVWRPLP FLNSEQPYDLNSWMES EAL
Sbjct: 350 HSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEAL 409

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
            LAK LDEDDVIVEGYAEYPTWRVHLAYIR+  G+PN+VVDLDGVGGVSIL KAK+FR+G
Sbjct: 410 DLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNG 469

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           + FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIA++ERE  R
Sbjct: 470 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 387/489 (79%), Gaps = 9/489 (1%)

Query: 16  ELPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVF--ICQXXXXXXXXXXXXX 73
           +LP S S+ +PK K R  +      ++V I  ++ LIL+  F  + +             
Sbjct: 22  KLPTSHSKLSPKGK-RSSWQNRKIVSWVIIT-VMVLILYKAFSGVVRGGREVMKTVGSNT 79

Query: 74  HTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQE 133
            +N+ ++LE++ YYDYDF++ D  +++KFD G +HYLI+++G++VLTP+D   +E+E + 
Sbjct: 80  SSNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKM 139

Query: 134 LLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLA 193
           LLS+TV++YDLS + G+ NG  N EHVLLCVPLRDAE VLPLMFK++MNLTYPHELIDLA
Sbjct: 140 LLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLA 199

Query: 194 FLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXX-----MNKD 248
           FLVSDCTE D TL++LIAYSR LQ GTL+ +F +M                     MN D
Sbjct: 200 FLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPD 259

Query: 249 YLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARN 308
           YL+ V++++SPPFH +Y+KPFRSVQ+FQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARN
Sbjct: 260 YLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARN 319

Query: 309 WLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDL 368
           WL  NALKPYH+WVYWRDADVELCPG+VIEDLMSK++DV VPNVWRPLP+FL+ EQPYDL
Sbjct: 320 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDL 379

Query: 369 NSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSI 428
           NSWMES EAL LAK LDEDDVIVEGYAEYPT+RVHLAYIR+   +PN+++DLDGVGGVSI
Sbjct: 380 NSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439

Query: 429 LVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEI 488
           L KA+LFR GI FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSDDDL EI
Sbjct: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499

Query: 489 ASKERENNR 497
           A+KERE+ R
Sbjct: 500 ANKERESRR 508

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/420 (70%), Positives = 363/420 (86%), Gaps = 5/420 (1%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           L D EYY+YDF+N +  ++ KF++G +HYLIS++G++VLTP+DK +YE+EL  LL  +V+
Sbjct: 99  LSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVE 158

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDL K+ G+ NG +NR+H+LLCVPLRDAE VLPLMFK++MN+TYPHELIDLAFLVSDC+
Sbjct: 159 KYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCS 218

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXX-----MNKDYLKMVED 255
           +GD+TLE+L+ YSRHLQ+GTL+ +FQ+M                     MN++YLKMVE 
Sbjct: 219 DGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVET 278

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
           A++ P H +Y+KPFRSVQIF+KDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM NAL
Sbjct: 279 AFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANAL 338

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRDAD+ELCPGT++ED+M+ ++DV+VPNVWRPLPEFL+SEQPYDLNSW+ES+
Sbjct: 339 KPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESD 398

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
           EALKLAK L EDDVIVEGYAEYPTWRVHLAYIRE  G+P  VVDLDGVGGVSIL KAKLF
Sbjct: 399 EALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLF 458

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKEREN 495
           RSG+HFPAFTFENHAETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDL EIA+KER++
Sbjct: 459 RSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQS 518

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/412 (72%), Positives = 355/412 (86%), Gaps = 2/412 (0%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           LED EYY+YDF++ D  ++ KFD G +HYLIS++GSEVL PE++  Y++EL  LL +TV+
Sbjct: 114 LEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVE 173

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDLS + G  NG++ R+H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+
Sbjct: 174 KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 233

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXX--XXMNKDYLKMVEDAYS 258
           EGD TL++LIAYSR LQ+GTL+ +FQ++                  M++DY+  V  A+S
Sbjct: 234 EGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFS 293

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
           PPFH++Y+KPFRSVQIFQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPY
Sbjct: 294 PPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 353

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRDADVELCPG+VIEDLMSKN+DV+VPNVWRPLP FLNSEQ YDLNSWMES EAL
Sbjct: 354 HSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREAL 413

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LAK LDEDDVIVEGYAEYPTWRVHLAYIR+  GNPN+VVDLDGVGGVSIL KAK+FR+G
Sbjct: 414 ELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNG 473

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIAS 490
           + FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIA+
Sbjct: 474 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 525

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/410 (72%), Positives = 352/410 (85%), Gaps = 2/410 (0%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           LED EYYDYDF++ D  +V KFD+G +HYLIS++GS+VLTP+D  +Y+ EL  LL +TV+
Sbjct: 114 LEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVE 173

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDLS++ G  NG++ R+H+LLCVPLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+
Sbjct: 174 KYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 233

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXX--XXMNKDYLKMVEDAYS 258
           E D TL++LIAYSR LQ+GTL+ +FQE+                  M+++Y+  V  A+S
Sbjct: 234 EDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFS 293

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
           PPFH +Y+KPFRSVQIFQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPY
Sbjct: 294 PPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 353

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRDADVELCPG++I+DLMSKN+DV+VPNVWRPLP FL SEQPYDLNSWMES E L
Sbjct: 354 HSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGL 413

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LAK LDEDDVIVEGYAEYPTWRVHLAYIR+  G+PN+V+DLDGVGGVSIL KAKLFR+G
Sbjct: 414 ELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNG 473

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEI 488
           + FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EI
Sbjct: 474 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/420 (72%), Positives = 352/420 (83%), Gaps = 3/420 (0%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           L+D+EYY+YDFKN D  +++K+D GA+H+LIS+ G+EVLTPED  RYE+E++ LL  TV 
Sbjct: 27  LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVD 86

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDLSKY G+ENG +NR+HVLLCVPLR+A +VLPLMFK++MNLTYPHELIDLAFLVSDC+
Sbjct: 87  VYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCS 146

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQE---MXXXXXXXXXXXXXXXXMNKDYLKMVEDAY 257
           E D TL++LIAYS+ LQ+GTL+ LF E   M                MN+DYL MVE A+
Sbjct: 147 EDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAF 206

Query: 258 SPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKP 317
            PPFH DY+KPFRSVQ+FQKDFGQ +GQGF++RH+V VQGIRRKLMGRARNWL  NALKP
Sbjct: 207 KPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKP 266

Query: 318 YHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEA 377
           YH+WVYWRD D+ELCPG+VIEDLMS N DV VPNVWRPLPEFL  EQ YDLNSW+ES EA
Sbjct: 267 YHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEA 326

Query: 378 LKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRS 437
           LKLA  LDEDDVIVEGYAEYPTWRVHL YIR  + NP +++DLDGVGGVSIL KAKLFR+
Sbjct: 327 LKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRA 386

Query: 438 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           G+HFPAFTFENHAETEAFGKMAKKM +RVGGLPHYT+WHIYEPSDDDL EIA KERE  R
Sbjct: 387 GVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRR 446

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/508 (62%), Positives = 391/508 (76%), Gaps = 11/508 (2%)

Query: 1   MDFLLNNKRQLKKKDE---LPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVF 57
           M F   +KR+ +K D+   LP+S S+  PK+K        +    +   A+I++I FL+F
Sbjct: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60

Query: 58  ------ICQXXXXXXXXXXXXXHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLI 111
                 I                + +   L D  YYDYDF+N D  ++KKFD+G  +Y I
Sbjct: 61  KFLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKI 120

Query: 112 SKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171
           +++G E +T E+ +++EQE+  LL +TV+ YD+ ++ GT N  +N+EHVLLCVPLRDAE+
Sbjct: 121 TQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAEN 180

Query: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQE--MX 229
           VLPLMFK++MN+TYPHELIDLAFLVSDC+EGDHTL++LIAYSR LQ+GTL+ +F E  M 
Sbjct: 181 VLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMS 240

Query: 230 XXXXXXXXXXXXXXXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTE 289
                          M++DYL+ V+D++SPPFH +Y+K FRSVQIFQKDFGQ++GQGF++
Sbjct: 241 EKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSD 300

Query: 290 RHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMV 349
           RH+VKVQG+RRKLM RARNWL  NALKPYH+WVYWRDADVELCPG+VI+DLM+K++DVMV
Sbjct: 301 RHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMV 360

Query: 350 PNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIRE 409
           PNVWRPLP FL+ +QPYDLNSW+ES EAL LAK LDEDDVIVEGYAEYPTWR HLAY R+
Sbjct: 361 PNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRD 420

Query: 410 KNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 469
            NG+PN+VV+LDGVGGVSIL +A+LFR GIHFPAFTFENHAETEAFGKMAKKMGFRVGGL
Sbjct: 421 ANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 480

Query: 470 PHYTLWHIYEPSDDDLLEIASKERENNR 497
           PHYTLWHIYEPSDDDL EI +KERE  R
Sbjct: 481 PHYTLWHIYEPSDDDLKEIGNKEREKRR 508

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/508 (61%), Positives = 388/508 (76%), Gaps = 12/508 (2%)

Query: 1   MDFLLNNKRQLKKKDE---LPISDSRWAPKSKYRHKFNPANSENFVKINAIIT------L 51
           M+F+ N KR   KK     LP ++S +   S+ +  F P N +  +    II       L
Sbjct: 1   MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL 60

Query: 52  ILFLVFICQXXXXXXXXXXXXXHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLI 111
           ILFL+   +                    L D EYY++DF++ D  +++KFD GA+HYLI
Sbjct: 61  ILFLMLNFEFNASKLNKTIIDIAQKTIN-LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLI 119

Query: 112 SKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171
           S++G++VLTPED+  YE+E+  L  +T++ YDL  + G  NG +NR+HVLLC+PLRDA  
Sbjct: 120 SQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASH 179

Query: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXX 231
           VLPLMF+++MNLTYPHELIDLAFLVSDC+E D+TL++LI +S++LQ+GTL+ +  E+   
Sbjct: 180 VLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAF 239

Query: 232 XXXXXXXXXXX--XXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTE 289
                          M+ +YLK V+ A+SPPFH DY+KPFRSVQIF+K+FGQ +GQGF++
Sbjct: 240 TKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSD 299

Query: 290 RHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMV 349
           RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDAD+ELCPG+VIEDLM+K++DV+V
Sbjct: 300 RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIV 359

Query: 350 PNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIRE 409
           PNVWRPLP FL+ EQPYDLNSW ES EALKLA+ LDEDDVIVEGYAEYPTWRVHLAYIR+
Sbjct: 360 PNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRD 419

Query: 410 KNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 469
             GNP++VVD+DGVGGVSIL KAKLFRSG+ FPAFTFENHAETEAFGKMAKKMG++VGGL
Sbjct: 420 PQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGL 479

Query: 470 PHYTLWHIYEPSDDDLLEIASKERENNR 497
           PHYTLWHIYEPSDDDL E+A+KERE  R
Sbjct: 480 PHYTLWHIYEPSDDDLKEMANKEREERR 507

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/422 (69%), Positives = 365/422 (86%), Gaps = 5/422 (1%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           L++NEYY+YDF+  D  ++ KFD G +HYLIS++G++VLTP+D+ RYE E+++L  +TVQ
Sbjct: 89  LQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDSTVQ 148

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDL++++G+ +G  NR+HVL+CVPLRDAE+VLPLMFK++MNLTYPHELID+AFLVSDC+
Sbjct: 149 RYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCS 208

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXX-----MNKDYLKMVED 255
           + D+TLE+LIAYSR LQ+GTL+ +F EM                     M ++YL  VE 
Sbjct: 209 DDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKVEK 268

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
           A++PP+H +Y+KPFRSVQIF+K+FGQ +GQGF++RH+VKVQGIRRKLMGR+RNWL  NAL
Sbjct: 269 AFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANAL 328

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRDAD+ELCPG+VI+D+M+K++DV+VPNVWRPLPEFLN EQPYDLNSWMES 
Sbjct: 329 KPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESP 388

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
           EAL+LA+ LDEDDVIVEGYAEYPTWRVHLAYIR++ G+P++VVDLDGVGGVSIL +AKLF
Sbjct: 389 EALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLF 448

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKEREN 495
           R+G+ FPAFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL EIA+KERE 
Sbjct: 449 RNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREK 508

Query: 496 NR 497
            R
Sbjct: 509 RR 510

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/511 (61%), Positives = 380/511 (74%), Gaps = 30/511 (5%)

Query: 8   KRQLKKKDELPISDSRWAPKSKY--RHKFNPANSENFVKINAIITLILFLVFICQXXXXX 65
           K + K+KDELP + S+  PK     R + +PA          I+   L +  +C+     
Sbjct: 9   KEKQKQKDELPTTRSKLYPKKSVYDRKRRSPA-----FYWTCILATCLAIYLLCKATLGD 63

Query: 66  XXXXXXXXHTN------------------EAKILEDNEYYDYDFKNFDEPLVKKFDDGAK 107
                     N                   AK LED EYYDYDF++ DE     FD G +
Sbjct: 64  SSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQ 123

Query: 108 HYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLR 167
           HYLI++YG +V+T +DK RY QE++ LLS++V  YDLS++ GT NG +NREH+L   PLR
Sbjct: 124 HYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLR 183

Query: 168 DAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQE 227
           DAE VLP+MFK++MNLTYPHELID+AFLVSDC+EGD TL++LI ++RHLQDGTL  +F++
Sbjct: 184 DAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKD 243

Query: 228 MXXXXXXXXXXXXX-----XXXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQE 282
           M                     M+++Y+KM + +++ P HN+Y KPFRSVQIFQKDFGQ 
Sbjct: 244 MDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQI 303

Query: 283 VGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMS 342
           +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+VI+DLMS
Sbjct: 304 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 363

Query: 343 KNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRV 402
           KN+DV+VPNVWRPLPEFLN EQPYDLNSWMES EAL+LAK LDEDDVIVEGYAEYPTWRV
Sbjct: 364 KNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRV 423

Query: 403 HLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKM 462
           HLAY+R+ NG+PNQ +D+DGVGGVSIL KAKLFR G+HFPAFTFENHAETEAFGKMAKKM
Sbjct: 424 HLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKM 483

Query: 463 GFRVGGLPHYTLWHIYEPSDDDLLEIASKER 493
           G+ VGGLP+Y LWHIYEPSDDDL ++A+ ER
Sbjct: 484 GYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 344/419 (82%), Gaps = 1/419 (0%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
           L++ EYYDYDFK  D   +KK+D+G  HY+ISK G E L+ EDK  +E+E   LL++T  
Sbjct: 81  LDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTD 140

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDLS+Y+G  NG  NR+HVLLCVPLRDA  +LP++FKN+MNLTYPHELID+AFLVSDCT
Sbjct: 141 LYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCT 200

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXX-XXXXXXXXXXXXMNKDYLKMVEDAYSP 259
           +   T+ SL+ +S+ LQ+GTL+   Q+                  M KDYLKMV++A++P
Sbjct: 201 DNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNP 260

Query: 260 PFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYH 319
           PFH+DY+KPFRS+QIF+KDFGQ++GQGF++RH+VKVQG+RRKLMGRARNWL  NALKPYH
Sbjct: 261 PFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYH 320

Query: 320 AWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALK 379
           +WVYWRD DVELCPGTVIEDLM  ++DV+VPNVWRPLP FL   Q YDLNSW+ESNEA+K
Sbjct: 321 SWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIK 380

Query: 380 LAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGI 439
           LAK LDEDDVIVEGYAEYPTWRVHL Y+R+ NGNP+ ++DLDGVGGVSIL +A+LFR GI
Sbjct: 381 LAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGI 440

Query: 440 HFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498
           HFPAFTFENHAETEAFGKMAKKMGF+VGGL HYTLWHIYEPSDDDL EIA  ERE+ R+
Sbjct: 441 HFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/404 (71%), Positives = 335/404 (82%), Gaps = 3/404 (0%)

Query: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157
           +++KFD+GA+HYLISK G E+L   DK RYE+E++ LL +TV++YDL  + G+  G  NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217
           EHVLL VPLR+AE VLPLMFKN+MNLTYPHELIDLAFLVSDC+E D TLE+L+ Y + LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 218 DGTLAGLFQEMXXXXXXXXXXXXX---XXXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQI 274
            GTL+ +F                      M   YLKMV+DAYSPPFH  Y+KPFRSVQI
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 275 FQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPG 334
           FQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 335 TVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGY 394
           +VI+DLMS +FDV VPNVWRPLPEFL  EQPYDLNSW+ES+ AL+LA+ LDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 395 AEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEA 454
           AEYPTWRVHLAY+R+ + NP  +++LDGVGGVSIL KAKLFR+G+HFPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 455 FGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498
           FGKMAKKMG+RV GLPHYTLWHIYEPSDDDL++IA +ERE  RS
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/413 (69%), Positives = 341/413 (82%)

Query: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140
            +D  Y+ +DF++ D  +V KFD G  +YLIS+YG+E  +  D + Y   LQ LL +TV+
Sbjct: 98  FKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVE 157

Query: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200
            YDL  + G+ +G + +EH+L+CVPLRDAE+VLPLMFKN+MNLTYPHELIDLAFLVSDC+
Sbjct: 158 KYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCS 217

Query: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYSPP 260
           EGD TLE+L  YS+ LQ+G L  +  +M                M  DYLK V+ AY PP
Sbjct: 218 EGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPP 277

Query: 261 FHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHA 320
           FH +Y KPFRSVQIFQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM+NALKPYH+
Sbjct: 278 FHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHS 337

Query: 321 WVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKL 380
           WVYWRDADVELCPG+VIEDLM +++DV+VPNVWRPLP+FLNS QPYDLNSWMESNEAL+L
Sbjct: 338 WVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQL 397

Query: 381 AKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIH 440
           AK LDEDDVIVEGYAEYPT+RVHLAYIRE++G+P QVVDLDGVGGVSIL +A++FR G+H
Sbjct: 398 AKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVH 457

Query: 441 FPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKER 493
           F AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDLL +A  E+
Sbjct: 458 FSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/510 (60%), Positives = 383/510 (75%), Gaps = 27/510 (5%)

Query: 5   LNNKRQLKKKDELPISDSRWAPKSKYRHKFNPANSENFVK-INAIITLILFLVFICQXXX 63
           L+ K + K+K+     D R  PK     KF   N  + V   N  +++IL  +FI +   
Sbjct: 20  LSEKTKEKRKNR----DFRLLPKYS---KFKVTNFRDKVSNFNVALSVILLCIFIAKTIS 72

Query: 64  XXXXXXXXXXHTNE---------AKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKY 114
                       +E          ++L   EYY+YDF +++   + K+D G + YL+  Y
Sbjct: 73  VNVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTY 132

Query: 115 GSE---VLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171
            ++    L+ + K  Y+ EL +LLS++V  YD+  +SGT +G+ +REHVLLC+PLRDAED
Sbjct: 133 KTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAED 192

Query: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXX 231
           VLPLMFKN+MNLTYPHELID+AFLVSDC+E DHTLESL+ Y+R LQ+GTL  +F+EM   
Sbjct: 193 VLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKL 252

Query: 232 XXXXXXXXXXX-------XXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVG 284
                               M K+YL+ V++A+  PFH +Y+KPFRS+QI++KDFGQ VG
Sbjct: 253 DEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVG 312

Query: 285 QGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKN 344
           Q F++RH VKVQGIRRKLMGRARNWLMTNALKPYH+WVYWRDADVELCPGTVIEDLMSK+
Sbjct: 313 QSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKD 372

Query: 345 FDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHL 404
           FDV+VPNVWRPLPEF+NSEQPYDLNSWMES EA+ LAK L ED+VIVEGYAEYPTWRVHL
Sbjct: 373 FDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHL 432

Query: 405 AYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGF 464
           AY+REK+G+PNQVVD+DGVGGVSIL +A+LFR+G+HFPAFTFENHAETEAFGKMAKKMGF
Sbjct: 433 AYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGF 492

Query: 465 RVGGLPHYTLWHIYEPSDDDLLEIASKERE 494
           RVGGLPHYTLWHIYEPSDDDL+ IA+KE+E
Sbjct: 493 RVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/496 (59%), Positives = 364/496 (73%), Gaps = 17/496 (3%)

Query: 17  LPIS--DSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVFICQXXXXXXXX------ 68
           +P+S  +SR+ PK K +  F  +     V I +++T+      I Q              
Sbjct: 32  VPLSPQNSRYHPKVKGKFNFRLSYKLKNV-IVSLLTIACIFFLIKQTMDRNGSTPRSYAG 90

Query: 69  XXXXXHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYE 128
                 + +  +LE++EYY+++++  D   V+++DDG KH LI + G+  L    +  +E
Sbjct: 91  LLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFE 148

Query: 129 QELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHE 188
           + L  LLSTTV+ YDLSKY+GT NG +NREHVL+CVPLR+AE+VLPLMF+++MNLTYPHE
Sbjct: 149 EHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHE 208

Query: 189 LIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLA------GLFQEMXXXXXXXXXXXXXX 242
           LIDLAFLVSDC++ DHT++SLI+Y+  LQ GTL+        ++                
Sbjct: 209 LIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHL 268

Query: 243 XXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKL 302
             MNKDYL MVE+A   PFH +Y+KPFRSVQIFQKDFGQ +GQGF++RH VKVQG RRKL
Sbjct: 269 KYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKL 328

Query: 303 MGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNS 362
           MG+ARNWL  NALKPYH+WVYWRDADVELCPG+VIEDLMS  +DV+VPNVWRPLPEFL S
Sbjct: 329 MGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGS 388

Query: 363 EQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDG 422
           EQ YDLNSW+ES+ AL LAK LDEDDVIVEGYAEY TWR HLA  R+  GN   V+DLDG
Sbjct: 389 EQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448

Query: 423 VGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 482
           VGGVSIL KAKLFR+G+HF AF FENHAETEAFGKMAKKMG+RVGGL HYTLWHIYEPS+
Sbjct: 449 VGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSN 508

Query: 483 DDLLEIASKERENNRS 498
           DDL+EIA KER + RS
Sbjct: 509 DDLMEIARKERSSRRS 524

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/428 (63%), Positives = 334/428 (78%), Gaps = 9/428 (2%)

Query: 77  EAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLS 136
           E ++L+D EYYDY+F       + K+D+G +HY +++ G       D   +E++++EL+S
Sbjct: 61  EPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVS 117

Query: 137 TTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLV 196
            TV+ YDL  Y GT NG +NREHVL+C+PLR+A  VLP+MFK++MNLTYPHELID+AFLV
Sbjct: 118 ATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLV 177

Query: 197 SDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXX------XXMNKDYL 250
           SDC+E D TL+SL+ Y+ +LQ GTL  +                          M+++YL
Sbjct: 178 SDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYL 237

Query: 251 KMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWL 310
           +MV DA+SPP+H +YEKPFRSVQ+F+KDFGQ++GQGF++RH VKVQGIRR+LMGRARNWL
Sbjct: 238 QMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWL 297

Query: 311 MTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNS 370
             NALKPYH+WVYWRD DVELCPG+VIEDLMS  +DV+VPNVWRPLPEFL  +Q YDLNS
Sbjct: 298 TANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNS 357

Query: 371 WMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILV 430
           W+ES +AL LAK L+EDDVIVEGYAEY TWR HL   RE  GNP +V+DLDGVGGVSIL 
Sbjct: 358 WIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILA 417

Query: 431 KAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIAS 490
           KAKLFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD+++IA 
Sbjct: 418 KAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIAR 477

Query: 491 KERENNRS 498
           +EREN RS
Sbjct: 478 RERENRRS 485

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/337 (71%), Positives = 280/337 (83%), Gaps = 3/337 (0%)

Query: 164 VPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAG 223
           VPLR+A+ VLPLMFKN+MNLTYPHELIDLAFLVSDC+E D T E+L+ Y++ LQ GTL+ 
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 224 LFQEMXXXXXXXXXXXXX---XXXMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFG 280
           +F                      M   YLKMV+DA++PPFH +Y+KPFRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 281 QEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDL 340
           Q +GQ F++RH+VKVQG RRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+VIEDL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 341 MSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTW 400
           M+  +DV VPNVWRPLPEFL+ EQ YDLNSW+ES+ AL LAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 401 RVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAK 460
           RVHL YIRE++G+P   +DLDGVGGVSIL KA+LFR+G+HFPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 461 KMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           KMG+ V GLPHYTLWHIYEPSDDDL+++  +ERE+ R
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  384 bits (987), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 238/362 (65%), Gaps = 51/362 (14%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V  YDLS Y G ++G Q  + VL CVPLRDA + LP+ FK++ ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 199 CTEGDHTLESLIAYSRHLQ---DGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVED 255
            T  D T+  L+     LQ   DGT                                   
Sbjct: 110 ST--DDTMGVLLNSLHDLQSQADGT----------------------------------- 132

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
                      K F  ++IFQKDFGQ +GQ F++RH    QG RRKLM RARNWL + A+
Sbjct: 133 -----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAI 181

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRD DVE  P T++EDLM  + D++VPNVWRPLP++LN  QPYDLNSW+ES 
Sbjct: 182 KPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESE 241

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
             L+LA +L EDDVIVEGY EY TWRVHLAY+R+ NG+P   ++LDG+GGVSIL KAK+F
Sbjct: 242 GGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVF 301

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKEREN 495
           R+G HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDL  +A    E 
Sbjct: 302 RTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEE 361

Query: 496 NR 497
            R
Sbjct: 362 QR 363

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  379 bits (974), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/359 (51%), Positives = 239/359 (66%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           VQ YDL  Y G  +G Q  +HVL  VPLRDA + LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 53  VQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSD 112

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L+ Y                                        ++ A S
Sbjct: 113 SS--DDTMGVLLEY----------------------------------------LQKAQS 130

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
            P   D  + F +++I++KDFGQ +GQ F++RH    QG RRKLMGRARNWL + ALKPY
Sbjct: 131 KP---DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPY 187

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 188 HSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 247

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA++LDED VIVEGY EY TWR HLAY+R+ +G+P   ++LDG+GGVSIL KAK+FR+G
Sbjct: 248 QLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFRAG 307

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  +A    E  R
Sbjct: 308 SHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 366

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/359 (51%), Positives = 237/359 (66%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G ++G Q  + +L CVPLRDA + LP+ F ++  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D+T+  L++  ++ Q                                         
Sbjct: 142 SS--DNTMGVLLSNLQNAQS---------------------------------------- 159

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++IF+KDFGQ +GQ F++RH  K QG RRKLM RARNWL + A+KPY
Sbjct: 160 ---QQDRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIKPY 216

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 217 HSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 276

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA +LDED VIVEGY EY TWR HLAY+R+ NGNP   ++L+G+GGVSIL KAK+FRSG
Sbjct: 277 QLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFRSG 336

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK++++M F V GLPHY +WHIYEPS +DL  +A    E  R
Sbjct: 337 SHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEKR 395

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 237/359 (66%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G  +G Q  + VL  VPLRDA + LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L+ + +  Q  T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D +K F +++IF+KDFGQ +GQ F++RH    QG RRKLMGRARNWL + ALKPY
Sbjct: 133 -----DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPY 187

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   +
Sbjct: 188 HSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGM 247

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA++LDED VIVEGY EY TWR HLAY+R+ +GNP   ++LDG+GGVSIL KAK+FR+G
Sbjct: 248 QLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFRAG 307

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  +A    E  R
Sbjct: 308 SHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 366

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  374 bits (960), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 240/358 (67%), Gaps = 47/358 (13%)

Query: 138 TVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVS 197
           +V+ YD+S Y G ++G      +L+CVPL+DA + LPL FK +  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 198 DCTEGDHTLESLIAYSRHLQ-DGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDA 256
           D +  D+T+ +L+   + LQ DG  +G                                 
Sbjct: 114 DSS--DNTMYNLLNMLKRLQIDGGTSG--------------------------------- 138

Query: 257 YSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALK 316
                       F +++I++KDFGQ +GQGF++RH    QG RRKLMG+ARNWL T A+K
Sbjct: 139 -----------KFGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAIK 187

Query: 317 PYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNE 376
           PYH+WVYWRD DVE+ P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES  
Sbjct: 188 PYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 247

Query: 377 ALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFR 436
            L L+ +L ED VIVEGY EY TWR HLAY+R+ NG+P + ++LDGVGGVSIL KA +FR
Sbjct: 248 GLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVFR 307

Query: 437 SGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERE 494
           SG HFPAF+F+ HAETEAFGK++K M F V GLP+Y +WHIYEPS +DL  +A  E +
Sbjct: 308 SGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEK 365

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  374 bits (959), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 236/359 (65%), Gaps = 47/359 (13%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL+ Y+G  +G Q  + +L CVPLRDA + LP+ F ++  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D+T+  L+    HLQ                                         
Sbjct: 114 SS--DNTMGVLM---HHLQQA--------------------------------------- 129

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++IF+KDFGQ +GQ F++RH    QG RRKLM RARNWL + A+KPY
Sbjct: 130 ---QKDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPY 186

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE+ P +++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW+ES   L
Sbjct: 187 HSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGL 246

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA  L ED VIVEGY EY TWR HLAY+R+ NGNP   + LDG+GGVSIL KA++FR+G
Sbjct: 247 QLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFRAG 306

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+F+ HAETEAFGK++++MGF V GLPHY +WHIYEPS DDL  +A    E  R
Sbjct: 307 SHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEKR 365

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 237/354 (66%), Gaps = 45/354 (12%)

Query: 136 STTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFL 195
           + +V+ YDL  Y G ++G Q  + +L CVPLRDA + LP+ F ++  +TYPH LIDL+FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 196 VSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVED 255
           VSD +  D+T+  L++                                      L+M + 
Sbjct: 119 VSDSS--DNTMGVLLSN-------------------------------------LQMAQS 139

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
                   D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
             L+LA +LDED VIVEGY EY TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
           R+G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  374 bits (961), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/359 (50%), Positives = 236/359 (65%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL+ Y G  +G Q  + VL CVPLRDA + LP+ FK++  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L++  +  Q                                         
Sbjct: 142 SS--DDTMGVLLSSLKKAQS---------------------------------------- 159

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
              + D  + F +++IF+KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 160 ---NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 216

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  N DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 217 HSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 276

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA +L+ED VIVEGY EY TWR HLAY+R+ +G+P   ++LDG+GGVSIL KAK+FR+G
Sbjct: 277 QLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFRTG 336

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDL  +A    E  R
Sbjct: 337 SHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEKR 395

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  374 bits (959), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 231/356 (64%), Gaps = 45/356 (12%)

Query: 142 YDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTE 201
           YDL  Y G  NG Q  + +L CVPLRDA + LP+ FK++  +TYPH L+DL+FLVSD   
Sbjct: 70  YDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLVSDSK- 128

Query: 202 GDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYSPPF 261
            D T+  L++  +  Q                                            
Sbjct: 129 -DDTMGVLLSNLQTAQS------------------------------------------- 144

Query: 262 HNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAW 321
             D  K F +++ F+KDFGQ +GQ F++RH    QG RRKLM RARNWL + A+KPYH+W
Sbjct: 145 QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPYHSW 204

Query: 322 VYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLA 381
           VYWRD DVE  P T++EDLM    DV+VPNVWRPLPE+L + QPYDLNSW ES+  L+LA
Sbjct: 205 VYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQESDAGLELA 264

Query: 382 KNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHF 441
            +LD+D VIVEGY EY TWR HLAY+R+ NG+P   ++LDG+GGVSIL KA++FRSG HF
Sbjct: 265 DSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARVFRSGSHF 324

Query: 442 PAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           PAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL  +A    E  R
Sbjct: 325 PAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEQR 380

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  370 bits (951), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 186/360 (51%), Positives = 233/360 (64%), Gaps = 46/360 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ +DLS   G  +G    + VL CVPLRDA + LP+ FK++  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
               D T+  L  + R LQ                                        S
Sbjct: 102 SK--DETMSVLRQHVRELQ----------------------------------------S 119

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
            P   D  + F +++IFQKDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 120 QP---DNARQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 176

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T+IEDLM  + DV+VPNVWRPLP++L   QPYDLNSW+ES   L
Sbjct: 177 HSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEGGL 236

Query: 379 KLAKNL-DEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRS 437
           +LA +  DED VIVEGY EY TWRVHLAY+R+ NG+P   ++LDG+GGVSIL +A++FRS
Sbjct: 237 QLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVFRS 296

Query: 438 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           G HFPAF+F+ HAETE FGK+++ MG+ V GLPHY +WHIYEPS DDL  +A    E  R
Sbjct: 297 GSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEQR 356

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  372 bits (954), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 179/351 (50%), Positives = 232/351 (66%), Gaps = 45/351 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G ++G Q  + +L CVPLRDA + LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D+T+  L++  +  Q                                         
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 140 ---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DV+  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA  LDED VIVEGY EY TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+FR+G
Sbjct: 257 QLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
            HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +A
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  372 bits (955), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/351 (51%), Positives = 234/351 (66%), Gaps = 45/351 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G ++G Q  + +L CVPLRDA + LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D+T+  L++                                      L+M +    
Sbjct: 122 SS--DNTMGVLLSK-------------------------------------LQMAQS--- 139

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 140 ---QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA  LDED VIVEGY EY TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+FR+G
Sbjct: 257 QLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
            HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +A
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 231/351 (65%), Gaps = 45/351 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G ++G Q  + +L CVPLRDA + LP+ F ++  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D+T+  L++     Q                                         
Sbjct: 122 SS--DNTMGVLLSNLHKAQS---------------------------------------- 139

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 140 ---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA  L+ED VIVEGY EY TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+FR+G
Sbjct: 257 QLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
            HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +A
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 232/351 (66%), Gaps = 45/351 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL+ Y G ++G Q  + +L CVPLRDA + LP+ F ++  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L++  ++ Q                                         
Sbjct: 147 SS--DDTMGVLLSNLQNAQS---------------------------------------- 164

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++IF+KDFGQ +GQ F++RH    QG RRKLM RARNWL + A+KPY
Sbjct: 165 ---QQDKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPY 221

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 222 HSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 281

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA  L EDDVIVEGY EY TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+FR+G
Sbjct: 282 QLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 341

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
            HFPAF+FE HAETEAFGK+++KM + V GLPHY +WHIYEPS +DL  +A
Sbjct: 342 SHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  369 bits (946), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 233/359 (64%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G  NG Q  + V+ CVPLRDA   L + F  +  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+++L+++ R  Q                                         
Sbjct: 117 SS--DDTMKTLLSHLRRAQS---------------------------------------- 134

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
              + D  + F +++IF+KDFGQ VGQ F++RH    QG RRK M RARNWL + ALKPY
Sbjct: 135 ---NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALKPY 191

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H++VYWRD DV+  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW+ES   L
Sbjct: 192 HSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGL 251

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA +LDED  IVEGY EY TWR HLAY+R+ +G+P   ++LDG+GGVSIL KAK+FR+G
Sbjct: 252 QLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFRTG 311

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS DDL  +A    E  R
Sbjct: 312 SHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 370

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  368 bits (945), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/359 (50%), Positives = 236/359 (65%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G  +G Q  + +L CVPLRDA + LP+ F+++  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L++   HLQ                                        S
Sbjct: 122 SS--DDTMGVLLS---HLQ----------------------------------------S 136

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 137 AQSQMDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 196

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE  P T++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 256

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA+ L+ED VIVEGY EY TWR HLAY+R+ NG+P + ++LDG+GGVSIL KAK+FR+G
Sbjct: 257 QLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRTG 316

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS +DL  +A    E  R
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKR 375

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  372 bits (955), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 233/359 (64%), Gaps = 45/359 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V  YDL+ Y G  +G Q  + +L CVPLRDA   LP  F ++  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
               D T+  L++   HLQ                            NK           
Sbjct: 132 SK--DDTMGVLLS---HLQTAQ----------------------SQQNK----------- 153

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                   K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + ALKPY
Sbjct: 154 -------LKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 206

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE CP T++EDLM    DV+VPNVWRPLP++L + QPYDLNSW ES   L
Sbjct: 207 HSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 266

Query: 379 KLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSG 438
           +LA +LDED VIVEGY EY TWR HLAY+R+ NG+P + ++LDG+GGVSIL KAK+FRSG
Sbjct: 267 QLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRSG 326

Query: 439 IHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
            HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  +A    E  R
Sbjct: 327 SHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEKR 385

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  372 bits (954), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/354 (49%), Positives = 234/354 (66%), Gaps = 45/354 (12%)

Query: 136 STTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFL 195
           +  V+ YDLS Y G ++G Q  + +L C+PLRDA   LP+ F ++  +TYPH L+DL+FL
Sbjct: 63  TPGVEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFL 122

Query: 196 VSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVED 255
           VSD +  D T+  L+++ + +Q                                      
Sbjct: 123 VSDSS--DDTMGVLLSHLQTVQS------------------------------------- 143

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
                   D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM +ARNWL + AL
Sbjct: 144 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVAL 197

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRD D+E  P T++EDLM  + D++VPNVWRPLP++L + QPYDLNSW ES 
Sbjct: 198 KPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 257

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
             L+LA  LDE+ VIVEGY EY TWR HLAY+R+ NG+P   ++LDG+GGVSIL KAK+F
Sbjct: 258 GGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVF 317

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
           RSG HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  +A
Sbjct: 318 RSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  365 bits (936), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 228/350 (65%), Gaps = 45/350 (12%)

Query: 136 STTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFL 195
           +  V+ YDL  Y G ++G Q  + ++ CVPLRDA   LP  F ++  ++YPH LIDL+FL
Sbjct: 62  TPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFL 121

Query: 196 VSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVED 255
           VSD +  D T+  L++  +  Q                                      
Sbjct: 122 VSDSS--DDTMGVLLSNLQTAQS------------------------------------- 142

Query: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
                   D  K F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL + AL
Sbjct: 143 ------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375
           KPYH+WVYWRD D+E  P T++EDLM  + D++VPNVWRPLP++L + QPYDLNSW ES 
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
             L+LA  L+ED VIVEGY EY TWR HLAY+R+ NG+P   ++LDG+GGVSIL KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 485
           RSG HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  359 bits (921), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 228/360 (63%), Gaps = 46/360 (12%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G  +G Q    +L  VPLRDA   LP  F ++  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+  L+    HLQ                                         
Sbjct: 117 SS--DDTMGELL---HHLQIAQS------------------------------------- 134

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                D  K F +++IF+KDFGQ +GQ F++RH    QG RRKLM RARNWL +  LKPY
Sbjct: 135 ---QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLKPY 191

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVE+ P +++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   +
Sbjct: 192 HSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGI 251

Query: 379 KLAKNL-DEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRS 437
           +LA  L DED VIVEGY E+ TWR HLAY+R+ NGNP   ++LDG+GGVSIL KAK+FR+
Sbjct: 252 QLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 311

Query: 438 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497
           G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  +A    E  R
Sbjct: 312 GSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  360 bits (924), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 178/352 (50%), Positives = 231/352 (65%), Gaps = 46/352 (13%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V+ YDL  Y G  +G Q    +L  VPLRDA + LP  F ++  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            +  D T+ +L+++    Q                            NKD  +       
Sbjct: 123 SS--DDTMGALLSHLEKAQS---------------------------NKDKTRR------ 147

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                     F +++I++KDFGQ +GQ F++RH    QG RRKLM RARNWL T ALK Y
Sbjct: 148 ----------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALKAY 197

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEAL 378
           H+WVYWRD DVELCP +++EDLM  + DV+VPNVWRPLP++L + QPYDLNSW ES   +
Sbjct: 198 HSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEVGV 257

Query: 379 KLAKNLDEDD-VIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRS 437
           +LA +L +DD VIVEGY +Y TWR HLAY+R+ NGNP   ++LDG+GGVSIL K K+FR+
Sbjct: 258 QLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVFRT 317

Query: 438 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIA 489
           G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL  +A
Sbjct: 318 GSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  208 bits (530), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 186/344 (54%), Gaps = 50/344 (14%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T++ ++ +EHVL+  P++   D     + N++ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD TL+ L A  +++Q G                                 VED   
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGK--------------------------------VEDR-- 178

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                     F  + I ++D       G  ERHS+ VQ  RR  M  ARN L+ +++ P 
Sbjct: 179 ----------FAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFSSIGPS 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPL---PEFLNSEQPYDLNSWMESN 375
            +WV W DAD+   P TVI+D+ + N  V+  NV++      +  NS +PYD N+W ES 
Sbjct: 229 TSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWAESE 288

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
           + L++AKN++ED++IVEGYAE  T+R  +A+  +K G  + ++ LDGVGG   LVKA++ 
Sbjct: 289 KGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVH 348

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           R G  FP F F +  ETE F KMAK++ + + GLP+Y ++HI E
Sbjct: 349 RDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  201 bits (511), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 181/347 (52%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T N + N+E VL+  P++         + N+++LTYP  LI+L F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L +  R +Q G                                       
Sbjct: 153 TASGDAALQKLESAVREVQTG--------------------------------------- 173

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                  +K F  + I ++        G  +RH+++VQ  RR  M  ARN L+ + + P+
Sbjct: 174 -----KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +W+ W DAD+   P TVI+DL S N  V+  NV++   +F + +Q      PYD N+W 
Sbjct: 229 TSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYDFNNWA 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES   LKLA+ L ++++IVEGY+E  T+R  +A+  + NG  N +++LDGVGG   LVKA
Sbjct: 286 ESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  F  F F +  ETEAF KMAK++G+ V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  196 bits (498), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/347 (31%), Positives = 183/347 (52%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K + T+    N+E VL+  P++   D     + N++ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L  L A  +  Q G                           KD          
Sbjct: 153 TATGDTALRKLEAAVKRTQLG--------------------------KKD---------- 176

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                   + F  + I ++D          ERH++KVQ  RR  M  ARN L+ + + P+
Sbjct: 177 --------QRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLN------SEQPYDLNSWM 372
            +W+ W DAD+   P ++I+D+ + N  V+  NV++   +++N      +E+PYD N+W 
Sbjct: 229 TSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPYDFNNWA 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           +S +AL++A  + +D+V+ EGYAE PT+R  +A++ + +G+    + LDGVGG   LVKA
Sbjct: 286 DSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  192 bits (488), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 178/347 (51%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K + T+N   N+E VL+  P+++        + N++ LTYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              G+  LE L A  + +Q G     F ++                 ++ + K++E    
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITILRQA-----------SQSFDKLLEK--- 197

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                                         ERH+++VQ  RR  M  ARN L+ + + PY
Sbjct: 198 ------------------------------ERHALEVQKERRAAMALARNELLFSTIGPY 227

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +W+ W DAD+   P +VIED+ + N  V+  NV++    + + EQ      PYD N+W 
Sbjct: 228 TSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYDYNNWA 284

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES+  L+LA  +  D+++VEGY E  T+R  +A+  E +      ++LDGVGG   LVKA
Sbjct: 285 ESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCTLVKA 344

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
            + R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 345 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  188 bits (477), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 176/347 (50%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T +   N+EHVL+  P++         + N++ LTYP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L    + +Q    A  F ++                 ++ + K++E    
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSKITIMRQN-----------SQSFDKLMEK--- 198

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                                         ERH++ VQ  RR  M  ARN L+ + + P+
Sbjct: 199 ------------------------------ERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +WV W DAD+   P T+I+D+   N  V+  N+++    F + E+      PYD N+W 
Sbjct: 229 TSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYDFNNWQ 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES+  L++A  +D+D++IVEGYAE  T+R  +A+    N  P++ + LDGVGG   LVKA
Sbjct: 286 ESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  187 bits (476), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 179/347 (51%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T+    N+E VL+  P++   +     + NI+++TYP ELI+L F+   
Sbjct: 97  IAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFIAPR 153

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L A  + +Q G                          N+ + K++     
Sbjct: 154 TPTGDAALKKLEAAIKKIQSGK------------------------KNERFAKII----- 184

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                          I +++          +RH++ VQ  RR  M  ARN L+ + L P+
Sbjct: 185 ---------------ILRQESQSFDMLAEKDRHALAVQKQRRSAMALARNELLFSTLGPH 229

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE------QPYDLNSWM 372
            +WV W DAD+   P TVI+DL + +  V+  NV++    F N E      +PYD N+W 
Sbjct: 230 TSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYDFNNWQ 286

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES   L+LA +L  D++IVEGYAE  T+R  +A+  +++   ++ + LDGVGG   LVKA
Sbjct: 287 ESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGCTLVKA 346

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 347 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  187 bits (474), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 182/357 (50%), Gaps = 51/357 (14%)

Query: 127 YEQELQELLSTT-VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTY 185
           + + + E++S   +  +DL+K   T++   N+E VL+  PL+         ++NI+ L+Y
Sbjct: 84  FNEHIDEIISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSY 140

Query: 186 PHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXM 245
           P ELI+L F+V     GD  L+SL                                    
Sbjct: 141 PRELIELGFIVPRTQTGDLALQSL------------------------------------ 164

Query: 246 NKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGR 305
                   E A      +   + F  V I ++D          ERH++ VQ  RR  M  
Sbjct: 165 --------EKAVEKTQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMAL 216

Query: 306 ARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPL---PEFLNS 362
           ARN L+ + + P+ +WV W DAD+   P T+I+D+ + +  V+  NV++      +  ++
Sbjct: 217 ARNELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASA 276

Query: 363 EQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDG 422
            +PYD N+W ES   L+LA  +++D++IVEGY+E  T+R  +AY  +     ++ + LDG
Sbjct: 277 TRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDG 336

Query: 423 VGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           VGG   LVKA++ R G  FP+F F +  ETE F KMAK++G+ + GLP+Y ++HI E
Sbjct: 337 VGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  185 bits (469), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 174/346 (50%), Gaps = 54/346 (15%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T     N+E VL+  P++         ++N++ LTYP ELI+L F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPR 155

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              G++ L+ L    + +Q                                         
Sbjct: 156 TKTGENALKELEIAIKKVQS---------------------------------------- 175

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
               +   + F  + I ++D          +RHS+ VQ  RR  M  ARN L+ + L P+
Sbjct: 176 ----DKKNQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLFSTLGPH 231

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ-----PYDLNSWME 373
            AWV W DAD+   P TVI+D+ S +  V+  NV++    F N E+     PYD N+W E
Sbjct: 232 TAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIRPYDFNNWRE 289

Query: 374 SNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAK 433
           S+  L++A N+DE+++IVEGY+E  T+R  +A+    +G     ++LDGVGG   LVKA 
Sbjct: 290 SDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKAD 349

Query: 434 LFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 350 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  184 bits (467), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 180/350 (51%), Gaps = 62/350 (17%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T +   N+E VL+  P++   D     ++N++ LTYP ELI+L F++  
Sbjct: 94  IAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPR 150

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L++L A  + +Q                                         
Sbjct: 151 SDSGDAALKALEAAVKKVQT---------------------------------------- 170

Query: 259 PPFHNDYEKPFRSVQIFQKD---FGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315
               +   + F  + I ++D   FGQ + +   ERH++ VQ  RR  M  ARN L+ + +
Sbjct: 171 ----DKKNQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNELLFSTI 223

Query: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLN 369
            P+ +WV W DAD+   P TVI+D+ + +  V+  NV++    + + E+       YD N
Sbjct: 224 GPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEKKEKSIRAYDFN 280

Query: 370 SWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSIL 429
           +W ES+  L++A  +++D++IVEGY+E  T+R  +A+  +   + N  + LDGVGG   L
Sbjct: 281 NWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGCTL 340

Query: 430 VKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           VKA + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++H+ E
Sbjct: 341 VKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  184 bits (466), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 175/346 (50%), Gaps = 54/346 (15%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T + I ++EHVL+  P++   +     ++N++ L+YP ELI+L F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L    +++Q       F ++                             S
Sbjct: 153 SDAGDAALKKLETAVKNVQSDKKNNRFSKITILRQE-----------------------S 189

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
             F    EK                     ERHS+ VQ  RR  M  ARN L+ + L P+
Sbjct: 190 QSFDKLEEK---------------------ERHSLAVQKERRAAMALARNELLFSTLGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ-----PYDLNSWME 373
            +WV W D+D+   P TVIE +   +  V+  NV++    F N +Q     PYD N+W E
Sbjct: 229 TSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDNDKQQDSIRPYDFNNWAE 286

Query: 374 SNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAK 433
           S+  L+LA  + +D++IVEGYAE  T+R  +A+    +G+  + + LDGVGG   LVKA+
Sbjct: 287 SDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCTLVKAE 346

Query: 434 LFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           + R G  FP F F +  ETE F KMAK++ + V GLP++ ++HI E
Sbjct: 347 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  183 bits (465), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 175/352 (49%), Gaps = 60/352 (17%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           V  YDL+K   T +   N+E VL+  P++         + N++ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L A  +  Q                                         
Sbjct: 151 SASGDAALKQLEAAVKRAQT---------------------------------------- 170

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGF-----TERHSVKVQGIRRKLMGRARNWLMTN 313
               +     F  V I ++D      +GF      ERH++ VQ  RR  M  ARN L+ +
Sbjct: 171 ----DKKNNRFGKVTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARNELLFS 221

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVW-RPLPEFLN--SEQPYDLNS 370
            + P+ +WV W DAD+     ++I+D+ + N  V+  NV+ R   E  N  S +PYD N+
Sbjct: 222 TIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPYDFNN 281

Query: 371 WMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILV 430
           W +S  A +L   + +D++IVEGYAE  T+R  +A+    +G PN+++ LDGVGG   LV
Sbjct: 282 WADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLV 341

Query: 431 KAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 482
           KA++ R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 342 KAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  182 bits (463), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 173/349 (49%), Gaps = 60/349 (17%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T     N+EHVL+  P++         + N++ LTYP E  +L F++  
Sbjct: 97  IAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTELGFILPR 153

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            + GD  L  L A  + +Q                                         
Sbjct: 154 TSSGDIALSKLEAAVKKVQT---------------------------------------- 173

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGF-----TERHSVKVQGIRRKLMGRARNWLMTN 313
               +   + F  + I +++       GF      ERH+++VQ  RR  M  ARN L+ +
Sbjct: 174 ----DKKNQRFSKITILRQN-----SAGFDKLMEKERHALEVQKERRSAMASARNELLFS 224

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE---QPYDLNS 370
           +L P  +WV W DAD+   P  +I+D+ S N  V+  NV++   +    +   +PYD N+
Sbjct: 225 SLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNN 284

Query: 371 WMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILV 430
           W ES+ AL+LAK + +D+++VEGY +  T+R  +AY  +  G  N  ++LDGVGG   LV
Sbjct: 285 WQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLV 344

Query: 431 KAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           KA + R G  FP F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 345 KADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  181 bits (460), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 173/347 (49%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T     N+EH+L+  P++         + N++ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L    + +Q       F ++                 ++ + K++E    
Sbjct: 153 TATGDLALKKLENAIKKVQTDKKTQRFSKITILRQN-----------SQSFDKLMEK--- 198

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                                         ERH++ VQ  RR  M  ARN L+ + + P+
Sbjct: 199 ------------------------------ERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +WV W DAD+   P ++I+D+   N  ++  N+++    F + E+      PYD N+W 
Sbjct: 229 TSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYDFNNWQ 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES+  L++A  + +D++IVEGYAE  T+R  +A+  + NG P + + LDGVGG   LVKA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 182/349 (52%), Gaps = 60/349 (17%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K + T N   N+E VL+  P++   +     + N++ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            T GD+ L  L A  +  Q                           ++K           
Sbjct: 212 TTSGDNALRKLEAAVKKTQ---------------------------LSKK---------- 234

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGF-----TERHSVKVQGIRRKLMGRARNWLMTN 313
                  ++ F  + I ++D      Q F      +RH+++VQ  RR  M  ARN L+ +
Sbjct: 235 -------DQRFLKITILRQD-----SQSFDLLKEKDRHALEVQKKRRSAMALARNELLFS 282

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ---PYDLNS 370
            + PY +WV W DAD+   P T+I+D+ + +  V+  NV++   +    ++   PYD N+
Sbjct: 283 TIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNN 342

Query: 371 WMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILV 430
           W +S+ AL++A ++ +D V+ EGY E  T+R  +A+  ++  +P+  + LDGVGG   LV
Sbjct: 343 WADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLV 402

Query: 431 KAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           KA++ R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 403 KAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  181 bits (460), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 169/347 (48%), Gaps = 50/347 (14%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T     N+E VL+  P++   +     + N++ LTYP ELI+L F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPR 153

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L  L                                            E+A  
Sbjct: 154 TQSGDVALAKL--------------------------------------------EEAVK 169

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
               +   + F  V I ++D          ERH++ VQ  RR  M  ARN L+ + + P+
Sbjct: 170 KVQTDKKNQRFVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMALARNELLFSTIGPH 229

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE---QPYDLNSWMESN 375
            +WV W DAD+   P  +I+D+ + N  V+  NV++   +    E   + YD N+W ES 
Sbjct: 230 TSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNNWAESE 289

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
             L+LA  + ED++IVEGY+E  T+R  +AY  + NG+P   + LDGVGG   LV+A + 
Sbjct: 290 TGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLVQADVH 349

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 482
           R G  FP F F +  ETE F KMAK++   V GLP+Y ++HI E +D
Sbjct: 350 RDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  180 bits (456), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 175/347 (50%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T +   N+EHVL+  P++         + N++ L+YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L++L    + +Q       F ++                 ++ + K++E    
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKITILRQN-----------SQSFDKLME---- 197

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                                         ERH++ VQ  RR  M  ARN L+ + + P+
Sbjct: 198 -----------------------------KERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +W+ W DAD+   P ++I+D+   +  V+  N+++    F + E+      PYD N+W 
Sbjct: 229 TSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYDFNNWQ 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES+  L++A  + +D++IVEGYAE  T+R  +A+    +G PN+ + LDGVGG   LVKA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
            + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 346 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  179 bits (454), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 176/352 (50%), Gaps = 66/352 (18%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T +   N+E +L+  P++         ++N++ LTYP ELI+L F+   
Sbjct: 94  IAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPR 150

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L +L A    +Q                                         
Sbjct: 151 TPTGDQALAALEAAVDKVQS---------------------------------------- 170

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFT-----ERHSVKVQGIRRKLMGRARNWLMTN 313
               +   + F  V I ++D       GF      ERH+++VQ  RR  M  ARN L+ +
Sbjct: 171 ----DKKNQRFSKVTILRQD-----SVGFNKLTEKERHALEVQKERRASMALARNELLFS 221

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYD 367
            + P+ +WV W DAD+   P ++I+D+ + +  V+  NV++    + + E+      PYD
Sbjct: 222 TIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQKAIRPYD 278

Query: 368 LNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVS 427
            N+W ES+  L+LA  + +D++IVEGYAE  T+R  +AY  + + +  + + LDGVGG  
Sbjct: 279 FNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGC 338

Query: 428 ILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
            LVKA++ R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 339 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  178 bits (452), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/347 (30%), Positives = 174/347 (50%), Gaps = 56/347 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   T +   N+EH+L+  P++         + N++ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  L+ L +  + +Q       F ++                 ++ + K++E    
Sbjct: 153 TATGDSALKKLESAIKKVQTDKKTQRFSKITILRQN-----------SQSFDKLMEK--- 198

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                                         ERH+++VQ  RR  M  ARN L+ + + P+
Sbjct: 199 ------------------------------ERHALEVQKERRAAMALARNELLFSTIGPH 228

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQ------PYDLNSWM 372
            +WV W DAD+   P ++I+D+   N  V+  N+++    F + E+      PYD N+W 
Sbjct: 229 TSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASIRPYDFNNWQ 285

Query: 373 ESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKA 432
           ES+  L +A  + +D++IVEGYAE  T+R  +A+  + +   N+ + LDGVGG   LVKA
Sbjct: 286 ESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLVKA 345

Query: 433 KLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           ++ R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  176 bits (446), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/348 (30%), Positives = 175/348 (50%), Gaps = 59/348 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           +  YD++  + T + + N+E VL+  P++   D     ++N+++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
              GD  ++ L    + +Q G                          N+ +LK       
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSG------------------------KENQRFLK------- 180

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFT-----ERHSVKVQGIRRKLMGRARNWLMTN 313
                        + I ++D      Q F      ERH+  VQ  RR  M  ARN L+ +
Sbjct: 181 -------------ITILRQD-----SQSFNKLDEKERHAFNVQKERRAAMALARNELVFS 222

Query: 314 ALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE--QPYDLNSW 371
            + P  +W+ W DAD+   P TVI+D+ + +  ++  NV++   +  N E  +PYD N+W
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNW 282

Query: 372 MESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVK 431
            ES   L++A ++ +D++IVE Y E  T+R  +A + + NG+P+  + LDGVGG   LVK
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 432 AKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
           A++ R G  FP F F +  ETE F  MAK++ + V GLP+Y ++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  172 bits (436), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 165/342 (48%), Gaps = 53/342 (15%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           ++ YDL+    T     N E VL+  P++         + N++ LTYP + I L FL+  
Sbjct: 94  LREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFLLPR 150

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
            + G+  L  L    R +Q G                           KD          
Sbjct: 151 TSSGNTALRKLEKAVRKVQTGP--------------------------KD---------- 174

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                   + F  + I ++DF        + RH   VQ  RR  M  ARN L+ + + PY
Sbjct: 175 --------QRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFSTIGPY 226

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE---QPYDLNSWMESN 375
            +WV W D+D+   P T+IED+ S N  ++  NV++   E  N E   + YDLN+W ES 
Sbjct: 227 TSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLNNWAESE 284

Query: 376 EALKLAKNLDEDDVIVEGYA-EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKL 434
             LK+A  L ED +IVEGY  E+ T+R  +A++       ++++ LDGVGG   LVKA++
Sbjct: 285 LGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLVKAEV 344

Query: 435 FRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 476
            R G  FP F F +  ETE F KMAK++ + + GLP+Y ++H
Sbjct: 345 HRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  172 bits (436), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/341 (29%), Positives = 169/341 (49%), Gaps = 49/341 (14%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   + N  +N+EHVL+  PL+  E      + N++ L+YP + I+L F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
             +GDH+L+ L +  + +Q       F ++                              
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKITI---------------------------- 191

Query: 259 PPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPY 318
                          + Q   G E      E   ++ +   R  M  ARN L+ + L P 
Sbjct: 192 ---------------LRQNSKGFETVPEKKEVSEIEYEKQIRAEMALARNELLASTLGPQ 236

Query: 319 HAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE---QPYDLNSWMESN 375
            AW+ W D+D+   P ++I+D+   +  V+  NV+    +  + E   +PYD  +W+ES 
Sbjct: 237 TAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWIEST 296

Query: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435
           EAL+LA  + ED++IVEG A   T R  + +  +++G+P+  + LDGVG   +LVK+++ 
Sbjct: 297 EALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKSEVH 356

Query: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 476
           R G  FP F F +  E+E F KMAK++ + V GLP+Y ++H
Sbjct: 357 RDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  161 bits (407), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 179/346 (51%), Gaps = 56/346 (16%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           + +YDL+K   + N ++N+EHVL+  PL+  ++     ++N++NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 199 CTEGDHTLESLIAYSRHLQDGTLAGLFQEMXXXXXXXXXXXXXXXXMNKDYLKMVEDAYS 258
             +GD  L+ L    +++Q     G+ +++                 NK           
Sbjct: 159 TKKGDQILKQLENAVKNVQ-----GIDKKLGS---------------NK----------- 187

Query: 259 PPFHNDYEKPFRSVQIF-QKDFGQEVGQGFTER------HSVKVQGIRRKLMGRARNWLM 311
                     F  + I  QKD G      F +R      + ++++  +R  M  ARN L+
Sbjct: 188 ----------FAKITILRQKDSG---FHKFNDRKDKKEMNDIELEKEKRAEMALARNELL 234

Query: 312 TNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSE--QPYDLN 369
           ++ L    AW+ W D++V   P T+I+D+   +  V+  NV+       +    +PYD  
Sbjct: 235 SSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFR 294

Query: 370 SWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSIL 429
           +W+ES+ AL+LA  + ED++IVEG A   T R  +    E +G+P + + LDG+G    L
Sbjct: 295 NWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTL 354

Query: 430 VKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLW 475
           VK+++ R G  FP F F +  E+E F KMAK++ + V GLP+Y ++
Sbjct: 355 VKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 90/178 (50%), Gaps = 9/178 (5%)

Query: 300 RKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEF 359
           RK +   +N L+ + L PY +WV W D+ +   P T+++DL +    ++  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 360 LNSEQPYD---LNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQ 416
            NS+   D   LN+W+ S+    LA  +    V++EG +   T R  +    +   +   
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 417 VVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTL 474
            ++LD V     LVKA++ R G  FP F F +  ETE F +MA+ +  +  GLP+Y +
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 139 VQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSD 198
           +  Y+L++ + + +   + EH+L+ +PL +        F+N+  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 199 CTEGDHTLESL 209
                  L++L
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 89/203 (43%), Gaps = 21/203 (10%)

Query: 289 ERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVM 348
           +RH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    +++
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFLY-NRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 349 VPNVWRPLPEFLNSEQPYDLNSWM-ESNEALKLAKNLDEDDVI---VEGYAEYPTWRV-H 403
           VP + R     + S++ YD N+W+ E  +    +K  + +  +   V G  ++    V  
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNYESYVPRPVNGKTKFLQDCVDE 481

Query: 404 LAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTF----------ENHAETE 453
              +       + VV+LD VGG  +    K+F  GI FP F             +  ETE
Sbjct: 482 KITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDGVETE 541

Query: 454 AFGKMAKKMGFRVGGLPHYTLWH 476
                AK +G++  G+P+    H
Sbjct: 542 GLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 16/136 (11%)

Query: 331 LCPGT----VIEDLM----SKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNE-ALKLA 381
           LC G+    +I DL+    SK    +V  +W P P+  + +   D+ S M+ N+  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 382 KNLDEDDVIVEGYAEYPTWRVHLAYIREK-----NGNPNQVVDLDGVGGVSILVKAKLFR 436
            N +E   +    ++ PT       +  +     + N   ++    +G +S+  K K  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 437 SGIHFPAFTFENHAET 452
           +  HFPA+ F+  ++ 
Sbjct: 263 TYDHFPAYHFKTQSKV 278

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 417 VVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 476
           V++L+G G   I  KA LFR+     A  ++N  ++  FG    + GF  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 477 IYEPSDDDLLEIA 489
           IYE +     +IA
Sbjct: 272 IYESNGLRGFDIA 284

>KAFR0B00740 Chr2 (143264..145984) [2721 bp, 906 aa] {ON} Anc_7.462
           YPR042C
          Length = 906

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 334 GTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEG 393
            T+++ +  K+ D++   + R +  FL S   +   +W+   + +KLA N    ++IVEG
Sbjct: 563 NTIVQKIYDKSSDIIRDIILRKISPFLTSLGIHKSGTWV-CQKVIKLAHNPRSVNLIVEG 621

Query: 394 YAEYPT 399
             +Y T
Sbjct: 622 IKQYCT 627

>Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {ON}
           similar to Ashbya gossypii AGL209W
          Length = 986

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 392 EGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAE 451
           E + E+P W   L Y          VV+L+G G      KA LFR+     A  + +   
Sbjct: 229 EAFFEHP-WSKELLY----------VVNLEGTGAGG---KAVLFRTSDVSTASVYADAVR 274

Query: 452 TEAFGKMAKKMGFRVGGLPHYTLWHIYE 479
            + FG    + GF  G +   T + +YE
Sbjct: 275 QQPFGNSIYQQGFYTGNIGSETDFKVYE 302

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,060,251
Number of extensions: 2563143
Number of successful extensions: 7023
Number of sequences better than 10.0: 80
Number of HSP's gapped: 7127
Number of HSP's successfully gapped: 124
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)