Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.367.344ON31131116510.0
TPHA0F029207.344ON3202879171e-123
TDEL0C020307.344ON3113168731e-117
KLLA0D12474g7.344ON3123138151e-108
ZYRO0F11594g7.344ON3093108071e-107
SAKL0F11242g7.344ON3093118031e-106
YLR205C (HMX1)7.344ON3173147548e-99
Smik_12.2637.344ON3182797341e-95
Suva_10.2997.344ON3202847341e-95
Skud_12.2687.344ON3183127235e-94
Ecym_47297.344ON3263067227e-94
NDAI0E045007.344ON3273207227e-94
KLTH0H01386g7.344ON3073116912e-89
NCAS0E028907.344ON3153136661e-85
Kwal_56.246247.344ON3073126643e-85
KAFR0L014707.344ON3003016355e-81
KNAG0B026407.344ON3023076225e-79
ACL154W7.344ON3192875784e-72
CAGL0A03905g7.344ON2822655093e-62
YNL127W (FAR11)2.143ON95399703.2
Kpol_1046.31.434ON100632685.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.36
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   640   0.0  
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   357   e-123
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   340   e-117
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   318   e-108
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   315   e-107
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   313   e-106
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   295   8e-99
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   287   1e-95
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   287   1e-95
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   283   5e-94
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   282   7e-94
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   282   7e-94
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   270   2e-89
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   261   1e-85
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   260   3e-85
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   249   5e-81
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   244   5e-79
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   227   4e-72
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   200   3e-62
YNL127W Chr14 (383987..386848) [2862 bp, 953 aa] {ON}  FAR11Prot...    32   3.2  
Kpol_1046.3 s1046 complement(2177..5197) [3021 bp, 1006 aa] {ON}...    31   5.6  

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60
           MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT
Sbjct: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60

Query: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120
           IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS
Sbjct: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120

Query: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKF 180
           DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKF
Sbjct: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKF 180

Query: 181 EHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSK 240
           EHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSK
Sbjct: 181 EHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSK 240

Query: 241 DVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQF 300
           DVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQF
Sbjct: 241 DVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQF 300

Query: 301 TLASVLLNRYI 311
           TLASVLLNRYI
Sbjct: 301 TLASVLLNRYI 311

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 222/287 (77%), Gaps = 8/287 (2%)

Query: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64
           IPSPTDV ALANRINFETRDFHNK+ AFM IRLALAL+HGFIYR+GLV FYHIF TIE E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 65  IDLVLNNQD---DS---QMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118
           ID +LN  D   DS   Q K IL SFY++EFRRKD +L+DL +LYYPEF+ +R  +L+F+
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 119 NSDRFTNDS-EQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF 177
           NS+ F  ++  +L  F  YI+    E P T++AYCHVLYLALFAGGKIMKSNV K++G+F
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 178 PKFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIK 237
           PKF+H+SH+E+  +G+NF++FT     +  D KLR+ YKKNYELSTRDEL E QK  +I+
Sbjct: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTAD-FDSKLRFEYKKNYELSTRDELNEMQKNDIIE 245

Query: 238 TSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSIS 284
            SK++FVMLEN IAE+G +NR +LM  F+ K  T++VEEWKYN  ++
Sbjct: 246 VSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLT 292

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 229/316 (72%), Gaps = 13/316 (4%)

Query: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60
           +  TIP+PTDVGALANRINF TRD HNKV+A+M +RLA ALKHGFIYR+G++ FYHIF+ 
Sbjct: 4   VAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDA 63

Query: 61  IETEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEF 117
           +E E+D +LN   N ++ QM+ +L  F+L+EFRR ++I KDLE+LY PE+ +D   L  F
Sbjct: 64  VEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEY-SDSESLRNF 122

Query: 118 INSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF 177
           +        + QLQ+FV  I +   +D CT+LAYCHVLYLALFAGGK+M+SN+ +H G+F
Sbjct: 123 VEHQPL---APQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF 179

Query: 178 PKFEHLSHKEIIARGTNFYQFTDSTNPETTDV--KLRWLYKKNYELSTRDELLEQQKLTV 235
           PKFE+L+ KE++ RGTNF+ F+D    E +D   KLRW YK+ YEL+TR EL E QK  +
Sbjct: 180 PKFEYLTPKELVIRGTNFFTFSD----EGSDAENKLRWKYKEGYELATRQELSESQKTRI 235

Query: 236 IKTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFIL 295
           ++ S  +F    + I E+G  NRNELM+ FS+KL T++ EEWKY++ +S   K S++ + 
Sbjct: 236 LQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMA 295

Query: 296 IIIQFTLASVLLNRYI 311
           I+IQF +A ++L ++I
Sbjct: 296 ILIQFLVAYIVLRKFI 311

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  318 bits (815), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 219/313 (69%), Gaps = 9/313 (2%)

Query: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61
            +TIPSPTDVGALANRINF+TRD HNK++A+M +++A A++HGFIYR+G+V +Y++F+ I
Sbjct: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65

Query: 62  ETEIDLVLNNQ---DDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118
           E EID +L +     D ++K IL  F+ +EFRR DK++ DL++LY  E+     QL EF+
Sbjct: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSE-QLQEFL 124

Query: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178
           +  +      +LQ FV  I +N  ++P T+LAYCHVLYLALFAGG++MKSN+ +H+G+FP
Sbjct: 125 DGFQL---PAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFP 181

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238
           KF HLS KE++ R TNF+ F++    +    +LRW YKK YEL+TR EL E +KL +I+ 
Sbjct: 182 KFGHLSPKELVRRATNFFTFSEEGVDDEN--RLRWQYKKGYELATRTELTEAEKLRIIEV 239

Query: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298
           S+ +F      +AE+G  NR ELM  FSYKL +F+ EEWKY+  ++P +KK ++F LI+ 
Sbjct: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVF 299

Query: 299 QFTLASVLLNRYI 311
                  +L R I
Sbjct: 300 NMVFVYTILRRLI 312

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  315 bits (807), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 220/310 (70%), Gaps = 8/310 (2%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           +TIP+PTDVGALANRINF TRD HNK++A+M +RLA ALKHG+I+R+G++ +Y+IF  IE
Sbjct: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61

Query: 63  TEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            E+D +++   N+ + QM+ +L  F++++FRR D+I +DL LLY PEF  +   L +F+ 
Sbjct: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTE-SSLEQFLT 120

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
           S    + +  LQ FV  I  N  E+PCT+LAYCHVLYLALFAGGK+M+SN+ +H G+FPK
Sbjct: 121 SG--NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPK 178

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           F+HLS +E++ RGTNF+ F++  +    + KLRW YK+ YEL+TRDEL E+QK  +I  S
Sbjct: 179 FQHLSPRELVQRGTNFFTFSEEGS--EAENKLRWRYKRGYELATRDELTEEQKQKIISVS 236

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQ 299
            ++F      IAE+G  NR ELM   S++L T++ EEWK+   +S   K  L+  ++++Q
Sbjct: 237 SEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQ 296

Query: 300 FTLASVLLNR 309
           F +  ++L R
Sbjct: 297 FLIVYLVLRR 306

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  313 bits (803), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 216/311 (69%), Gaps = 9/311 (2%)

Query: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61
            +TIPSPTDVGALANRINF TRD HNK++A M ++LA A+KHG IYR+G++ FY+IF  +
Sbjct: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62

Query: 62  ETEIDLVLNNQD---DSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118
           E EID +L N     + Q + IL+ F+ +EFRR + I +DLELLY  E+ + R +L  F+
Sbjct: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEY-STRTELHAFL 121

Query: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178
           + +       Q Q FV+YI     E P T+LAYCHVLYLALFAGGK+MKSN+ +H G+FP
Sbjct: 122 DDNVL---PPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFP 178

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238
           KF+HL+ ++I+ RGTNF+ F++       + KLRW YKK YEL+TR EL E+QK  +IK 
Sbjct: 179 KFQHLTPEQIVRRGTNFFTFSEEG--ADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236

Query: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298
           S ++F    + I E+G  NRNELM  FS+KL +FI+EEWKY+  +S   K +++ I  I+
Sbjct: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAIL 296

Query: 299 QFTLASVLLNR 309
           QF LA  LL +
Sbjct: 297 QFLLAYWLLRK 307

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  295 bits (754), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 216/314 (68%), Gaps = 11/314 (3%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           + IPSPTDVGALANRINF+TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ IE
Sbjct: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 63  TEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            EID +LN+   +++ Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ 
Sbjct: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE-SLNEFLA 125

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
           + +       LQ F+  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP 
Sbjct: 126 TFQ---KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 182

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           FE LS KE++ +GTNF+ F+D    E T  +L+W YKKNYEL+TR EL E QKL +I  +
Sbjct: 183 FEKLSQKELVKKGTNFFTFSDLGPTEET--RLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYN--SSISPFLKKSLMFILII 297
           + +F    N +AE+G  NR ELM  FS+K  T++ EEW +N  S+    L   ++ +L I
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300

Query: 298 IQFTLASVLLNRYI 311
           I   +   L+  ++
Sbjct: 301 IAIWVLYFLVKSFL 314

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 142/279 (50%), Positives = 196/279 (70%), Gaps = 9/279 (3%)

Query: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64
           IPSPTD+GALANRINF TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ IE E
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 65  IDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSD 121
           ID +LN+     + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ + 
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE-SLNEFLAT- 126

Query: 122 RFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFE 181
                   LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP FE
Sbjct: 127 --FEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184

Query: 182 HLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSKD 241
            LS KE++ +GTNF+ F+D    E T +KL   YKKNYEL+TR EL E QKL +I  ++ 
Sbjct: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKLE--YKKNYELATRTELTEAQKLQIISVAEG 242

Query: 242 VFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYN 280
           +F    N +AE+G  NR ELM  FS+K  T++ EEW +N
Sbjct: 243 IFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFN 281

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 202/284 (71%), Gaps = 9/284 (3%)

Query: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61
           ++ IPSPTD+GALANRINF TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ I
Sbjct: 8   STIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAI 67

Query: 62  ETEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118
           E EID +LN+   + + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+
Sbjct: 68  EQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE-SLNEFL 126

Query: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178
            +         LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP
Sbjct: 127 AT---FEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFP 183

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238
            FE L+ KE++ +GTNF+ F++   P T + +L+W YKKNYEL+TR EL E QKL +I  
Sbjct: 184 NFEKLTQKELVKKGTNFFTFSE-LGP-TEETRLKWEYKKNYELATRTELTEAQKLKIISV 241

Query: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSS 282
           ++ +F    N +AE+G  NR ELM+ FS+K  T++ EEW ++  
Sbjct: 242 AEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKG 285

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  283 bits (723), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 209/312 (66%), Gaps = 11/312 (3%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           + IPSPTDVGALANRINF TRD HNK++ FMGIR+A+A++HGFIYR+G++ +Y++F+ IE
Sbjct: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 63  TEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            EID +L++   + + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ 
Sbjct: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTE-SLNEFLA 125

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
                     LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP 
Sbjct: 126 K---FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 182

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           FE LS KE++ +GTNF+ F+D    E T +KL   YKKNYEL+TR EL E QKL +I  +
Sbjct: 183 FERLSQKELVKKGTNFFTFSDLGPTEETRLKLE--YKKNYELATRTELTEAQKLQIISVA 240

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEW--KYNSSISPFLKKSLMFILII 297
             +F    + +AE+G  NR ELM  FS+K  T++ EEW    +S+       +++ +L I
Sbjct: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300

Query: 298 IQFTLASVLLNR 309
           I   +  +L+ +
Sbjct: 301 IAVWVIYLLVKK 312

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  282 bits (722), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 204/306 (66%), Gaps = 19/306 (6%)

Query: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64
           IPSPTDVGALANRINF TRD H K  AF+  ++ALA++HGFIYR+G++ FY+IF+ +E +
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 65  IDLVL---NNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEF--QNDRPQLLEFIN 119
           ID +L   + +++ Q+  IL  F+ +EFRR  ++L+DLE  Y+ E+  QN+  Q L    
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFL---- 137

Query: 120 SDRFTNDSE---QLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGI 176
                ND E   +LQ FV +I+    E+P T+LAYCHVLY ALFAGGK+M+SN+ +++G+
Sbjct: 138 -----NDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGL 192

Query: 177 FPKFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVI 236
           FPK + +S  E    GTNF+ F+D    E    KLRW YKKNYEL+TR+ L E QKL +I
Sbjct: 193 FPKPKGISAAESSRNGTNFFTFSDDGVDEEN--KLRWQYKKNYELATREGLDENQKLEII 250

Query: 237 KTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILI 296
             S   F  + + + E+G  N+ ELMNIFS+KL TF+  EW+YN  +S  +K++L   + 
Sbjct: 251 DVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVF 310

Query: 297 IIQFTL 302
            I F +
Sbjct: 311 FINFLM 316

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  282 bits (722), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 212/320 (66%), Gaps = 17/320 (5%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           + IPSPTD  ALANRINF TRD HNK+   M ++LA+AL+HG IYR+G++ +Y+IF  +E
Sbjct: 7   TIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVE 66

Query: 63  TEIDLVLNNQDDS-----QMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEF 117
           +EI+ +L+   D+     +   +LS  +L EF R DK+ KDL+LLY   FQND+  LL F
Sbjct: 67  SEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQD-LLNF 125

Query: 118 INSD---RFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHL 174
           IN +      N + +L  FV +I  +   +PC +LAYCHVLYLALFAGGKI+KS + K+L
Sbjct: 126 INEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNL 185

Query: 175 GIFPKFEHLSHKEIIARGTNFYQFTDST------NPETTDVKLRWLYKKNYELSTRDELL 228
           G  P F HLS KE+    TNF+QFT+++      N  + + KL+  +K+N+EL+TR  L 
Sbjct: 186 GFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLN 245

Query: 229 EQQKLTVIKTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLK 288
           E +KLT+I+ +K +F      + E+G RN+ ELMN+FS+KL  ++ EEWK+N SI    K
Sbjct: 246 ENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305

Query: 289 KSLMFI--LIIIQFTLASVL 306
             LMF+  L++IQF ++  L
Sbjct: 306 AILMFVILLLLIQFFVSRSL 325

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  270 bits (691), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 9/311 (2%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           +TIPSPTDVGALANRINF TRD HNK+   M  + A A+KHGFIYR+G++ F+++F  IE
Sbjct: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61

Query: 63  TEIDLV---LNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            E+D +       ++ Q + IL+ F+ +EFRR  +IL+DLELLY  EF      L  F+ 
Sbjct: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTS-ASLRTFLE 120

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
               T  + +LQ FV Y+  +    P  +LAYCHVLYLALFAGG++M+S + +  G+FPK
Sbjct: 121 E---TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPK 177

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           F +L+ +E++ RGTNF+ F+D+      + +LR  YK+ YEL+TR  L E+QKL ++  S
Sbjct: 178 FPNLTTEEVVRRGTNFFTFSDAGV--QAENQLRKNYKRGYELATRQGLTEEQKLNILDVS 235

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQ 299
             +F      + E+G  NR ELM   S++L TF++EEW+Y+  ++   K  ++   +++Q
Sbjct: 236 NAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQ 295

Query: 300 FTLASVLLNRY 310
             +   +L ++
Sbjct: 296 ILMMYWVLRKF 306

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  261 bits (666), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 208/313 (66%), Gaps = 8/313 (2%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           + IPSPTD  ALANRINF+TRD HNK++  M I+LA+AL+HGFIYR+G++ +Y+IF  +E
Sbjct: 7   TIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVE 66

Query: 63  TEI-DLVLNNQDDSQMKL--ILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            EI  L  +     ++K+  +LS  ++ EF R + +LKDL+LLY+ E+     + L+   
Sbjct: 67  EEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTK--EALQLFL 124

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
               T     L +F+KYI  +  E+PC++ AYCHVLYLALFAGGKI++S + K+LG  P 
Sbjct: 125 ETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPN 184

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           F HLS KE+  +GTNF++F      E T +KL   +KKNYEL+TR+ L E++K  +I+TS
Sbjct: 185 FNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLE--FKKNYELNTRESLNEKEKSIIIETS 242

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSS-ISPFLKKSLMFILIII 298
           K +F      + E+G+ N+ +LM+  ++K+ T+++EEWK+N + +S   K  +M +++++
Sbjct: 243 KKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLL 302

Query: 299 QFTLASVLLNRYI 311
               A  +L R++
Sbjct: 303 HMLFAFFILKRFL 315

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  260 bits (664), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 200/312 (64%), Gaps = 9/312 (2%)

Query: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62
           STIPSPTDVGALANRINF TRD HNK+   M ++ A A+KHGFIYR+GL+ F+++F  IE
Sbjct: 2   STIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIE 61

Query: 63  TEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119
            EID +L N    ++ Q + IL  F++  F R  +I +DL+LLY  EF +D  QL  F+ 
Sbjct: 62  QEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDE-QLSLFLQ 120

Query: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179
            +  T   EQ Q FV ++  +    P ++LA+CHVLYLALFAGG++M+S + +  G+FPK
Sbjct: 121 QN--TLPPEQ-QGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPK 177

Query: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239
           F  L+ +E++ +GTNF+ F+D  +    + +LR  YK+ YEL+TR+ L E QKL +++ +
Sbjct: 178 FPDLTPEEVVRKGTNFFTFSD--DGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVA 235

Query: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQ 299
              F      I+E+G  NR ELM   S+KL +F ++EWK+   ++   K  ++    +IQ
Sbjct: 236 AATFEWNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQ 295

Query: 300 FTLASVLLNRYI 311
             +   +L +++
Sbjct: 296 ILVMYWMLRKFL 307

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  249 bits (635), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 195/301 (64%), Gaps = 19/301 (6%)

Query: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60
           M   +PSPTD  ALANRINF TRD HN +   M I+   AL+H FIY++ L+ +Y++F T
Sbjct: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60

Query: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120
           +E EID +++N D S +  IL  F+ D+FRRKD+ILKDL+ L   + Q+D          
Sbjct: 61  LEDEIDFIISN-DRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSD---------- 109

Query: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF--P 178
           D++ +   +L  F+ +I++N  E P  +LAYCHVLYLALFAGG+IM++++ K+L  F  P
Sbjct: 110 DQWLSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMP 169

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238
           KF+ +SH ++I   TNF++F      E    KL+  YK+NY++ T+ +L E +KL +I  
Sbjct: 170 KFDKMSHTDVIMNATNFFKFDKDIVSEN---KLKSEYKRNYDILTKAKLNEDEKLEIIDI 226

Query: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298
           S+++F    N + E+GT N++ELM  F+YK+ T++VEEWK+     P +KK ++  LII 
Sbjct: 227 SREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFR---KPQIKKYVILFLIIF 283

Query: 299 Q 299
            
Sbjct: 284 H 284

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 186/307 (60%), Gaps = 24/307 (7%)

Query: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60
           M STIPSPTD  ALANRINF TRD HN+V     ++  +AL+H FIY + L  FY +F T
Sbjct: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60

Query: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120
           +E  ID ++ ++    +  IL  FY+ EFRR DKI +D  L++  E+          + S
Sbjct: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDT--------VES 110

Query: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKF 180
            ++T    QL  F++Y+++    DP T+LA CHVLYLALFAGG++ KS++ K+LG  P F
Sbjct: 111 GQWT-PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNF 169

Query: 181 -------EHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKL 233
                  E +S   +++  TNF+QF ++   E    KLRW YK+NYEL+TRD L E QKL
Sbjct: 170 RDKNGPGEEMSDHTLVSNATNFFQFAETIEDEN---KLRWTYKRNYELATRDTLTEDQKL 226

Query: 234 TVIKTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMF 293
            VI  S+DVF      I E+  +N +ELM+  S+K+ T+ +EEWK+N +   F +  L  
Sbjct: 227 AVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKN---FKRGVLWG 283

Query: 294 ILIIIQF 300
           +  + QF
Sbjct: 284 VAFLAQF 290

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  227 bits (578), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 174/287 (60%), Gaps = 10/287 (3%)

Query: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61
           +  +P PTD GALANRINF TR+ H+K  AF+  + A+AL+H  IYR+GL+  Y+IF ++
Sbjct: 15  SPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSV 74

Query: 62  ETEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118
           E  ID +L      D++++  IL +F+  EF R   +++D E+ Y  E+     QL +F+
Sbjct: 75  EQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTS-AQLHQFL 133

Query: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178
           +S        +L   V  I+  A   P T+LA+CHVLYLALFAGG++M+S +++ LG+ P
Sbjct: 134 DSYEL---PPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLP 190

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238
           +   LS +E   RGT+F+ F      E    K R  YK+ YEL+TR  L E +K  VI  
Sbjct: 191 RAAGLSARETQLRGTHFFTFGAGAGEEN---KARVAYKRAYELATRTALSEAEKADVIDA 247

Query: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISP 285
           ++  F  ++  +AE+  RNR EL+   SY+L TF+ EEW+Y +  SP
Sbjct: 248 ARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSP 294

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  200 bits (509), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 160/265 (60%), Gaps = 30/265 (11%)

Query: 33  MGIRLALALKHGFIYREGLVVFYHIFNTIETEIDLVLN---------NQDDSQMKL---- 79
           M +R A+AL+HG +YR+G++ FY++F  IE EID +L+           D S  KL    
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 80  ILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSDRFTNDSE---QLQNFVKY 136
           I+  F++ EFRR +++ KDL LLY PE+    P   E    D    D +   QLQ FV  
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEY----PTSTEL---DAMLVDHQLPPQLQGFVDM 113

Query: 137 IQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFEHLSHKEIIARGTNFY 196
           +     ++P T+LAYCHV+YLALFAGGK+M+S + ++ G+FPKFEHLS KE+  +GTNF+
Sbjct: 114 VHATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFF 173

Query: 197 QFTDSTNPETTDV--KLRWLYKKNYELSTRDELLEQQKLTVIKTSKDVFVMLENCIAEVG 254
            F+D+      DV  +L+W YKKNYEL+TR+ L E  KL +I  +K +F    + I E+G
Sbjct: 174 TFSDA----GVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIG 229

Query: 255 TRNRNELMNIFSYKLFTFIVEEWKY 279
             N+  L N     L  ++ EE K+
Sbjct: 230 QLNKEALTNN-KLDLLQYVFEELKF 253

>YNL127W Chr14 (383987..386848) [2862 bp, 953 aa] {ON}  FAR11Protein
           involved in recovery from cell cycle arrest in response
           to pheromone, in a Far1p-independent pathway; interacts
           with Far3p, Far7p, Far8p, Far9p, and Far10p; has
           similarity to the N- and C-termini of N. crassa HAM-2
          Length = 953

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 10/99 (10%)

Query: 217 KNYELSTRDEL--LEQQKLTVIKTSKDVFVMLENCIAEVGTRNR--NELMNIFS----YK 268
           K   +S RD+   L++Q + +  +S  ++ +   CI   G      N +++ F      +
Sbjct: 332 KKIAISCRDDNRNLKKQTILLFHSSTILYFICSICIEGRGENPEAVNVVIDAFEKTDLLE 391

Query: 269 LFTFIVEEWKYNSSISPFLKK--SLMFILIIIQFTLASV 305
             T  +E W++NS ++  ++   SL+F LI++QF  +SV
Sbjct: 392 FLTKYIENWRWNSRLAMRIRNMISLLFKLIVLQFGDSSV 430

>Kpol_1046.3 s1046 complement(2177..5197) [3021 bp, 1006 aa] {ON}
           complement(2177..5197) [3021 nt, 1007 aa]
          Length = 1006

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVK 210
           KF+ LS  E+   G + Y FT S+ PE  D+K
Sbjct: 933 KFQVLSDNEVEEYGEDLYSFTHSSEPENEDMK 964

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,261,563
Number of extensions: 1603605
Number of successful extensions: 5403
Number of sequences better than 10.0: 57
Number of HSP's gapped: 5539
Number of HSP's successfully gapped: 57
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)