Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.357.346ON42542522340.0
TPHA0F029307.346ON43640518020.0
TDEL0C020207.346ON42540618010.0
Suva_10.2977.346ON43640417700.0
Skud_12.2667.346ON43640417670.0
SAKL0F11286g7.346ON42341517640.0
Smik_12.2617.346ON43640417650.0
YLR203C (MSS51)7.346ON43640417530.0
NCAS0E028807.346ON42940516980.0
ZYRO0F11616g7.346ON41540816820.0
Kwal_56.246317.346ON42241216800.0
KLLA0D12430g7.346ON41840516800.0
KLTH0H01342g7.346ON42240716780.0
CAGL0A03927g7.346ON43742416710.0
NDAI0E044807.346ON44340416650.0
Ecym_47277.346ON42940616490.0
KNAG0B026307.346ON43842016160.0
TBLA0E005007.346ON43742315640.0
KAFR0B008407.346ON42640715550.0
NCAS0A141207.346ON42741815370.0
NDAI0A019307.346ON45042615190.0
KNAG0C037507.346ON42440415060.0
ACL152W7.346ON42841414860.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.35
         (425 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   865   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   698   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   698   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   686   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   685   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   684   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   684   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   679   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   658   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   652   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   651   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   651   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   650   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   648   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   645   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   639   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   627   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   607   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   603   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   596   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   589   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   584   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   577   0.0  

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/425 (97%), Positives = 414/425 (97%)

Query: 1   MSTAVKLPMRLGAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDL 60
           MSTAVKLPMRLGAGSYSLIQKRSLMGFVRNALGL           ENRFHPWDQSPCVDL
Sbjct: 1   MSTAVKLPMRLGAGSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDL 60

Query: 61  RERAAKIRTLAKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYE 120
           RERAAKIRTLAKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYE
Sbjct: 61  RERAAKIRTLAKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYE 120

Query: 121 HDLRSGRPFPEFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITI 180
           HDLRSGRPFPEFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITI
Sbjct: 121 HDLRSGRPFPEFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITI 180

Query: 181 GSLLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGAR 240
           GSLLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGAR
Sbjct: 181 GSLLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGAR 240

Query: 241 AEAQLPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFH 300
           AEAQLPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFH
Sbjct: 241 AEAQLPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFH 300

Query: 301 PDYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFS 360
           PDYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFS
Sbjct: 301 PDYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFS 360

Query: 361 KQDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY 420
           KQDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY
Sbjct: 361 KQDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY 420

Query: 421 HAIEV 425
           HAIEV
Sbjct: 421 HAIEV 425

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/405 (78%), Positives = 363/405 (89%), Gaps = 1/405 (0%)

Query: 20  QKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79
           QKRSLMGFV+NALGL           ENRFHPWDQSP  DLRERAA+IRTLAKCPVT K+
Sbjct: 32  QKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91

Query: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           INYTCPLSGIPTHH +EAW  DKDYH+SKRYEILKKVNIYEHDLRSGRPFPEFDFP DQ 
Sbjct: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151

Query: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199
           +DR++NLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LHQFSPYSLNPKGP+T
Sbjct: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211

Query: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259
           LEGLKSLAALRY+LYP+Q KS N+ +   DRPMRIFILGARAEAQLPGHVWKQ Q+LFP+
Sbjct: 212 LEGLKSLAALRYSLYPFQRKS-NISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPD 270

Query: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319
           Q FEIHFIG EC LN EKN+YI S+ P+VKK+D+T+KL++H DYFHV+HEAQDF PYDP+
Sbjct: 271 QTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPY 330

Query: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379
           LDVFFTFHPG+A PET+++W+G+TMKALL+TKCAIFTTGF+KQD+  D+++VK RYG E+
Sbjct: 331 LDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEM 390

Query: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           D LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 391 DTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/406 (79%), Positives = 361/406 (88%), Gaps = 3/406 (0%)

Query: 20  QKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79
           Q+R ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA+CPVT K+
Sbjct: 23  QRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82

Query: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           INYTCPLSGIPTHH +EAW  DK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ QD
Sbjct: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142

Query: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199
           +DR +N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LHQFSPYSLNPKGPVT
Sbjct: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202

Query: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259
           LEGLKSLAALRYTLYP +NK+ +   +T+DRPMRIFILGARAEAQLPGHVWKQ QYLFPE
Sbjct: 203 LEGLKSLAALRYTLYPLENKTIS---STKDRPMRIFILGARAEAQLPGHVWKQLQYLFPE 259

Query: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319
           Q FE+HF+GPEC LNKEK+QY+TSSTP+VK+VD+T+  V+H D+FHV HEAQDFFPYDP+
Sbjct: 260 QMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPY 319

Query: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379
           LDVFF FHPG+  PET+  WL ETMK LL+TKCAIFTTGF+K DLLRD+D VK++YG E+
Sbjct: 320 LDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEV 379

Query: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           D+LM+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV
Sbjct: 380 DVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/404 (78%), Positives = 355/404 (87%), Gaps = 2/404 (0%)

Query: 21  KRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200
           D+ +NLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260
           EGLKSLAALRYTLYP +N+S  V   TR+R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 213 EGLKSLAALRYTLYPLENRS--VLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270

Query: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320
            FEIHFIGPEC   ++K +Y+ S+TP+V+++D+TLK   H D+F VFHEAQDFFPYDP++
Sbjct: 271 NFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYM 330

Query: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380
           DVFFTFHPGYA PE+   W+GETM ALL+TKCAIFTTGF+K+DL+ DI++VK++YG E+D
Sbjct: 331 DVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMD 390

Query: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 391 ILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 357/404 (88%), Gaps = 2/404 (0%)

Query: 21  KRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260
           EGLKSLAALRYTLYP +N+S  V   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 213 EGLKSLAALRYTLYPLENRS--VLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270

Query: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320
            FEIHF+GPEC   ++K +Y+ S+TP+V++VD+TL+ + H D+F VFHEAQDFFPYDP++
Sbjct: 271 NFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYM 330

Query: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380
           DVFFTFHPGYA PE+   W+GETM+ALL+TKCAIFTTGF+K+DL+ DI+ VK++YG E+D
Sbjct: 331 DVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMD 390

Query: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +LMDPV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 391 ILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/415 (75%), Positives = 361/415 (86%), Gaps = 2/415 (0%)

Query: 11  LGAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTL 70
           +   S + IQKR ++GFVRNALGL           +NRFHPWDQSP  DLR RAA IR L
Sbjct: 11  IAPASATRIQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRAL 70

Query: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130
           A+CPVT K+INYTCP SGIPTHH +EAW  D  YH +K+YEILKKVNIYEHDLRSGRPFP
Sbjct: 71  ARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFP 130

Query: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190
           EFDFPQDQDYDR++N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY
Sbjct: 131 EFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPY 190

Query: 191 SLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVW 250
           +LNPKGP+TLEGLKSLAALRYTLYP Q++   V   T+DRPMRIFILGARAEAQLPGHVW
Sbjct: 191 ALNPKGPITLEGLKSLAALRYTLYPQQHR--KVSAATKDRPMRIFILGARAEAQLPGHVW 248

Query: 251 KQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEA 310
           KQFQ+LFPE  FE+HFIGPE + ++EK +YITSSTPIV++VD+TL  V+H DYFHVFHEA
Sbjct: 249 KQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEA 308

Query: 311 QDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDV 370
           QDFFPYDP+LD+FF FHPG+A PE+TE W+G+TM+ LL+TKCAIFTTGF++QDL+RD+  
Sbjct: 309 QDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTA 368

Query: 371 VKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           V+ +YGNE+DMLM+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV
Sbjct: 369 VREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/404 (78%), Positives = 357/404 (88%), Gaps = 2/404 (0%)

Query: 21  KRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ+Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152

Query: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260
           EGLKSLAALRYTLYP +N+S  +   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 213 EGLKSLAALRYTLYPLENRS--LLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270

Query: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320
            FEIHFIGPEC   ++K +Y+ S+TP+V++VD+TLK +   D+F VFHEAQDFFPYDP++
Sbjct: 271 NFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYM 330

Query: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380
           DVFFTFHPGYA PE+   W+GETMKALL+TKCAIFTTGF+K+DL  D+++VK++YG E+D
Sbjct: 331 DVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMD 390

Query: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 391 ILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 357/404 (88%), Gaps = 2/404 (0%)

Query: 21  KRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 33  RRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260
           EGLKSLAALRYTLYP +N+S  +   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 213 EGLKSLAALRYTLYPLENRS--LPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270

Query: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320
            FEIHFIGPEC   ++K +Y+ S+TP+V++VD+TLK ++  ++F VFHEAQDFFPYDP++
Sbjct: 271 SFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYM 330

Query: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380
           DVFFTFHPGYA PE+   W+GETMKALL+TKCAIFTTGF+K+DL  DI++VK++YG E+D
Sbjct: 331 DVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMD 390

Query: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +LM+PV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 391 VLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/405 (75%), Positives = 345/405 (85%), Gaps = 2/405 (0%)

Query: 20  QKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79
           Q R LMGFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA+CPVT K+
Sbjct: 26  QTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKE 85

Query: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           INYTCP+SGIPTHH +EAW  DK+YH SKRYE+LKKVNIYEHDLRSGRPFPEFDFP+DQ 
Sbjct: 86  INYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQG 145

Query: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199
            DR++N+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LHQFSPYSL PKGP++
Sbjct: 146 QDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPIS 205

Query: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259
           LEGLKSLAALRYTLYP QN+   V   T+ RPMRIFILGARAE+QLPGHVWKQ QYLFPE
Sbjct: 206 LEGLKSLAALRYTLYPMQNRL--VISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPE 263

Query: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319
           Q FEIHFIGPE Y +K+K +YI  +TPI + VD+TLKL++H +YFH  HEAQDFFPYDP+
Sbjct: 264 QTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPY 323

Query: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379
           +DVFF FHPG+A  E  E W+ +TMK LLDTKCAIFTTGF+K DLL DI VV+++YG EL
Sbjct: 324 MDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKEL 383

Query: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           D+LM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 384 DILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/408 (72%), Positives = 351/408 (86%), Gaps = 3/408 (0%)

Query: 18  LIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTH 77
           + Q+R+++GFVRNALGL           ENRFH WDQSP  DLRERAA+IR LA+CPVT 
Sbjct: 11  ITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTG 70

Query: 78  KDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQD 137
           K+INYTCPLSGIPTHH KEAW  DK YHESK++E+LKKVNIYEHDLRSGRPFPEFDFPQD
Sbjct: 71  KEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQD 130

Query: 138 QDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGP 197
            ++DR +N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L+QFSPYSLNPKGP
Sbjct: 131 LEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGP 190

Query: 198 VTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLF 257
           +TLEGLKSLAALRYTLYP++NK+      T+DRPMR+FILGARAEA LPGHVWKQ Q+LF
Sbjct: 191 ITLEGLKSLAALRYTLYPFENKTV---AATKDRPMRLFILGARAEALLPGHVWKQLQFLF 247

Query: 258 PEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYD 317
           PE  FE+HFIGPEC +NKEK+QY++S  P+VK++D+TL  V+H DYFHV+H+AQDFFPYD
Sbjct: 248 PETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYD 307

Query: 318 PFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGN 377
           P+LD FF FHPG+  PE+T++WL +T+  LL+TKCAIF TG +K  LLRDI+ V +++  
Sbjct: 308 PYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSK 367

Query: 378 ELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           E+D+LM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 368 EIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/412 (72%), Positives = 348/412 (84%), Gaps = 2/412 (0%)

Query: 14  GSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKC 73
            S+  +QKR +MGFVRNALGL           ENRFHPWDQSP  DLRERAA IR LAKC
Sbjct: 13  NSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKC 72

Query: 74  PVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFD 133
           PVT ++INYTCP SGIPTHH +EAW  D DY +SKR EILKKVNIYEHDLRSGRPFPEFD
Sbjct: 73  PVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFD 132

Query: 134 FPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLN 193
           FP DQD+DR++NLTNWDLFFYTR F+SMDTEFQLAAVTKMLSYPITIGS+LHQFSPYSLN
Sbjct: 133 FPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLN 192

Query: 194 PKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQF 253
           PKGP+TLEGLKSLAALRYTLYP QN+   V    ++ P+RIF+LGARAEAQLPGHVWKQ 
Sbjct: 193 PKGPITLEGLKSLAALRYTLYPDQNR--RVTSIAKNSPLRIFVLGARAEAQLPGHVWKQL 250

Query: 254 QYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDF 313
           Q++FPE + EIHF+GPE Y ++ K +Y+ S+ PI+++VD+TL  V+H DYFHVFHEAQDF
Sbjct: 251 QFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDF 310

Query: 314 FPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKN 373
           FPYDP+ D+FF FHPG+A PE+ E W+G+TM+ALL+TKCAIFTTGF++ DL RD+D V  
Sbjct: 311 FPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVA 370

Query: 374 RYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
            YG ELD++MDP KN FGSTKWELND+NPQEVYQFNM++AGFRGKRYHAIEV
Sbjct: 371 EYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/405 (74%), Positives = 347/405 (85%), Gaps = 4/405 (0%)

Query: 22  RSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81
           R +MGFVRNALGL           ENRFHPWDQSP  DLRERAA+I+ +A CPVTHKDI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141
           +TCPLSGIPTHH +EAW  D +YH+SKRYE+LKKVNIYEHDLRSGRPFPEFDFPQDQDYD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201
           R++N++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGP+TLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261
           GLKSLAALRYTLYP Q+         +D P+RIFILG RAEAQLPGHVWKQ QYL P+  
Sbjct: 197 GLKSLAALRYTLYPEQSGRFRAG---QDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTS 253

Query: 262 FEIHFIGPECYLNKEKNQYITSST-PIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320
            E+HF+GPE + ++EK  Y+ SST  IVK++D+ ++L +H D+FHVFHEAQDFFPYDP+ 
Sbjct: 254 IELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYN 313

Query: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380
           DVFF FHPG+A PET E W+G+TMKAL+ TKCA+FTTGFSK+DLLRDI +V+++YG+ELD
Sbjct: 314 DVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELD 373

Query: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           MLM+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 374 MLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/407 (73%), Positives = 347/407 (85%), Gaps = 2/407 (0%)

Query: 19  IQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHK 78
           +QKR +MGFVRNALGL           ENRFHPWDQSP  DLRERAA IR LAKCPVT +
Sbjct: 18  VQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77

Query: 79  DINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138
           +INYTCP SGIPTH+ +EAW  D +Y +SKR EILKKVNIYEHDLRSGRPFPEFDFP DQ
Sbjct: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137

Query: 139 DYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPV 198
           D+DR++NLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+LHQFSPYSLNPKGPV
Sbjct: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197

Query: 199 TLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFP 258
           TLEGLKSLAALRYTLYP QN+   V   T++ P+RIFILGARAEAQLPGHVWKQ Q++FP
Sbjct: 198 TLEGLKSLAALRYTLYPEQNR--RVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFP 255

Query: 259 EQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDP 318
           E   E+HF+GPE Y ++ K +Y+ SS+PIV++VD+TL  V+H DYFHVFHEAQDFFPYDP
Sbjct: 256 ETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDP 315

Query: 319 FLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNE 378
           + D+FF FHPG+A PE+ E W+G+TM+ALL+TKCA+FTTGF++ DL RD+  V  ++G E
Sbjct: 316 YTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKE 375

Query: 379 LDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LDMLM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 376 LDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/424 (70%), Positives = 348/424 (82%), Gaps = 16/424 (3%)

Query: 16  YSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPV 75
           Y+ + KR LMGFVRNALGL           +NRFHPWDQSP VDLRERAA+I+TLAKCPV
Sbjct: 16  YACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPV 75

Query: 76  THKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFP 135
           THK I YTCP+SGIPTHH +EAW  DK+YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP
Sbjct: 76  THKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFP 135

Query: 136 QDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPK 195
           +DQ  DR +NLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGS+LHQFSPYSLNPK
Sbjct: 136 RDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPK 195

Query: 196 GPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQY 255
           GP+TLEGLKSLAALRYTLYP QN++  V    +++PMRIFILGARAEAQLPGHVWKQ Q+
Sbjct: 196 GPITLEGLKSLAALRYTLYPLQNRA--VTTTAKNKPMRIFILGARAEAQLPGHVWKQLQF 253

Query: 256 LFPEQEFEIHFIGPECYLNKEKNQYI--------------TSSTPIVKKVDDTLKLVFHP 301
           LFP+Q FEIHFIGPE   ++E+N+YI              TSS P+ K++D+T+K  +H 
Sbjct: 254 LFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHT 313

Query: 302 DYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSK 361
           DYFH  H AQDFFPYDP+ DVFF FHPG A PE+ + W+ +T+K LLDTKCAIFTTGF+K
Sbjct: 314 DYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNK 373

Query: 362 QDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 421
           +D+  DI ++++ YG E+DMLM+PVKNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH
Sbjct: 374 KDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYH 433

Query: 422 AIEV 425
            I+V
Sbjct: 434 PIKV 437

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/404 (73%), Positives = 346/404 (85%), Gaps = 2/404 (0%)

Query: 22  RSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81
           RSLMGFVRNALGL           ENRFHPWDQSPC DLRERAAKIRTLA CPVT+K+IN
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141
           YTCP+SGIPTHH K AW MD++YH +K YEILKKVNIYEHDLRSGRPFPEF FPQDQD+D
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201
           R+IN+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LHQFSPYSL PKGP+TLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261
           GLKS+AALRYTLYP+ NKS      T++RPMRIF+LGARAEAQLPGH+WKQ QYLFPEQ+
Sbjct: 222 GLKSMAALRYTLYPFHNKS--FMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQK 279

Query: 262 FEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFLD 321
           FE+ FIGPE Y +KEK QY+    P+++ +DDTLKL F  +YFH  HE+QD FPYDP++D
Sbjct: 280 FELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMD 339

Query: 322 VFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELDM 381
           VFF FHPG++  ETTE W+ +TMK+LL+T+CAIF TGFS+ D+L D++++  +Y N+LD+
Sbjct: 340 VFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDI 399

Query: 382 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 400 LMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/406 (71%), Positives = 345/406 (84%), Gaps = 3/406 (0%)

Query: 20  QKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79
           Q+R +MGFVRNALGL           +NRFHPWDQSP  +LRERAA+I+ LAKCPVT K+
Sbjct: 27  QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKN 86

Query: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           I ++C  SGIPTHH +EAW  D +YHESKRY +LKKVNIYEHDLRSGRPF EFDFP+ QD
Sbjct: 87  IQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQD 146

Query: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199
           YDR++N+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGP+T
Sbjct: 147 YDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPIT 206

Query: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259
           LEGLKSLAALRYTLYP QN+      + +D+P+R+FILGARAEAQLPGHVWKQ QYLFPE
Sbjct: 207 LEGLKSLAALRYTLYPEQNRRVR---SIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPE 263

Query: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319
              E+HF+GPE   ++EK +Y+TSS P+VK++DDT+K+ +H DYFHVFHEAQDFFPYDP+
Sbjct: 264 SLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPY 323

Query: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379
            D+FF FHPG+  PET + W+  T++ALL TKCAIFTTGF+K+DL+ D+  VK +YG+EL
Sbjct: 324 NDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDEL 383

Query: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           DML+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 384 DMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/420 (68%), Positives = 339/420 (80%), Gaps = 6/420 (1%)

Query: 11  LGAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTL 70
           L A     I +R LMGFVRNALGL           ENRFHPWDQSP   LRERAA+I+TL
Sbjct: 18  LRASGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTL 77

Query: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130
           AKCPVT  ++ YTCPLSGIPTHH +EAW  D  YH +KRYE LKKVNIYEHDLRSGRPFP
Sbjct: 78  AKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFP 137

Query: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190
           EFDFPQ+Q YD+++N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL QFSPY
Sbjct: 138 EFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPY 197

Query: 191 SLNPKGPVTLEGLKSLAALRYTLY--PYQNKSQNVKVNT----RDRPMRIFILGARAEAQ 244
           SLNPKGP+TLEGLKSLAA+RYTLY   + N ++   V T    ++RPMR+F+LGARAEAQ
Sbjct: 198 SLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQ 257

Query: 245 LPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYF 304
           LPGHVWKQ  YLFPEQ FE+ FIGPE Y ++ + QY+ S TP+V+KVD+TLK + + DYF
Sbjct: 258 LPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYF 317

Query: 305 HVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDL 364
           HV HE+QDFFPYDP+ D FFTFHPG+A PE  + WL  T+ ALLDTKCAIFTTGF + DL
Sbjct: 318 HVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDL 377

Query: 365 LRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           + D+ ++  ++G+E+D+LM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 378 MNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/423 (66%), Positives = 337/423 (79%), Gaps = 13/423 (3%)

Query: 11  LGAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTL 70
           +   +YS   KR+LMGFVR+ LGL           ENRFHPW+ SPC DLRERAA+I+T+
Sbjct: 17  IACSNYS---KRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTM 73

Query: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130
           AKCPV++ DINYTCP+SGIPTHH ++ W MD +YH++   +ILKKVNIYEHDLRSGRPFP
Sbjct: 74  AKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFP 133

Query: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190
           EFDFP++Q+YD +INL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI S+LHQFSPY
Sbjct: 134 EFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPY 193

Query: 191 SLNPKGPVTLEGLKSLAALRYTL--------YPYQNKSQNVKVNTRDRPMRIFILGARAE 242
           SL PKGPVTLEGLKSLAALRYTL            + S  +   +++RPMRIFILGARAE
Sbjct: 194 SLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAE 253

Query: 243 AQLPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPD 302
           AQLP HVWKQ QYLFP   FEIHFIGPE  L+K+K+ Y+TS+TPI K++DD++ LV+H D
Sbjct: 254 AQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTD 313

Query: 303 YFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQ 362
           YFHV+H+AQDF+PYDP+ D+FF FHPG A   T E WL ETM+ LLD+KC IF TGF ++
Sbjct: 314 YFHVYHKAQDFYPYDPYFDIFFMFHPGLA--ATKETWLNETMQGLLDSKCPIFMTGFHEK 371

Query: 363 DLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHA 422
           D+  DI V+   +  ++D+LM PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYHA
Sbjct: 372 DITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHA 431

Query: 423 IEV 425
            E 
Sbjct: 432 TET 434

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/407 (68%), Positives = 333/407 (81%), Gaps = 2/407 (0%)

Query: 19  IQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHK 78
           +  R+L+GFVRNALGL            NRF+PWDQSP  +LRERAAKI+ +A+CP+T K
Sbjct: 22  VLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGK 81

Query: 79  DINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138
           +INYTCP+SGIPTHH +EAW  D+ YH +K  +ILKKVNIYEHDLRSGR FPEFDFP DQ
Sbjct: 82  EINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQ 141

Query: 139 DYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPV 198
            +DR +NL NWDL+FYTRSFYSMDTEFQLA VTKMLSYPITI S+LHQ+SPYSL P GP+
Sbjct: 142 TFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPI 201

Query: 199 TLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFP 258
           TLEGLKS+AALRY+LYP Q+KS    +N + RPMRIFILGARAE+QLPGHVWKQFQYLFP
Sbjct: 202 TLEGLKSIAALRYSLYPSQHKSSRSVLN-KTRPMRIFILGARAESQLPGHVWKQFQYLFP 260

Query: 259 EQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDP 318
            Q FEI FIGPEC L +E +  +  +  IVK++DDT+ LV+HP  FH  H+AQDFFPYDP
Sbjct: 261 LQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDP 319

Query: 319 FLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNE 378
           + DVFF FHPG+A PET E+W+ +T+KALLDTKCA+F TGFSK+DL  D+ ++   YG++
Sbjct: 320 YNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDK 379

Query: 379 LDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LD LM PVKN+FGSTKWELND+NPQEVYQFNMYI+ FRGKRYH IE+
Sbjct: 380 LDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 339/418 (81%), Gaps = 6/418 (1%)

Query: 8   PMRLGAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKI 67
           P+ L A    +   R+L+GFV+NALG+            NRF+PWD+SP   +RERAA+I
Sbjct: 16  PVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARI 75

Query: 68  RTLAKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGR 127
           +  AKCPVT K+I +TCPLSGIPTH+ KEAW  D +YH++K YE L+KVNIYEHDLRSGR
Sbjct: 76  KAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGR 135

Query: 128 PFPEFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQF 187
           PFPEFDFP +Q  D  +N+TNWDLFFYTR FYSMDTEFQLA VTKMLSYPITIGS+L+++
Sbjct: 136 PFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKY 195

Query: 188 SPYSLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPG 247
           SPY+L PKGPVTLEGLKSLAALRYTL        N    T+ RPMRIFILGARAE+QLP 
Sbjct: 196 SPYNLIPKGPVTLEGLKSLAALRYTL------RNNAFATTKTRPMRIFILGARAESQLPI 249

Query: 248 HVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVF 307
           H+WKQ Q+LFP Q FEI+FIGPEC L ++ + Y++S + IVK+VD++L L ++PDYF  F
Sbjct: 250 HIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKF 309

Query: 308 HEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRD 367
           H+AQDFFPYDP+ D+FFTFHPG+A PE+++ W+G+TMKALLDTKCAIFTTGFS+ D+++D
Sbjct: 310 HKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKD 369

Query: 368 IDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           I  V++ YG E+DMLM+P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++ 
Sbjct: 370 ITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/426 (64%), Positives = 331/426 (77%), Gaps = 20/426 (4%)

Query: 14  GSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKC 73
            +Y     R  +GFV+NALG+           ENRFHPWDQSP  DLRERAA+IR LAKC
Sbjct: 31  NNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKC 90

Query: 74  PVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFD 133
           PVT K+INYTCP+SGIPTHH KEAW  D +YH++K Y+ILKKVN++EHDLRSGR FPEF+
Sbjct: 91  PVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFE 150

Query: 134 FPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLN 193
           FPQ QD+D  +++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LH++ PY+L 
Sbjct: 151 FPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALE 210

Query: 194 PKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQF 253
           P GP+TLEGLKS+AAL+Y+L        N    T++RPMRIFILGARAE+QLP H+WKQF
Sbjct: 211 PNGPITLEGLKSIAALKYSL------RHNEFETTKERPMRIFILGARAESQLPEHIWKQF 264

Query: 254 QYLFPEQEFEIHFIGPECYL------------NKEKNQYITSSTP--IVKKVDDTLKLVF 299
            YLFP Q FEI+FIGPEC +            N   +  +T   P  IVK++D+ L LV+
Sbjct: 265 SYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVY 324

Query: 300 HPDYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGF 359
           H D+FH  H A+DFFPYD + DVFFTFHPG+A PE T+ W+GETMKALLDTKCAIFTTGF
Sbjct: 325 HTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGF 384

Query: 360 SKQDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 419
           +KQDLL+DID+V+  YG E+DMLM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKR
Sbjct: 385 NKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKR 444

Query: 420 YHAIEV 425
           YHA++V
Sbjct: 445 YHAVKV 450

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/404 (66%), Positives = 324/404 (80%), Gaps = 8/404 (1%)

Query: 22  RSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81
           R++MG+VRNA GL            NRFHPW++SPC DLR+RAA+I+TLA+CPVT K+IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141
           YTCP+SGIPTHH ++AW  D DYH++K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201
           R +NL NWDLF YTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P+GPVTLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261
           GLKS+AALRYTLYP   K+      + + PMRIFI+G RAE+QLPGHVWKQ QYLF E+ 
Sbjct: 209 GLKSIAALRYTLYPKLGKTS----LSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERI 264

Query: 262 FEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFLD 321
           FEIHFIGPEC L + KN    +STP++KKVDDTL L++HP YFH  H++ D FPY+P+ D
Sbjct: 265 FEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKD 320

Query: 322 VFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELDM 381
           VFF FHPG+AYP+T ++WL ET+  LL+TKCAIF TGF++ D+  D+ ++   Y NE+D+
Sbjct: 321 VFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDV 380

Query: 382 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 381 LMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/414 (67%), Positives = 327/414 (78%), Gaps = 4/414 (0%)

Query: 12  GAGSYSLIQKRSLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPCVDLRERAAKIRTLA 71
           G  + +  Q+R +MGFVRNALGL           ENRFH W+QSP  DLRERAA+IR LA
Sbjct: 19  GCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALA 78

Query: 72  KCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPE 131
           +CPVT KDI Y+C  SGIPTHH +EAW  D++YH SKR+  L+KVN+YEHDLRSGRPF E
Sbjct: 79  RCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAE 138

Query: 132 FDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYS 191
           FDFPQ+Q  DR++N+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLHQFSPY+
Sbjct: 139 FDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYA 198

Query: 192 LNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWK 251
           L P+GP+TLEGLKSLAALRYTLYP    ++ V    R +PMRIFILGARAEAQLPGHVWK
Sbjct: 199 LEPRGPITLEGLKSLAALRYTLYPESESARAV----RSKPMRIFILGARAEAQLPGHVWK 254

Query: 252 QFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQ 311
           Q QYLFP    EIHFIGPE   ++++ +Y+ SSTP+ K+VD TLKLV H DY HVFHEAQ
Sbjct: 255 QLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQ 314

Query: 312 DFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVV 371
           DFFPYDP+ DVFF FHPG+A  E    W+ +T+ ALL+TKCAIF TGF + D+  D + +
Sbjct: 315 DFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEAL 374

Query: 372 KNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           +  +  E+D+LM P KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYHAI+V
Sbjct: 375 RASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,042,686
Number of extensions: 2133565
Number of successful extensions: 4797
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4857
Number of HSP's successfully gapped: 24
Length of query: 425
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 313
Effective length of database: 40,638,807
Effective search space: 12719946591
Effective search space used: 12719946591
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)