Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.347.347ON19119110231e-143
Suva_4.817.347ON1911919071e-126
TPHA0F029407.347ON1911918991e-124
ZYRO0F11638g7.347ON1911918981e-124
Smik_4.737.347ON1911918931e-124
YDL165W (CDC36)7.347ON1911918921e-123
Skud_4.927.347ON1911918911e-123
NDAI0A019207.347ON1931938761e-121
TDEL0C020107.347ON1911918721e-120
NCAS0A141307.347ON1911918521e-117
KAFR0B008507.347ON1921928521e-117
CAGL0I03388g7.347ON1911918501e-117
KNAG0C037607.347ON1911918301e-114
TBLA0E005107.347ON2871677901e-106
Kwal_56.246347.347ON1901927771e-106
KLTH0H01320g7.347ON1901927751e-106
SAKL0F11308g7.347ON1911937711e-105
Ecym_47267.347ON1911986709e-90
KLLA0D12408g7.347ON1841916691e-89
ACL151C7.347ON2081986527e-87
KLTH0F11880g3.370ON563841171e-06
KAFR0H008603.370ON578841162e-06
ZYRO0C16588g3.370ON608821152e-06
Kwal_23.39623.370ON553841116e-06
CAGL0D01342g3.370ON548841118e-06
YPR072W (NOT5)3.370ON560821109e-06
Smik_16.3163.370ON560821109e-06
Skud_16.3613.370ON560821082e-05
Suva_16.4013.370ON565821072e-05
KNAG0A072903.370ON507851053e-05
TBLA0H014903.370ON552831054e-05
ADL364C3.370ON504871045e-05
Ecym_34563.370ON508861045e-05
SAKL0B08052g3.370ON576841011e-04
TDEL0C051203.370ON56284993e-04
NDAI0A050803.370ON57584984e-04
KLLA0B09196g3.370ON59072940.001
TPHA0A035003.370ON54881930.001
Kpol_1006.73.370ON54078930.001
KLTH0A03652g7.214ON77265810.055
ZYRO0D16302g7.214ON829116770.17
Kpol_1070.257.214ON68683710.86
CAGL0K00363g1.527ON122767691.6
NCAS0A112103.370ON58241682.0
KLLA0E04335g7.214ON75844655.1
TDEL0H023307.214ON81281646.6
Kwal_47.181147.214ON76365647.1
TBLA0D042707.214ON84766647.8
YIL034C (CAP2)7.208ON28798629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.34
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   398   e-143
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   353   e-126
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   350   e-124
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   350   e-124
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   348   e-124
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   348   e-123
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   347   e-123
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   342   e-121
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   340   e-120
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   332   e-117
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   332   e-117
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   332   e-117
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   324   e-114
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   308   e-106
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   303   e-106
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   303   e-106
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   301   e-105
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   262   9e-90
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   262   1e-89
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   255   7e-87
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    50   1e-06
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    49   2e-06
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    49   2e-06
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    47   6e-06
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    47   8e-06
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    47   9e-06
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    47   9e-06
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    46   2e-05
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    46   2e-05
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    45   3e-05
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    45   4e-05
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    45   5e-05
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    45   5e-05
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    44   1e-04
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    43   3e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    42   4e-04
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    41   0.001
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    40   0.001
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    40   0.001
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    36   0.055
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    34   0.17 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    32   0.86 
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...    31   1.6  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   2.0  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    30   5.1  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    29   6.6  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    29   7.1  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    29   7.8  
YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}  C...    28   9.8  

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  398 bits (1023), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           REFVLFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  353 bits (907), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 162/191 (84%), Positives = 181/191 (94%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGL+AL+PL+KQ+D ELS  Y+H+MT+G DLSSML+SLGIPRD+Q +R+LDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFFTPESF NIP+VLQS VTPP FNSI+NDQQRV LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  350 bits (899), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (92%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGLEALLPLIKQDD E SKKYNHAMTIG DL+S+ HSLGIP +N+RYR+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPR+FTP+SF NIP VLQS  TP VFNS+E DQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP+VEP+V+ DG SERGSYIFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+FVLFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  350 bits (898), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGLEAL+PL+KQ+D ELS KY+H+MT+G DLSSMLHSLGIPRD++R+++LDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIPNVL S+ TPP FNS++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  348 bits (893), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M+KFGL+AL+PL+K +D ELS  Y+H+MT+G DLSSML+SLGIPRD+Q +R+LDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFFTPESF NIP VLQS VTPP FNSI+NDQQRV LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  348 bits (892), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M+KFGL+AL+PL+K +D ELS  Y+H+MT+G DLSSML+SLGIPRD+Q +R+LDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFFTPESF NIP VLQS VTPP FNSI+NDQQRV LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  347 bits (891), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 178/191 (93%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M+KFGL AL+PL+K +D ELS  Y+H+MT+G DLSSML+SLGIPRD+Q +R+LDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEPRFFTPESF NIP VLQS VTPP FNSI+NDQQRV LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  342 bits (876), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 160/193 (82%), Positives = 179/193 (92%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGLEAL+PLIK DD ELSK Y+H+MT+G DL+SMLHSLGIPRD++R+R+LDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQS--KVTPPVFNSIENDQQRVTLFQDETLFYLFYK 118
           AETSRSEVEP FF P+SF +IP+VLQS  K TPP F+S++ DQQRV LFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQREFVLFYNAIM 191
           CQREF+LFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  340 bits (872), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 154/191 (80%), Positives = 178/191 (93%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M+KFGL+AL+PLIKQ++ E +  Y+H++T+G DLSSMLHSLGIPRD++R+R+LDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SF NIP VLQS+ TPP FNS+++DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           REF+LFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 152/191 (79%), Positives = 173/191 (90%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGL+AL+PL++QDD ELSK Y+H+MT+G DLSSM+HSLGIPRDN R+R+LDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I  VLQS VTPP F+S +NDQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP++EP VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           ++F+LFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 155/192 (80%), Positives = 175/192 (91%), Gaps = 1/192 (0%)

Query: 1   MDKFGLEALLPLIKQD-DTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSP 59
           MDKFGL+AL+PLIKQD   E + +Y+H+MT+G DLSSML+SLGIPRD Q +R+LDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKH 119
           WAETSRSEVEP+F  P+SF NI NVLQS VTPP F+SI+NDQQRV LFQDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKC 179
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSE+GSY+FFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 180 QREFVLFYNAIM 191
           QR+F+LFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  332 bits (850), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 150/191 (78%), Positives = 174/191 (91%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M KFGL+ L+PLI+ D+ +  K Y+H+MTIGTDLSSMLHSLGIPRD++ +R+LDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESFKNIP+VLQSK TPP F+ ++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPM+EP+V+ DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  324 bits (830), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 170/191 (89%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           MDKFGL+AL+PL++Q D E++ KY+H+M +G DLSSMLHSLGIPRD++R  +L TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS+ TPP F+S++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFVLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 138/167 (82%), Positives = 152/167 (91%)

Query: 25  NHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPWAETSRSEVEPRFFTPESFKNIPNV 84
           +H++TIG DLSSMLHSLG+PRDN+R+RILDTFQSPWAETSRSEV+PRFF P SF NI NV
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLK 144
           LQ   TPP FN+IE DQQRV LFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQREFVLFYNAIM 191
            WLTKDPM+EP+V+ DG SERGSY+FFDPQRWEKCQREF+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 16/17 (94%)

Query: 1  MDKFGLEALLPLIKQDD 17
          MD+FGL+AL+PLI+ D+
Sbjct: 1  MDRFGLKALVPLIRLDE 17

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  303 bits (777), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 140/192 (72%), Positives = 167/192 (86%), Gaps = 3/192 (1%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRD-NQRYRILDTFQSP 59
           M+K+GL ALLPLI+++D   S +Y+ +MT+G DLS +LHSLGI  + + RYR+LDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKH 119
           W ETSRSEVEP+FF PESFKNIPNVLQ+   PP FNS++ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPM+EP+V+  G SERGSY+FFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QREFVLFYNAIM 191
           QR+FVLFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  303 bits (775), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (85%), Gaps = 3/192 (1%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDN-QRYRILDTFQSP 59
           M+K+GL ALLPLI+++D   S  Y+ +MT+G DLS +LHSLGIP +   R R+LDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKH 119
           W ETSRSEVEP+FF PESFKNIPNVLQS   PP FNS++ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPM+EP+V+  G SERGSY+FFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QREFVLFYNAIM 191
           QR+FVLFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  301 bits (771), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/193 (75%), Positives = 168/193 (87%), Gaps = 6/193 (3%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRY--RILDTFQS 58
           ++K+GL+ALLPLIKQ+    + +Y+ AMT+G DLSSMLHSLGI   NQ Y  R+LDTF S
Sbjct: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGI-DSNQEYKTRVLDTFPS 59

Query: 59  PWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYK 118
           PW ETSRSEVEP+FFTPESF NIPNVLQS  +PP FNS++ D  ++ LFQDETLFYLFYK
Sbjct: 60  PWVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYK 118

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK 178
           HPGTV+QE+TYLELRKRNWRYHKTLK WLTKDPM+EP+VS DGLSERGSY+FFDPQRWEK
Sbjct: 119 HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK 178

Query: 179 CQREFVLFYNAIM 191
           CQR+FVLFYNAIM
Sbjct: 179 CQRDFVLFYNAIM 191

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  262 bits (670), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIP-RD------NQRYRIL 53
           M K+GL++LLP+IK D     K+Y+ +MT+GTDL S+LHSL +  RD      N  +  L
Sbjct: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLF 113
           DTF SPW ETSRSEVEP+FF PESFKNI  VL    T   F S+  D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP++EP+VS D  SERGSY+FFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQREFVLFYNAIM 191
           QRWEKCQR+F+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (79%), Gaps = 7/191 (3%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60
           M+K+GL+ L+P+++ D T     Y+  MT+G DL+S+L+SL I +D + +  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHDPT-----YDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120
            ETSRSEV+P FF PESFKNI  +L +      F S+  DQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPM+EP+V+ D +SERGSY+FFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 REFVLFYNAIM 191
           R+FVL YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  255 bits (652), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 14/198 (7%)

Query: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDN-------QRYRIL 53
           MDK+GL+ LLP+IK +     K+Y+  MT+G D+SS+LHSL +   +         +  L
Sbjct: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI  VL    T   F S+  D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP++EP+VS D  SERGSY+FFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQREFVLFYNAIM 191
           QRWEKCQR+F+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 104 VTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  VE L  G   S
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQS 530

Query: 164 ERGSYIFFDPQR-W--EKCQREFV 184
           E  S+ +FD Q+ W   +C  EFV
Sbjct: 531 EEISWRYFDYQKSWLARRCGAEFV 554

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 105 TLFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           T F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E L  G   S
Sbjct: 488 TKFDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKS 545

Query: 164 ERGSYIFFDPQR-W--EKCQREFV 184
           E  S+ +FD ++ W   +C  +FV
Sbjct: 546 EEESWRYFDYKKSWLARRCSPDFV 569

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  VE L  G   SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYIFFDPQR-W--EKCQREFV 184
            S+ +FD QR W   +C  +F+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 104 VTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  VE L  G   S
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQS 520

Query: 164 ERGSYIFFDPQR-W--EKCQREFV 184
           E  S+ +FD Q+ W   +C  +FV
Sbjct: 521 EEISWRYFDYQKSWLARRCGTDFV 544

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 105 TLFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
            +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E L  G   S
Sbjct: 458 NMFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKS 515

Query: 164 ERGSYIFFD-PQRW--EKCQREFV 184
           E  S+ +FD  + W   +C  +FV
Sbjct: 516 EEESWRYFDFKKSWLSRRCGSDFV 539

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E L  G G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYIFFDPQR-W--EKCQREFV 184
            S+ +FD ++ W   +C  +FV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E L  G G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYIFFDPQR-W--EKCQREFV 184
            S+ +FD ++ W   +C  +FV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + G+  Q L   EL K RNW +++  + W  K+  +E L  G G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYIFFDPQR-W--EKCQREFV 184
            S+ +FD ++ W   +C  +FV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + G+  Q L   EL K RNW +++  + W  K+  +E L  G G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYIFFDPQR-W--EKCQREFV 184
            S+ +FD ++ W   +C  +FV
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 6/85 (7%)

Query: 104 VTLFQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPMVEPLVSGDGL 162
           +T F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E L  G   
Sbjct: 416 LTKFDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNK 473

Query: 163 SERGSYIFFDPQR-W--EKCQREFV 184
           SE  S+ +FD ++ W   +C  +FV
Sbjct: 474 SEEESWRYFDYKKSWLARRCNSDFV 498

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 105 TLFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           T F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++  VE L  G   S
Sbjct: 461 TKFDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--VEKLPPGLPQS 518

Query: 164 ERGSYIFFDPQR-W--EKCQREF 183
           E  S+ +FD Q+ W   +C   F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 102 QRVTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDG 161
           Q +T F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  VE L  G  
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 162 LSERGSYIFFDPQR-W--EKCQREFVL 185
             E  S+ +FD Q+ W   +C  +FV 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 102 QRVTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDG 161
           Q +T F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  VE L  G  
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGME 473

Query: 162 LSERGSYIFFDPQR-W--EKCQREFV 184
             E  S+ +FD Q+ W   +C  +FV
Sbjct: 474 QKEEVSWRYFDYQKSWLARRCGPDFV 499

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 6/84 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMVEP--LVSGDGLS 163
           F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+    P  +VS +   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 164 ERGSYIFFDPQR-W--EKCQREFV 184
           E  S+ +FD Q+ W   +C  +FV
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDFV 567

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 105 TLFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           T F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  VE L  G   +
Sbjct: 471 TKFDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQA 528

Query: 164 ERGSYIFFDPQ-RW--EKCQREFV 184
           E  S+ +FD Q  W   +C  + V
Sbjct: 529 EEESWRYFDYQGSWLARRCNNDVV 552

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 105 TLFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           T F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+    P  +     
Sbjct: 483 TKFDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKD 542

Query: 164 ERGSYIFFDPQR-W--EKCQREFV 184
           E  S+ +FD ++ W   +C  +FV
Sbjct: 543 EEESWRYFDYKKSWLSRRCGNDFV 566

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 104 VTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLS 163
           ++ F  +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  VE L  G    
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGK 556

Query: 164 ERGSYIFFDPQR 175
           E  ++ +FD Q+
Sbjct: 557 EEVTWRYFDYQK 568

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLSER 165
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+  V         +E 
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKE--VTKSAPDMAQTEE 517

Query: 166 GSYIFFDPQR-W--EKCQREF 183
            ++ +FD Q  W   +C  +F
Sbjct: 518 ETWRYFDYQNSWLARRCNHDF 538

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 110 ETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSY 168
           +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+    P   G   +E  ++
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSP--PGMQQAEEETW 512

Query: 169 IFFDPQR-W--EKCQREF 183
            +FD Q  W   +C  +F
Sbjct: 513 RYFDYQNSWLARRCNSDF 530

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 35.8 bits (81), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFF 171
           LFY FY     + QE+ Y  L +RNW+  KT + W ++  +  P  S + L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 172 DPQRW 176
           +   W
Sbjct: 724 NLDDW 728

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query: 83  NVLQSKVTPPVFNSIENDQQRVTLFQDE-------TLFYLFYKHPGTVIQELTYLELRKR 135
           ++L+  + P + NS  NDQ++     +        TLFY +Y     + QE+  + L +R
Sbjct: 677 DILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSER 736

Query: 136 NWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQR-EFVLFYNAI 190
           +W+  K    W  +    +     + L E   Y  F    W    R  F L Y A+
Sbjct: 737 DWKVSKNCAMWFLRQSETK---FANELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 111 TLFYLFYKHPGTVIQ-ELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYI 169
           TLFY +Y  P T +Q +++ + L +R+W+  K    W  K    EP  S +   E G+Y 
Sbjct: 564 TLFYHYY-FPLTPLQKQISSILLIERDWKLLKNGTMWFLK--QGEPKFSNESF-EVGNYK 619

Query: 170 FFDPQRWEKCQR-EFVLFYNAIM 191
            F    W   ++  F L +N++M
Sbjct: 620 IFKADDWTVIEKFNFKLDFNSLM 642

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 77   SFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHPGTVIQELTYLELRKRN 136
            S K I +++ S+   PV  +I    Q+ T+   + +F+L     GTV    TY EL + N
Sbjct: 1164 SAKKINDIIGSRSLAPV--TIIVSHQKETIKLCDKIFFLV---DGTVAMMGTYEELMENN 1218

Query: 137  WRYHKTL 143
            W + K L
Sbjct: 1219 WEFRKLL 1225

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAW 146
           F  +TLF++FY + GT  Q L   EL + R+W ++K    W
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVE 154
           TLFY +Y     + Q +  L L++R WR  KT   W  +   V+
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLRQGAVK 684

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIF 170
           TLFY +Y     + Q +  L L +RNW+  K+   W  +    EP  + + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-EFVLFYNAI 190
           F    W    +  F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFF 171
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++  +  P  S + L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 172 DPQRW 176
           +   W
Sbjct: 731 NLDDW 735

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIF 170
           TLFY +Y     + +E++ + L +R+WR       W ++    +     D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQGEAKL---SDELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}
          CAP2Beta subunit of the capping protein (CP)
          heterodimer (Cap1p and Cap2p) which binds to the barbed
          ends of actin filaments preventing further
          polymerization; localized predominantly to cortical
          actin patches
          Length = 287

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 1  MDKFGLEALLPLIKQ-DDTELSKKYNHAMTIGTDLS-SMLHSLGIPRDNQR--------- 49
          M     +A L L+++ + T L +  N+ + +  +L+  +L S+ +P   Q+         
Sbjct: 1  MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREY 60

Query: 50 -----YRILDTFQSPWAETSRSEVEPRFFTPESFKNIP 82
                R +D+F+SPW+ T   E+ P+      F + P
Sbjct: 61 LCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAP 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,170,762
Number of extensions: 959167
Number of successful extensions: 2693
Number of sequences better than 10.0: 62
Number of HSP's gapped: 2697
Number of HSP's successfully gapped: 63
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)