Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.337.348ON1951959431e-131
NCAS0A141407.348ON2242017891e-107
TPHA0F029507.348ON2161827771e-105
TDEL0C020007.348ON2131907691e-104
SAKL0F11330g7.348ON2081957551e-102
NDAI0A019107.348ON2141827421e-100
KLLA0D12386g7.348ON2111867311e-98
KAFR0B008607.348ON2281907251e-97
Ecym_47257.348ON2341957242e-97
KLTH0H01298g7.348ON2141957102e-95
TBLA0E005207.348ON2091857014e-94
Smik_4.727.348ON1971846995e-94
Kwal_56.246357.348ON2261916991e-93
ZYRO0F11660g7.348ON1981856961e-93
CAGL0I03366g7.348ON2121866953e-93
YDL166C (FAP7)7.348ON1971846822e-91
ACL150W7.348ON2191856763e-90
KNAG0C037707.348ON2231816754e-90
Suva_4.807.348ON2061886701e-89
Skud_4.917.348ON1941956664e-89
Ecym_62781.308ON30146760.20
Smik_15.623.103ON32329720.63
Zrou_YGOB_A13310g8.558ON55842710.99
ZYRO0A13310gsingletonOFF51542711.1
KAFR0F027804.32ON91533711.1
Ecym_72904.32ON90433711.1
NDAI0G056001.308ON29546691.3
KLTH0G12892g8.295ON492834701.4
SAKL0H25388g4.32ON90133701.4
Skud_12.404.32ON90833701.5
YLL026W (HSP104)4.32ON90833701.6
Smik_12.294.32ON90833691.6
Ecym_3180na 1ON621111691.6
KLLA0F18194g4.32ON89933691.7
Suva_10.454.32ON90833691.7
CAGL0G03883g4.32ON90833691.8
TDEL0F016504.32ON91133691.8
ZYRO0B00946g4.32ON91133691.8
KLTH0C09900g3.103ON32229682.0
Skud_12.1748.295ON490726692.0
KLTH0E06204g4.32ON90733692.1
Kwal_56.226333.103ON32229672.3
NCAS0C034308.295ON493429682.6
Smik_2.3268.558ON56442673.0
KLLA0F02926g2.462ON33963673.1
TDEL0D017601.308ON29849663.5
ZYRO0B06248g3.103ON32124654.2
KLTH0G14256g8.239ON63822664.3
Ecym_42738.295ON491534664.4
NDAI0E025908.590ON68550664.5
NCAS0A028904.32ON90933664.6
NDAI0D048204.32ON90633664.6
KAFR0E024307.52ON30722645.5
Kwal_56.235838.255ON70039655.9
AGL036C4.32ON90433648.3
ABR139W5.34ON127037648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.33
         (195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   367   e-131
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   308   e-107
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   303   e-105
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   300   e-104
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   295   e-102
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   290   e-100
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   286   1e-98
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   283   1e-97
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   283   2e-97
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   278   2e-95
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   274   4e-94
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   273   5e-94
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   273   1e-93
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   272   1e-93
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   272   3e-93
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   267   2e-91
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   265   3e-90
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   264   4e-90
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   262   1e-89
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   261   4e-89
Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON} ...    34   0.20 
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    32   0.63 
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    32   0.99 
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    32   1.1  
KAFR0F02780 Chr6 complement(550852..553599) [2748 bp, 915 aa] {O...    32   1.1  
Ecym_7290 Chr7 complement(613715..616429) [2715 bp, 904 aa] {ON}...    32   1.1  
NDAI0G05600 Chr7 (1383117..1384004) [888 bp, 295 aa] {ON} Anc_1....    31   1.3  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    32   1.4  
SAKL0H25388g Chr8 complement(2217698..2220403) [2706 bp, 901 aa]...    32   1.4  
Skud_12.40 Chr12 (79588..82314) [2727 bp, 908 aa] {ON} YLL026W (...    32   1.5  
YLL026W Chr12 (88623..91349) [2727 bp, 908 aa] {ON}  HSP104Disag...    32   1.6  
Smik_12.29 Chr12 (73014..75740) [2727 bp, 908 aa] {ON} YLL026W (...    31   1.6  
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    31   1.6  
KLLA0F18194g Chr6 (1668282..1670981) [2700 bp, 899 aa] {ON} high...    31   1.7  
Suva_10.45 Chr10 (92914..95640) [2727 bp, 908 aa] {ON} YLL026W (...    31   1.7  
CAGL0G03883g Chr7 complement(367226..369952) [2727 bp, 908 aa] {...    31   1.8  
TDEL0F01650 Chr6 complement(305032..307767) [2736 bp, 911 aa] {O...    31   1.8  
ZYRO0B00946g Chr2 complement(76350..79085) [2736 bp, 911 aa] {ON...    31   1.8  
KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa] {O...    31   2.0  
Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa]...    31   2.0  
KLTH0E06204g Chr5 (564895..567618) [2724 bp, 907 aa] {ON} highly...    31   2.1  
Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C...    30   2.3  
NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8...    31   2.6  
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    30   3.0  
KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} simila...    30   3.1  
TDEL0D01760 Chr4 complement(350943..351839) [897 bp, 298 aa] {ON...    30   3.5  
ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly ...    30   4.2  
KLTH0G14256g Chr7 complement(1234736..1236652) [1917 bp, 638 aa]...    30   4.3  
Ecym_4273 Chr4 (575663..590410) [14748 bp, 4915 aa] {ON} similar...    30   4.4  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    30   4.5  
NCAS0A02890 Chr1 complement(556208..558937) [2730 bp, 909 aa] {O...    30   4.6  
NDAI0D04820 Chr4 complement(1139382..1142102) [2721 bp, 906 aa] ...    30   4.6  
KAFR0E02430 Chr5 complement(493237..494160) [924 bp, 307 aa] {ON...    29   5.5  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...    30   5.9  
AGL036C Chr7 complement(643265..645979) [2715 bp, 904 aa] {ON} S...    29   8.3  
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...    29   8.4  

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  367 bits (943), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 182/195 (93%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             REGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NELEEGVSSDDNESD 195
           NELEEGVSSDDNESD
Sbjct: 181 NELEEGVSSDDNESD 195

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  308 bits (789), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 168/201 (83%), Gaps = 8/201 (3%)

Query: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVX 62
           SRR +PNLLITGTPGCGKST+CELLQRRL +YKYYNISDFAKEHDCY+GYD+ RKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 63  XXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122
                       R+G SI+DWHVNDVFPERLIDLV VLRCDNS+LYDRLH RKYHD+KI+
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182
           EN+DAEIMGVVLQDA ESYA+EIVVELQSDTTEQM+ANVDRIVDW ++WL+QH+ GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183

Query: 183 LEE--------GVSSDDNESD 195
           LE+        G  S+DNE D
Sbjct: 184 LEDKQRNSDESGSESNDNEDD 204

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  303 bits (777), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/182 (79%), Positives = 159/182 (87%)

Query: 2   LSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIV 61
           +SRR +PNLLITGTPGCGKST+CELLQRRLSDY YYNISDFAKEH+CY+G+DE RKSHIV
Sbjct: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60

Query: 62  XXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKI 121
                        R+G  IVDWHVNDVFPERLIDLVVVLRCDNS+LYDRL +R YHDSKI
Sbjct: 61  DEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120

Query: 122 QENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTN 181
            EN+DAEIMGVVLQDAQESYA+EIVVELQSDTTEQM+ NVD+IVDWVELW+KQHK GVTN
Sbjct: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180

Query: 182 EL 183
           EL
Sbjct: 181 EL 182

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  300 bits (769), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 146/190 (76%), Positives = 158/190 (83%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M  RR KPNLLITGTPGCGKST+CELLQRRL DYKYYNISDFAKEHDC++GYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             REG +IVDWHVNDVFPERLIDLVVVLRCDN+ILYDRL +R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           IQENLDAEIMGVVLQDA +SY +EIVVELQSD+TEQMEANVDRIV W +LWLKQHK G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NELEEGVSSD 190
           NEL E    D
Sbjct: 181 NELLERTKGD 190

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  295 bits (755), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/195 (73%), Positives = 159/195 (81%), Gaps = 3/195 (1%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M ++R +PN+L+TGTPGCGKST+CELL RRLSDY YYNISDFA+EH CY+GYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+G SIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLH R YHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVV+QDA ESYA+EIVVELQSDT E M+ANVDRIV+W E+WL QH  GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NELEEGVSSDDNESD 195
           NELE      DN SD
Sbjct: 181 NELE---PESDNASD 192

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  290 bits (742), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 155/182 (85%)

Query: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVX 62
           SRR +PNLLITGTPG GKST+CELLQRRL +Y YYNISDFAKE+DCYEGYD+ RKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  XXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122
                       R+G SIVDWHVND+FPERLIDLVVVLRCDNSILYDRL+ R YHDSKIQ
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182
           ENLDAEIMGVVLQDA ESY +EIVVELQSD TEQMEANV+RIV+W ++W+ QHK GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 LE 184
           L+
Sbjct: 186 LQ 187

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  286 bits (731), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 132/186 (70%), Positives = 157/186 (84%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M   R KPN++++GTPGCGKST+CELL RRL +Y YYNISDFAKEHDCY+GYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+GG I+DWHVNDVFPERL+DLVVVLRCDN ILYDRL+ R YH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+EN+DAEIMGVVLQDA +SYA+EIVVELQSDTTE+M+ NVDRI+ W E+WLKQHKKGVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NELEEG 186
           NEL++G
Sbjct: 181 NELDDG 186

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  283 bits (725), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 134/190 (70%), Positives = 154/190 (81%)

Query: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVX 62
           SRR  PNLL+TGTPGCGKST+CELL RRL DY Y+NIS+FA++H CY+GYDE RKSHIV 
Sbjct: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVD 67

Query: 63  XXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122
                       R G SI+DWHVNDVFPERLIDLVVVLRCDNSIL+DRLH R YH+SKIQ
Sbjct: 68  DDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127

Query: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182
           ENLDAEIMGVVLQDA +SY +EIVVELQS++TE+M+ANV+RIV W E+WL QHK GVTNE
Sbjct: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187

Query: 183 LEEGVSSDDN 192
            +  +  D N
Sbjct: 188 YQGELPKDSN 197

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  283 bits (724), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 136/195 (69%), Positives = 156/195 (80%), Gaps = 1/195 (0%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M S RL+PN+++TGTPGCGK+T+CELLQRRL D +YYNISDFAKEHDCYEGYDE RKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+GG+I+DWHVNDVFPERLIDLVVVLRCDNS LYDRLH R YHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+EN+DAEIMGVVLQDA +SY  +IVVELQS+T  QME NV RIV W   W+ QH  GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NELEEGVSSDDNESD 195
           NEL++   S+D ESD
Sbjct: 195 NELQQDYQSND-ESD 208

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  278 bits (710), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 158/195 (81%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           MLS R  PN+L+TGTPGCGK+++CELLQRRL D  YYNISDFA++H+CY+GYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+GG+IVDWHVND+FPERLIDLVVVLR DN++LYDRL +R YH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           IQEN+DAEIMGVV+QDAQ+SY +EIVVELQSDT +QM+ NVDRI  W   WL+Q+ KGVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NELEEGVSSDDNESD 195
           NEL E  S +++ +D
Sbjct: 181 NELVERGSDEEDGTD 195

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  274 bits (701), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 151/185 (81%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M SRR  PNLLI+GTPG GKS++CELL+R L DYKY NISDFAKE +CY+G+D+ RKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             REG +IVDWHVNDVFPERLIDLVV+LR DNS+LYDRL  RKYHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           +QENLDAEIMGVVLQDA +SYA+EIV+ELQS+ TE+M +NVDRIV WVELW KQH  GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NELEE 185
           NEL E
Sbjct: 181 NELGE 185

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  273 bits (699), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 148/184 (80%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M SRR  PN+++TGTPGCGKS+ CELL+ +L DYKYYNISDFAK+HDC+EGYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVV QDA ESY   IVVELQSDT E ME+NV RI+ W ++WL+QH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NELE 184
           NE +
Sbjct: 181 NEYQ 184

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  273 bits (699), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 131/191 (68%), Positives = 151/191 (79%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M S R  PN+L+TGTPGCGK+++CELLQRRL   KYYNISDFAKE+ CY+GYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R GG+IVDWHVNDVFPERLIDLVVVLR DNS L+DRL  R YH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           IQEN+DAEIMGVV+ DA++SYA+EIVVELQSDTTEQM+ NVDRIV W + W +QH +GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NELEEGVSSDD 191
           NEL     SDD
Sbjct: 181 NELNGADHSDD 191

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  272 bits (696), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 131/185 (70%), Positives = 150/185 (81%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M SRR  PN+LITGTPG GKST+ ELLQRRLSD++YYNISDFA+E+DC++GYDE RKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+GG+I+DWHVNDVFPERLIDLVVVLRC+NSIL+ RL  R YH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I EN+DAEIMGVV+QDA +SY +EIVVEL SD+TEQME NVDRIV WVELW  QH  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NELEE 185
           NEL E
Sbjct: 181 NELHE 185

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  272 bits (695), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/186 (70%), Positives = 151/186 (81%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M SRR  PN+++TGTPGCGKST+CELLQRRL  YKYYNIS+FA+EH CY+GYDE RKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V              EG SI+DWHVNDVFPERLIDLVVVLR +N  LYDRL AR YHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVVLQDAQESY  EIVVELQS+TTE ME NVDRI  WV+ W+++HK GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NELEEG 186
           +EL++G
Sbjct: 181 SELKDG 186

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  267 bits (682), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 146/184 (79%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M +RR  PN+++TGTPGCGKS++CE L+ +L DYKYYNISDFAK++DC+EGYDE RKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+G SIVDWHVNDVFPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVV QDA ESY   IVVELQSDT E M +NV RIV W ++WL+QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NELE 184
           NE +
Sbjct: 181 NEYQ 184

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  265 bits (676), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 146/185 (78%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M   R +PN+L++GTPGCGKST+CELLQR L DY+Y+NISDFA+EH+CY+GYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R GG+IVDWHVND+FPERLIDLVVVLRCDN+IL+DRL  R YH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+EN+DAEIMGVVLQDA +SY  EIVVELQSD TEQM+ NVDRI  W   W+ +H  GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NELEE 185
           N L++
Sbjct: 181 NALQQ 185

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  264 bits (675), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 144/181 (79%)

Query: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVX 62
           SRRL PN+L+TGTPG GKST+CELL R L DY YYNISDFA ++ CY+GYDE RKSHIV 
Sbjct: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVD 63

Query: 63  XXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122
                         GG+I+DWHVNDVFPERLIDLV VLRCD+S+L+DRL+ R+YH SKI 
Sbjct: 64  EDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123

Query: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182
           EN+DAEIMGVVLQDA +SY E+IVVELQSD TEQM ANVDR+V W  +W +QH +GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183

Query: 183 L 183
           L
Sbjct: 184 L 184

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  262 bits (670), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (78%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M SRR  PN+++TGTPGCGKS++CELL+  L  YKYYNISDFAK++DC+EGYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVV QDA +SY   IVVELQSDT + + +NV RI+ W ++WL+QH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NELEEGVS 188
           NE + G S
Sbjct: 181 NEYQGGRS 188

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  261 bits (666), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 148/195 (75%), Gaps = 1/195 (0%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60
           M  RR  PN+++TGTPGCGKS++CELL+  L  YKYYNISDFAK++DC+E YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120
           V             R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180
           I+ENLDAEIMGVV QDA +SY   IVVELQ DT E M +NV RIV W ++WL+QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NELEEGVSSDDNESD 195
           NE  +G   DD ES+
Sbjct: 181 NEY-QGPHGDDEESE 194

>Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AEL156W
          Length = 301

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEH 46
            L ++LKP LL+T T G       +L      D+ YY +S F  EH
Sbjct: 245 FLEKQLKPELLLTATAGTSWEGMVDLHMEDGFDHSYYFVSSFVPEH 290

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNLLITGTPGCGKSTSCELLQRRLSDYKY 36
          P+++I+G PG GK+TS   L   L  + Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY 71

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 32.0 bits (71), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 10  LLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEG 51
           LL+ G PG GK+T C+ L ++LS  K ++ SD     + Y+G
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLSIRKDFS-SDVDPISNNYKG 347

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 10  LLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEG 51
           LL+ G PG GK+T C+ L ++LS  K ++ SD     + Y+G
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLSIRKDFS-SDVDPISNNYKG 347

>KAFR0F02780 Chr6 complement(550852..553599) [2748 bp, 915 aa] {ON}
           Anc_4.32 YLL026W
          Length = 915

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK++  E +  R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTSIIEGIASRIVD 231

>Ecym_7290 Chr7 complement(613715..616429) [2715 bp, 904 aa] {ON}
           similar to Ashbya gossypii AGL036C
          Length = 904

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RRLK N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRLKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>NDAI0G05600 Chr7 (1383117..1384004) [888 bp, 295 aa] {ON} Anc_1.308
           YJL068C
          Length = 295

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 21/46 (45%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEH 46
            L ++LKP L +    G     S EL      D+ YY IS F  EH
Sbjct: 239 FLEKQLKPELFLAACKGTSWEKSIELHIVDGFDHSYYFISTFVPEH 284

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 1    MLSRRLKPN--LLITGTPGCGKSTSCELLQRRLS 32
            ++S  LK N  +L+ G  GCGK+T C+L+ + LS
Sbjct: 1358 LVSSCLKNNEPVLLVGETGCGKTTVCQLIAKYLS 1391

>SAKL0H25388g Chr8 complement(2217698..2220403) [2706 bp, 901 aa]
           {ON} highly similar to uniprot|P31539 Saccharomyces
           cerevisiae YLL026W HSP104 Heat shock protein that
           cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to
           refold and reactivate previously denatured aggregated
           proteins responsive to stresses including: heat ethanol
           and sodium arsenite involved in [PSI ] propagation
          Length = 901

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>Skud_12.40 Chr12 (79588..82314) [2727 bp, 908 aa] {ON} YLL026W
           (REAL)
          Length = 908

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>YLL026W Chr12 (88623..91349) [2727 bp, 908 aa] {ON}
           HSP104Disaggregase; Heat shock protein that cooperates
           with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and
           reactivate previously denatured, aggregated proteins;
           responsive to stresses including: heat, ethanol, and
           sodium arsenite; involved in [PSI+] propagation
          Length = 908

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>Smik_12.29 Chr12 (73014..75740) [2727 bp, 908 aa] {ON} YLL026W
           (REAL)
          Length = 908

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 85  VNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQENLDAEIMGVVLQDAQESYAEE 144
           +ND  PE  ID   +LR DN  L +R            +N +A  +       Q+S AEE
Sbjct: 2   INDSIPE--IDFTNILR-DNPHLANR------------DNAEANELASEGTSKQDSNAEE 46

Query: 145 IVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNELEEGVSSDDNESD 195
            +  ++SD     + + D + +W     +QH     ++++ G++ D   SD
Sbjct: 47  TLEVVESDLNSNPDQDADVLSNW-----EQH-----SDVQSGINDDSFVSD 87

>KLLA0F18194g Chr6 (1668282..1670981) [2700 bp, 899 aa] {ON} highly
           similar to uniprot|P31539 Saccharomyces cerevisiae
           YLL026W HSP104 Heat shock protein that cooperates with
           Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and reactivate
           previously denatured aggregated proteins responsive to
           stresses including: heat ethanol and sodium arsenite
           involved in [PSI ] propagation
          Length = 899

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIVEGVAQRIID 231

>Suva_10.45 Chr10 (92914..95640) [2727 bp, 908 aa] {ON} YLL026W
           (REAL)
          Length = 908

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>CAGL0G03883g Chr7 complement(367226..369952) [2727 bp, 908 aa] {ON}
           highly similar to uniprot|P31539 Saccharomyces
           cerevisiae YLL026w HSP104 heat shock protein
          Length = 908

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>TDEL0F01650 Chr6 complement(305032..307767) [2736 bp, 911 aa] {ON}
           Anc_4.32 YLL026W
          Length = 911

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>ZYRO0B00946g Chr2 complement(76350..79085) [2736 bp, 911 aa] {ON}
           highly similar to uniprot|P31539 Saccharomyces
           cerevisiae YLL026W HSP104 Heat shock protein that
           cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to
           refold and reactivate previously denatured aggregated
           proteins responsive to stresses including: heat ethanol
           and sodium arsenite involved in [PSI ] propagation
          Length = 911

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 322

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 8  PNLLITGTPGCGKSTSCELLQRRLSDYKY 36
          P+L+I+G PG GK+TS   L   L    Y
Sbjct: 44 PHLIISGLPGIGKTTSVSCLAHELLGNAY 72

>Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 7    KPNLLITGTPGCGKSTSCELLQRRLS 32
            K  +L+ G  GCGK+T C+LL + +S
Sbjct: 1360 KEPVLLVGETGCGKTTICQLLAQFMS 1385

>KLTH0E06204g Chr5 (564895..567618) [2724 bp, 907 aa] {ON} highly
           similar to uniprot|P31539 Saccharomyces cerevisiae
           YLL026W HSP104 Heat shock protein that cooperates with
           Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and reactivate
           previously denatured aggregated proteins responsive to
           stresses including: heat ethanol and sodium arsenite
           involved in [PSI ] propagation
          Length = 907

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C
          (RFC4) - Subunit 4 of Replication Factor C; homologous
          to human RFC 40 kDa subunit [contig 184] FULL
          Length = 322

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 8  PNLLITGTPGCGKSTSCELLQRRLSDYKY 36
          P+L+I+G PG GK+TS   L   L    Y
Sbjct: 44 PHLIISGLPGIGKTTSISCLAHELLGNAY 72

>NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8.295
            YLR106C
          Length = 4934

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 2/29 (6%)

Query: 1    MLSRRLKPN--LLITGTPGCGKSTSCELL 27
            ++SR L+ N  +L+ G  GCGK+T C+LL
Sbjct: 1363 LVSRCLQNNEPVLLVGETGCGKTTICQLL 1391

>Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa]
           {ON} YBR186W (REAL)
          Length = 564

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 10  LLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEG 51
           LL+ G PG GK+T C+ L ++LS  + ++  +F      Y+G
Sbjct: 310 LLVHGPPGTGKTTLCKALCQKLSVRREFS-DNFGTIDTSYKG 350

>KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} similar
          to uniprot|P34253 Saccharomyces cerevisiae YKL110C
          KTI12 Protein associated with the RNA polymerase II
          Elongator complex involved in sensitivity to G1 arrest
          induced by Kluyveromyces lactis toxin zymocin
          Length = 339

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 8  PNLLITGTPGCGKSTSCE----LLQR------RLSDYK--YYNISDFAKEHDCYEGYDED 55
          P +L+TG P  GK+T  +    LLQ       +LS+Y   Y++       HD Y G +E+
Sbjct: 29 PLVLLTGFPSSGKTTVAKKLVTLLQETIDSNDKLSNYSVVYHSDETLNISHDDYIGSNEE 88

Query: 56 RKS 58
          R++
Sbjct: 89 RRA 91

>TDEL0D01760 Chr4 complement(350943..351839) [897 bp, 298 aa] {ON}
           Anc_1.308 YJL068C
          Length = 298

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCY 49
            L   L+P LL+  T G       E+      D+ YY IS F  EH  +
Sbjct: 242 FLQTNLRPELLLEATKGTSWEGKIEVKMVDGFDHSYYFISTFVPEHATF 290

>ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly
          similar to uniprot|P40339 Saccharomyces cerevisiae
          YOL094C RFC4 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 321

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 8  PNLLITGTPGCGKSTSCELLQRRL 31
          P+L+I+G PG GK+TS   L   L
Sbjct: 44 PHLIISGLPGIGKTTSIHCLAHEL 67

>KLTH0G14256g Chr7 complement(1234736..1236652) [1917 bp, 638 aa]
           {ON} weakly similar to uniprot|P32641 Saccharomyces
           cerevisiae YER173W RAD24 Checkpoint protein involved in
           the activation of the DNA damage and meiotic pachytene
           checkpoints subunit of a clamp loader that loads Rad17p-
           Mec3p-Ddc1p onto DNA homolog of human and S. pombe Rad17
           protein
          Length = 638

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 14/22 (63%)

Query: 10  LLITGTPGCGKSTSCELLQRRL 31
           LL+TG  GC KSTS  LL   L
Sbjct: 98  LLLTGPAGCSKSTSVHLLSEEL 119

>Ecym_4273 Chr4 (575663..590410) [14748 bp, 4915 aa] {ON} similar to
            Ashbya gossypii AGR074C
          Length = 4915

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 1    MLSRRLKPN--LLITGTPGCGKSTSCELLQRRLS 32
            ++S  LK N  +L+ G  GCGK+T C+LL + ++
Sbjct: 1359 LVSACLKNNEPVLLVGETGCGKTTICQLLSQFMN 1392

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 30.0 bits (66), Expect = 4.5,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 77  GGSIVDWHVNDV-FPE--RLIDLVVVLRCDNSILYDRLHARKYHDSKIQE 123
           G  I  W +  V  PE    + + VVLRCD S L+    A   HD K+QE
Sbjct: 456 GADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQE 505

>NCAS0A02890 Chr1 complement(556208..558937) [2730 bp, 909 aa] {ON}
           Anc_4.32
          Length = 909

 Score = 30.0 bits (66), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GKS   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGVGKSAIIEGVAQRIID 231

>NDAI0D04820 Chr4 complement(1139382..1142102) [2721 bp, 906 aa]
           {ON} Anc_4.32
          Length = 906

 Score = 30.0 bits (66), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GKS   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGVGKSAIIEGVAQRIID 231

>KAFR0E02430 Chr5 complement(493237..494160) [924 bp, 307 aa] {ON}
           Anc_7.52 YOR340C
          Length = 307

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (81%)

Query: 168 VELWLKQHKKGVTNELEEGVSS 189
           V  ++K+HKK VTN +E+GVSS
Sbjct: 13  VARFIKKHKKQVTNPVEDGVSS 34

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score = 29.6 bits (65), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 21  STSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSH 59
           +TS ELL R+L+D+ +  +SDF   +  YE   +D + H
Sbjct: 384 ATSNELLLRKLADWSFM-LSDFKTAYSTYELLSKDFEQH 421

>AGL036C Chr7 complement(643265..645979) [2715 bp, 904 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL026W
           (HSP104)
          Length = 904

 Score = 29.3 bits (64), Expect = 8.3,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSD 33
           +L+RR+K N  + G PG GK+   E + +R+ D
Sbjct: 199 VLARRIKSNPCLIGEPGIGKTAIIEGVAQRIID 231

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score = 29.3 bits (64), Expect = 8.4,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNI 39
           +R +KP LLITG  G G+      L   L DY   N+
Sbjct: 724 ARTVKPKLLITGPAGNGQQYIGSALLHHLEDYNIQNL 760

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,755,201
Number of extensions: 818078
Number of successful extensions: 3713
Number of sequences better than 10.0: 80
Number of HSP's gapped: 3748
Number of HSP's successfully gapped: 82
Length of query: 195
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 91
Effective length of database: 41,556,135
Effective search space: 3781608285
Effective search space used: 3781608285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)