Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.327.349ON68447621020.0
KLTH0H01276g7.349ON55742211021e-142
TPHA0F029607.349ON65443611091e-142
YDL167C (NRP1)7.349ON71941611101e-141
Smik_4.717.349ON75941510971e-139
Skud_4.907.349ON70741510901e-138
Kwal_56.246387.349ON52742110651e-137
KLLA0D12364g7.349ON63141310111e-128
KAFR0B008707.349ON5424139991e-127
KNAG0C037807.349ON5384209411e-118
ZYRO0F11682g7.349ON5972178221e-100
TDEL0C019907.349ON6062228144e-99
Suva_4.797.349ON7082037991e-95
SAKL0F11352g7.349ON5832107864e-95
NCAS0A141507.349ON5702097768e-94
ACL149W7.349ON6282107694e-92
TBLA0E020607.349ON5642047471e-89
CAGL0I03344g7.349ON6034296531e-75
NDAI0A019007.349ON5652005923e-67
KLLA0B08976g3.379ON30598910.018
Kpol_1039.503.379ON29639790.48
Kwal_56.234868.229ON587122790.62
CAGL0G05511g2.52ON67468790.80
KNAG0F011202.52ON63559771.3
KLLA0F20834g2.52ON61664751.8
Kpol_400.12.52ON60059751.8
CAGL0G05401g2.52ON67159752.0
KAFR0F002902.52ON68064752.3
TDEL0A009402.52ON68230752.3
Ecym_25418.491ON67529742.5
TPHA0H008602.52ON58859742.6
Smik_4.162.52ON65064743.0
NCAS0D002902.52ON62659743.1
YDL224C (WHI4)2.52ON64959733.2
KAFR0A077002.52ON57159733.3
Skud_4.302.52ON65159733.4
Suva_4.202.52ON65259733.4
ZYRO0C10164g2.52ON74559733.5
Ecym_64412.52ON68959734.0
ABL158C2.52ON72959724.7
KLTH0B07546g2.52ON63956724.8
Kwal_23.45972.52ON66456725.0
SAKL0E13354g2.52ON67156716.0
TBLA0B006002.52ON73456707.4
NCAS0E007703.497ON115053709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.32
         (684 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   814   0.0  
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   429   e-142
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   431   e-142
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   432   e-141
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   427   e-139
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   424   e-138
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   414   e-137
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   394   e-128
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   389   e-127
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   367   e-118
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   321   e-100
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   318   4e-99
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   312   1e-95
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   307   4e-95
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   303   8e-94
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   300   4e-92
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   292   1e-89
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   256   1e-75
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   232   3e-67
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    40   0.018
Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [89...    35   0.48 
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    35   0.62 
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    35   0.80 
KNAG0F01120 Chr6 complement(199529..201436) [1908 bp, 635 aa] {O...    34   1.3  
KLLA0F20834g Chr6 complement(1942016..1943866) [1851 bp, 616 aa]...    33   1.8  
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    33   1.8  
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    33   2.0  
KAFR0F00290 Chr6 complement(71809..73851) [2043 bp, 680 aa] {ON}...    33   2.3  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    33   2.3  
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    33   2.5  
TPHA0H00860 Chr8 (176257..178023) [1767 bp, 588 aa] {ON} Anc_2.5...    33   2.6  
Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON} Y...    33   3.0  
NCAS0D00290 Chr4 complement(39189..41069) [1881 bp, 626 aa] {ON}...    33   3.1  
YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}  WH...    33   3.2  
KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2...    33   3.3  
Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON} Y...    33   3.4  
Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON} Y...    33   3.4  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    33   3.5  
Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar t...    33   4.0  
ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON} S...    32   4.7  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    32   4.8  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    32   5.0  
SAKL0E13354g Chr5 (1103459..1105474) [2016 bp, 671 aa] {ON} some...    32   6.0  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    32   7.4  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...    32   9.9  

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/476 (84%), Positives = 402/476 (84%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
           MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGAE 180
           NRWAKNHSDTVTVKKSKN                           NSDKEDEVHANTGAE
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 181 ESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240
           ESG                SKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240

Query: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXX 300
           NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEET       
Sbjct: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNNW 300

Query: 301 XXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360
                PYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS
Sbjct: 301 SMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360

Query: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKYV 420
           VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKYV
Sbjct: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKYV 420

Query: 421 XXXXXXXXXXXXXXXXXXXILNTTPNQYNFALGMQHNSQPQGLQARSSPINGSTGY 476
                              ILNTTPNQYNFALGMQHNSQPQGLQARSSPINGSTGY
Sbjct: 421 NNSNNMHNNPLNDNGSNLNILNTTPNQYNFALGMQHNSQPQGLQARSSPINGSTGY 476

 Score =  210 bits (534), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 106/145 (73%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTMXXXXXXXXXXXXXXXX 599
           VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTM                
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTMNNSNGLNNRHYYNNNN 599

Query: 600 XXXXXXXXXXXXXXXXXXXXXXXASKSTNNYNGIELPNMSVSTATSNASYNKTSQGLVGN 659
                                  ASKSTNNYNGIELPNMSVSTATSNASYNKTSQGLVGN
Sbjct: 600 NNNNNNNNNNNNNNSSSGNYNSNASKSTNNYNGIELPNMSVSTATSNASYNKTSQGLVGN 659

Query: 660 VVATHINNGSIDSVNNDTMVPLNSA 684
           VVATHINNGSIDSVNNDTMVPLNSA
Sbjct: 660 VVATHINNGSIDSVNNDTMVPLNSA 684

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINS 580
           R GDW C++C + NF +   C RC  P +   S ++NS
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAA---SNNLNS 416

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAA---SNNLNS 416
           R GDW C++C + NF +   C RC  P +   S ++NS
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINS 580

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  429 bits (1102), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/422 (51%), Positives = 275/422 (65%), Gaps = 7/422 (1%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E +  H  ++PKD ++I+K +YQF+D E+LE  +  +E K + + +    + +D
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVF--EENKHVELGN--GCTLQD 56

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QL++DI     DD FV CSLNS W  RVTIPRQARDE+  LP +LQ  KVFDLWKE+
Sbjct: 57  AVAQLEKDISEHAKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHA-NTGA 179
           +RW  NH +T  ++++                             N +  ++  A  +GA
Sbjct: 116 DRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA 175

Query: 180 EESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239
           E+                   +   E P  I +   I+T +HKKC T +D +LVLT PYD
Sbjct: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235

Query: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXX 299
           S  D + F +E SK+LYMNNLPPDTTQSELESWF QFG++PV FWTVKNIVEET      
Sbjct: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNN 295

Query: 300 XXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359
                  YVE QDSISGFV FQSH+EAT+AL LNGRSILSN+ANTKQPRV+EHIVEIQPS
Sbjct: 296 WSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPS 355

Query: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN-NLNSRK 418
           S  VL+R Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCS+PAAS   +N+  
Sbjct: 356 SARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNG 415

Query: 419 YV 420
           Y+
Sbjct: 416 YM 417

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           VPFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNN 413
           R GDW C +C + NF +   C RC  P ++ +
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEH 522

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C +C + NF +   C RC  P +
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAA 406

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  431 bits (1109), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/436 (49%), Positives = 276/436 (63%), Gaps = 45/436 (10%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAE---SLECYYGKDEVKVISIDDESA-- 55
           MYYI +ET+TLH +ETPKDHT+I  LSYQ ++ E    L     K++V ++S+ D  A  
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 56  --ISFKDMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKV 113
             ++FKD+I+Q   +++  +G++E V CSLNS WDLRVTIPRQ+ DE + LP +L+   +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 114 FDLWKEFNRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEV 173
           FDLWKE+ RW   H   +   K+K                               K  E+
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELY----------------------KILEI 158

Query: 174 HANTGAEESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLV 233
           + N+ A+ +                  K       ++    ++   I  KC+T ED   V
Sbjct: 159 NQNSDAKTNNEKLNDRSGNINMDRGYKKN------DVRSTVDVFMAIVDKCSTPEDHESV 212

Query: 234 LTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEET 293
           LT PY+SN DF+ F +E SK++YMNNLPPDTTQSELESWFAQFG KP   WTV+NI+E T
Sbjct: 213 LTHPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEST 272

Query: 294 XXXXXXXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHI 353
                       PYVEE DSISGF  FQ+HKEATDALLLNGRSILSNMANTKQPRVVEHI
Sbjct: 273 SYTNSNGNSNNSPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHI 332

Query: 354 VEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN- 412
           VE+QPSS+ +LER+Q+IS+ FPQSKNKPRPGDWNCMSCGFSNFQRRT+CFRCS+PAA++ 
Sbjct: 333 VELQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAATSN 392

Query: 413 ---------NLNSRKY 419
                     +N+RKY
Sbjct: 393 NGNGTNVNNTINTRKY 408

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 34/40 (85%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDIN 579
           VPFRAGDWKC ACSYHNFAKN+VCLRCGGPK+     D+N
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMN 586

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C++C + NF +   C RC  P +
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 17/34 (50%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLN 415
           R GDW C +C + NF +   C RC  P     LN
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILN 583

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  432 bits (1110), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 213/416 (51%), Positives = 273/416 (65%), Gaps = 35/416 (8%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E    H  +TPKD  RI+ +++Q V+AE+L C+YG + +  I ++  +  S + 
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTK-SLES 59

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QLD+DI  V+G+D+FV  SL S W +RVT+PRQARD+   L  YLQ  KVFDLWKEF
Sbjct: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEV----HAN 176
           +RW  NH + +  KK+                             N+   DE+      +
Sbjct: 120 DRWCVNHPEILGQKKA------------ISNNNCNTKSISINAAKNTKDLDEIVRILEVS 167

Query: 177 TGAEESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTK 236
              EE+G                   + E    + R T+IL  +HKKCT+ ED+  VLTK
Sbjct: 168 IPTEEAG------------------SVPEIYSLLKRTTDILIQLHKKCTSPEDMESVLTK 209

Query: 237 PYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXX 296
           PYDS++D +AF +E SK+LYMNNLPPDTTQSELESWF Q+G +PV FWTVKNIVE+T   
Sbjct: 210 PYDSHTDIRAFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNV 269

Query: 297 XXXXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEI 356
                    PYVE+QDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+
Sbjct: 270 NNNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLEL 329

Query: 357 QPSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           QPSS  VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 330 QPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 385

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  427 bits (1097), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 207/415 (49%), Positives = 268/415 (64%), Gaps = 32/415 (7%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E    H   +PKD  RI  ++YQFVDAE+L C+Y  + +  I +D E+  S + 
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETR-SLET 59

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QLD+ I+ ++G+DEFV  SL S W +RVT+PRQARD+   L  YLQ  K+FDLWKEF
Sbjct: 60  AMIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEF 119

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGAE 180
           +RW  NH + +   K+ +                            ++       N+G  
Sbjct: 120 DRWCVNHPEILEQMKTAS----------------------------NNNNSGTKGNSGGL 151

Query: 181 ESGXXXXXXXXXXXXXXXXSKEMKETPLE---INRVTEILTTIHKKCTTEEDITLVLTKP 237
                              ++E    P E   + R T+IL  +H+KC + ED+  VLT+P
Sbjct: 152 AKNAKDLDEMIRILEISSSTEEAVSVPEEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQP 211

Query: 238 YDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXX 297
           YDS++D + F +E SK+LYMNNLPPDTTQSELESWF Q+G +PV FWTVKNIVE+T    
Sbjct: 212 YDSHTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNIN 271

Query: 298 XXXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQ 357
                   PYVE+QDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+Q
Sbjct: 272 NNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQ 331

Query: 358 PSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           PSS  VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 332 PSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 649

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAA 410
           R GDW C +C + NF +   C RC  P +
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 649

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  424 bits (1090), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/415 (50%), Positives = 268/415 (64%), Gaps = 31/415 (7%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E    +  ++PKD  RI  ++YQ VDAE+L C+Y  D +  I +D E A S + 
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGE-AKSLES 59

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QLD+DI  V+G+DEFV  SL S W +RVT+ RQARD+   L  YLQ  ++FDLWKEF
Sbjct: 60  AMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGAE 180
           +RW  NH + +  +K+                             N++   +   + GA 
Sbjct: 120 DRWCVNHPELLEQRKA---------------------------TSNNNSNTKAGGSNGAL 152

Query: 181 ESGXXXXXXXXXXXXXXXXSKEMKETPLE---INRVTEILTTIHKKCTTEEDITLVLTKP 237
                              S+     P E   + R T+IL  +HKKC++ ED+  VLT+P
Sbjct: 153 AKNTKDFNEMIRILEVSTPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQP 212

Query: 238 YDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXX 297
           YDS +D + F +E SK+LYMNNLPPDTTQSELESWF Q+G +PV FWTVKNIVE+T    
Sbjct: 213 YDSYTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVN 272

Query: 298 XXXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQ 357
                   PYVEEQDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+Q
Sbjct: 273 NNWSLNNSPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQ 332

Query: 358 PSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           PSS  VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 333 PSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           R GDW C +C + NF +   C RC  P + N
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 613

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  414 bits (1065), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 211/421 (50%), Positives = 270/421 (64%), Gaps = 44/421 (10%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E D  H  ++PKD ++I+   YQF+D E L+  + +++  V+    E+  S ++
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVL----ENGCSLQE 56

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QL++DI   + DD FV CSLNS W  RVTIPRQARDE+  LP +LQ  +VFDLWKE+
Sbjct: 57  AVSQLEKDIGEHLKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEY 115

Query: 121 NRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGAE 180
           +RW  NH +T+ +++S +                           +S  +D   +  GA 
Sbjct: 116 DRWCVNHPETLALRRSNSMGKKVKDVAELRSVLEL----------DSATQD---STPGAA 162

Query: 181 ESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240
           E                         P  + +   I+  +HKKC T ED +LVLT PYDS
Sbjct: 163 E-------------------------PDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDS 197

Query: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXX 300
             D + F +E SK+LYMNNLPPDTTQSELESWF QFG++PV FWTVKNIVEET       
Sbjct: 198 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNW 257

Query: 301 XXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360
                 YVE QDSISGFV FQSH+EAT+AL LNGRSILSN+ANTKQPRV+EHIVE+QPSS
Sbjct: 258 SSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSS 317

Query: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPA-ASNNLNSRKY 419
             VL+R Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCS+P+  S  +N+  Y
Sbjct: 318 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGY 377

Query: 420 V 420
           V
Sbjct: 378 V 378

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           VPFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 483

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNN 413
           R GDW C +C + NF +   C RC  P ++ +
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEH 486

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C +C + NF +   C RC  P +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPST 367

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  394 bits (1011), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/413 (48%), Positives = 258/413 (62%), Gaps = 21/413 (5%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y++ E +T++S E PKDHT IS ++YQ +  E+L+  +  +E +  SID  +  S K+
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIW--EEARRHSID--ATHSLKN 56

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            I+ ++  +   V  +EFV CSLNS WDLRVT+ RQARDE   LP +LQ  KVFDLW+E 
Sbjct: 57  TIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREV 116

Query: 121 NRWAKNHSDTV--TVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTG 178
           +RW +NH +       +                              N D +++   +  
Sbjct: 117 DRWYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQR 176

Query: 179 AEESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPY 238
            E+                   K   ET   I +  ++L  +H+ CT++ D TLVLT P+
Sbjct: 177 MEQ---------------VNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPF 221

Query: 239 DSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXX 298
           DS  D K F  E S +LYMNNLPPDTTQSELESWFAQFGS+PV FWTVKN+VE+T     
Sbjct: 222 DSYLDIKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNN 281

Query: 299 XXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQP 358
                   YV+EQDSISGFV +Q+H+EA D+L LNGRSILSNM+NTKQPRVVEH+VEIQP
Sbjct: 282 NWSTNNNLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQP 341

Query: 359 SSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           SS +VL+R Q+I   FPQSKNKPRPGDW C SC FSNFQRRTACFRCS+P +S
Sbjct: 342 SSNSVLDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (81%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTM 583
           VPFRAGDWKC  C+YHNFAKNVVCLRCGGPK+   S + N+ T+
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATV 548

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 372 APFPQSKNKP-RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
            P     N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 497 GPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTAN 538

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C +CS+ NF +   C RC  P S
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMS 393

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  389 bits (999), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 261/413 (63%), Gaps = 29/413 (7%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISI-DDESAISFK 59
           M+Y+++E DTLH VETPKDHTRI+K+++Q V+A +L    G+   KV  I  DE A SFK
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL----GEVPTKVDQIVIDEQAESFK 56

Query: 60  DMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119
              ++L+E I ++  D  F+ CSL S WD+RVT+ RQARD  V++P +LQ  K+FDL KE
Sbjct: 57  AAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKE 116

Query: 120 FNRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGA 179
           + RW  NH + ++ K                               N  +E     N GA
Sbjct: 117 YQRWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEE-----NDGA 171

Query: 180 EESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239
            +                    +M +   ++   T +L  +  +CTT +D   VLT PYD
Sbjct: 172 IDD-------------------KMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYD 212

Query: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXX 299
           S++D ++F +E S++LYMNNLP DTTQSELESWF QFG++PV FWT KN+V +T      
Sbjct: 213 SDTDVRSFLQERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANT 272

Query: 300 XXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359
                 PYVEE DSI GFV FQ+H+EA + L LNGR+ILSN+ANTKQPRVVEH+VEIQPS
Sbjct: 273 WNSNNSPYVEELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPS 332

Query: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           S +VL++  +I + FPQSKNKPRPGDW+C SCGFSNFQRRTACFRCS+PA SN
Sbjct: 333 STSVLDKAHEILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDW C +C+YHNFAKNV+CLRCGGPK+
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP---KSHIN 574
           R GDW C +C + NF +   C RC  P     HIN
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  367 bits (941), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/420 (44%), Positives = 253/420 (60%), Gaps = 43/420 (10%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECY-YGKDEVKVISIDDESAISFK 59
           M+Y++IE  +    ++ KD T++ +L YQ +DA+SLE      +E++ ++++  +    +
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSN---LQ 57

Query: 60  DMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119
           D +   +++I +V+  +EFV CS+ S W+LRV +PR+A DE V LP  L+   V DLWKE
Sbjct: 58  DTVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKE 117

Query: 120 FNRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDKEDEVHANTGA 179
           F+RW  NH D +   K  N                                  VH   G 
Sbjct: 118 FDRWCTNHPDALQSVKGYNRKCKNLPM--------------------------VHQVLGV 151

Query: 180 EESGXXXXXXXXXXXXXXXXSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239
           E+                        T  E+   ++IL  +HKKC++++D   VLT+PY+
Sbjct: 152 EQRLNESVNANGY-------------TRKEVGITSDILLQLHKKCSSDDDTNTVLTQPYN 198

Query: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXX 299
           S  D++ F EE S +LY+NNLPPDTTQ ELE+WF QFGS+PVSFWT KNIVE+T      
Sbjct: 199 SKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNN 258

Query: 300 XXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359
                  YVEEQDS+SGF +FQ+ +EA +AL L+GRSILSN+ANTKQPR+VEH+VEI PS
Sbjct: 259 WNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPS 318

Query: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKY 419
           S  +L   ++I + FPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+P  S   NS  +
Sbjct: 319 SARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQNSTGF 378

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDWKC AC+YHNFAKN++CLRC GPK+
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKY 419
           R GDW C +C + NF +   C RCS P  S+  N R +
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTSHPHNLRSH 482

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  321 bits (822), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 177/217 (81%), Gaps = 1/217 (0%)

Query: 205 ETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDT 264
           ++  +++R  EIL  +H++C+T ED+ +VLT PYDS+ D + F +E SK+LY+NNLPPDT
Sbjct: 160 DSSFDLSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDT 219

Query: 265 TQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHK 324
           TQSELESWF QFG++PV FWTVKNIVEET            PYVEEQDSISGFV FQ+H+
Sbjct: 220 TQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHE 279

Query: 325 EATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPG 384
           EAT+ L LNGRSILSNMANTKQPRVVEHIVEIQPSS  VL+R Q+I +PFPQSKNKPRPG
Sbjct: 280 EATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPG 339

Query: 385 DWNCMSCGFSNFQRRTACFRCSYPAASN-NLNSRKYV 420
           DWNC SCGFSNFQRRTACFRCS+PA +   +N+++Y+
Sbjct: 340 DWNCPSCGFSNFQRRTACFRCSFPATTAVQVNTKQYI 376

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 94/135 (69%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           MYY+V+E +T H +E PKD  RI+K+SYQFV+AE+L+ +Y +++  +  I +  + +  +
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            +  L+E+I  + GD+ FV CSLNS W LRVT+ RQARD+   LP YLQ  K+FDLWKE+
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 121 NRWAKNHSDTVTVKK 135
            RW  NH + + ++K
Sbjct: 121 ERWCVNHPEVMPLRK 135

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPK 570
           VPFRAGDWKC +C YHNFAKNVVCLRCGGPK
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPK 515

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 17/53 (32%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRC-----------------GGPKSHINSGDI 578
           R GDW C +C + NF +   C RC                 GGP +++ +G I
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVNTKQYISGGPAANLQNGKI 389

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408
           R GDW C SC + NF +   C RC  P
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGP 514

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  318 bits (814), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 182/222 (81%), Gaps = 2/222 (0%)

Query: 200 SKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNN 259
           ++E+ E P+ +    +IL  + ++CTT+EDI+ VL++PYDS+ D + F +E SK+LY+NN
Sbjct: 158 TEEITEKPV-LGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNN 216

Query: 260 LPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVS 319
           LPPDTTQSELESWF QFG++PV FWTVKNIVEET            PYVEEQDSISGFV 
Sbjct: 217 LPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVV 276

Query: 320 FQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKN 379
           FQ+H+EAT+ L+LNGRSILSNMANTKQPRVVEHIVEIQPSS  VL+R Q+I +PFPQSKN
Sbjct: 277 FQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKN 336

Query: 380 KPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN-NLNSRKYV 420
           KPRPGDWNC SCGFSNFQRRTACFRCS+PAAS   +N+++Y+
Sbjct: 337 KPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYM 378

 Score =  184 bits (466), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 105/136 (77%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E +  H +E PKDH R++KLSYQF+DAES++ YY  D++ +IS+D + +ISF++
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            I + D D+ ++VG+DEFV CSL S W +RVTIPRQARDE   LP YLQ  +VFDLWKE+
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 121 NRWAKNHSDTVTVKKS 136
           +RW  NH + +T++KS
Sbjct: 121 DRWCANHPEVLTLRKS 136

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 27/33 (81%)

Query: 541 PFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHI 573
           PFRAGDWKC  C+YHNFAKN+VCLRCG  K  I
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSI 508

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 10/48 (20%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP---------KSHIN-SGDINS 580
           R GDW C +C + NF +   C RC  P         K ++N +G+INS
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINS 386

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           R GDW C +C + NF +   C RC     S
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  312 bits (799), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 138/203 (67%), Positives = 169/203 (83%)

Query: 210 INRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSEL 269
           + R  ++L  +HKKC++ ED+  VLT+PYDS++D ++F +E SK+LYMNNLPPDTTQSEL
Sbjct: 184 LQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQSEL 243

Query: 270 ESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHKEATDA 329
           ESWF Q+G++PV FWTVKNIVE+T            PYVE+QDSISGFV FQ+H+EAT+ 
Sbjct: 244 ESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEATEV 303

Query: 330 LLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCM 389
           L LNGRSILSN+ANTKQPRVVEH++E+QPSS  VL++ Q+I +PFPQSKNKPRPGDWNC 
Sbjct: 304 LALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCP 363

Query: 390 SCGFSNFQRRTACFRCSYPAASN 412
           SCGFSNFQRRTACFRCS+PA SN
Sbjct: 364 SCGFSNFQRRTACFRCSFPAPSN 386

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 1/135 (0%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E    H  ++PKD  RI  ++YQ VDAE+L  +Y       I +D E   S + 
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKK-SLES 59

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QLD+DI+ ++G+D+FV  SL S W +RVT+PRQARD+   L  YLQ  ++FDLWKEF
Sbjct: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 121 NRWAKNHSDTVTVKK 135
            RW  NH + + ++K
Sbjct: 120 ERWCINHPEIMGLRK 134

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           R GDW C +C + NF +   C RC  P + N
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 593

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  307 bits (786), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 167/210 (79%), Gaps = 3/210 (1%)

Query: 205 ETPLE---INRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLP 261
           E PL+   +++   IL+ +HKKC   ED ++VLT PYDS  D + F +E SK+LYMNNLP
Sbjct: 151 EAPLQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLP 210

Query: 262 PDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQ 321
           PDTTQSELESWF QFG++PV FWTVKN+VEET             YVEEQDSISGFV FQ
Sbjct: 211 PDTTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQ 270

Query: 322 SHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKP 381
           +H+EAT+AL LNGRSILSNMANTKQPRVVEH+VE+QPSS  VL+R  ++ +PFPQSKNKP
Sbjct: 271 THEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKP 330

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           RPGDWNC SCGFSNFQRRTACFRCS+PA S
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 92/140 (65%), Gaps = 7/140 (5%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           MYY+V+E +T+H  E PKDHTR+S++ YQF+ +++L+  + +  +  +          ++
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQ-----LRE 55

Query: 61  MIKQLDEDIKTVVGDD--EFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWK 118
            + QLD+ + + +  D  EF   SL+S W +RVTIPRQARDE   LP YLQ  KVFDLWK
Sbjct: 56  QVAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWK 115

Query: 119 EFNRWAKNHSDTVTVKKSKN 138
           E++RW  NH +T+ ++K+ N
Sbjct: 116 EYDRWCVNHPETLPLRKNSN 135

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (81%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTM 583
           VPFRAGDWKC++C+YHNFAKNVVCLRCGGPK+   +G  N   +
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANL 540

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408
           R GDW C+SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C +C + NF +   C RC  P +
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  303 bits (776), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 166/209 (79%)

Query: 205 ETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDT 264
           +T L I   T ILT + KKCTT +D+ LVLT+PYDS +D K F +E S++LYMNNLP DT
Sbjct: 170 QTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDT 229

Query: 265 TQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHK 324
           TQSELESWF QFG++P+ FWT KN +EET            P V+EQD ++GFV FQSH+
Sbjct: 230 TQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHE 289

Query: 325 EATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPG 384
           EAT+AL+LNGRSILSN+ANTKQPRVVEHIVEIQPSS  VL+  QDI + FPQSKNKPRPG
Sbjct: 290 EATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPG 349

Query: 385 DWNCMSCGFSNFQRRTACFRCSYPAASNN 413
           DW+C SCGFSNFQRRTACFRCS+PA +NN
Sbjct: 350 DWSCPSCGFSNFQRRTACFRCSFPAPNNN 378

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/137 (51%), Positives = 99/137 (72%), Gaps = 4/137 (2%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E +T H VETPKDH+RI+K SYQF+++E+L+  +  +E K I I D  A +FKD
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATF--EEPKSIDIPD-MANAFKD 57

Query: 61  MIKQLDEDIKTVVGD-DEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119
            I QL+ DIK  + D  +FV CSL SVWD+RVT+PRQA D    LP YL+  +VF+LWKE
Sbjct: 58  TISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKE 117

Query: 120 FNRWAKNHSDTVTVKKS 136
           F++W  NH + + ++KS
Sbjct: 118 FDKWCGNHPEVIPMRKS 134

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/31 (83%), Positives = 28/31 (90%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPK 570
           VPFRAGDWKC +C+YHNFAKNVVCLRC  PK
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSG 576
           R GDW C +C + NF +   C RC  P  + N G
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFPAPNNNKG 380

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 16/30 (53%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           R GDW C SC + NF +   C RC  P  S
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  300 bits (769), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 140/210 (66%), Positives = 164/210 (78%)

Query: 210 INRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSEL 269
           I + T +L  +H KCTT ED +LVLT PYDS +D  +F +E S++LYMNNLPPDTTQSEL
Sbjct: 155 IQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSEL 214

Query: 270 ESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHKEATDA 329
           ESWF QFG++PV FWTVKN+VE+T             YVEE DSISGFV FQSH+ A++A
Sbjct: 215 ESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEA 274

Query: 330 LLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCM 389
           L LNGRSILSNMANTKQPRVVEH+VE++PSS  VL+  Q+I +PFPQSKNKPRPGDWNC 
Sbjct: 275 LNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCP 334

Query: 390 SCGFSNFQRRTACFRCSYPAASNNLNSRKY 419
           SCGFSNFQRR ACFRCS+PA S    S+ Y
Sbjct: 335 SCGFSNFQRRIACFRCSFPATSAVTVSKLY 364

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 74/128 (57%), Gaps = 7/128 (5%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFV-DAESLECYYGKDEVKVISIDDESAISFK 59
           MYY++ E D  H  +TPKDH R+SK+ YQ + + E L  Y    E++V     + A    
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATG-- 58

Query: 60  DMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119
               QL+  ++     + FV CSL+S W LRVT+PRQA DE   LP +L   KVFDLWKE
Sbjct: 59  ----QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKE 114

Query: 120 FNRWAKNH 127
            +RW  NH
Sbjct: 115 CDRWCANH 122

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (93%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           VPFRAGDWKC+ CSYHNFAKN+VCLRCG PK+
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT 532

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 377 SKNKP-RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412
           S N P R GDW C++C + NF +   C RC  P  +N
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           R GDW C +C + NF + + C RC  P +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  292 bits (747), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/204 (66%), Positives = 158/204 (77%)

Query: 205 ETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDT 264
           ET   I+  +++L  +H+KCTTE+D   VLT PYDS  D+  F E +S +LYMNNLPPDT
Sbjct: 153 ETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDT 212

Query: 265 TQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHK 324
           TQSELE+WF QFG +P+ FWTVKNI+E+T            PYVEE DSISGF+ F +HK
Sbjct: 213 TQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHK 272

Query: 325 EATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPG 384
           EA D L LNG SILSN+ANTKQPRVVEH+VEIQPSS  V+ER+Q I  PFPQSKNKPRPG
Sbjct: 273 EAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPG 332

Query: 385 DWNCMSCGFSNFQRRTACFRCSYP 408
           DWNC SCGFSNFQRRTACFRCS+P
Sbjct: 333 DWNCPSCGFSNFQRRTACFRCSFP 356

 Score =  126 bits (317), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 4/138 (2%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           MYY +IE  T H  E PKDHT+I  +SYQF++  +L+  +  D++  I   D + +   +
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNI---DCTTLPLSE 57

Query: 61  MIKQLDEDIKTVVGDDE-FVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119
            I  L +D++  + + E FV CSLNS WDLRVTI RQA+DE  TLP + +  ++FDLWKE
Sbjct: 58  SIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKE 117

Query: 120 FNRWAKNHSDTVTVKKSK 137
           F+RW  NH + V  +  +
Sbjct: 118 FDRWCVNHKELVQTRDPR 135

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (90%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571
           VPFRAGDWKC+ C YHNFAKN+VCLRC GPKS
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAA 410
           R GDW C++CG+ NF +   C RCS P +
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSH 572
           R GDW C +C + NF +   C RC  P+  
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQ 359

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  256 bits (653), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 155/429 (36%), Positives = 217/429 (50%), Gaps = 73/429 (17%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V++     S   P     + +L YQ +D  SLE    ++E  V+ +D ES    K+
Sbjct: 1   MHYVVLDVQIDSSAVKPV----LLRLGYQVIDPVSLEA---RNEPYVVDVDGES---IKE 50

Query: 61  MIKQLDEDIKTVV--------------GDD---EFVFCSLNSVWDLRVTIPRQARDEIVT 103
            I +LDED+K+                G D   EFVFC+LN  W ++V +   A D  V 
Sbjct: 51  FIAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVE 110

Query: 104 LPDYLQEVKVFDLWKEFNRWAKNHSDTVTVKKSKNXXXXXXXXXXXXXXXXXXXXXXXXX 163
           LP+YL+    FD+WKE++ W KNHSD                                  
Sbjct: 111 LPEYLRYPVFFDIWKEYSIWKKNHSD---------------------------------- 136

Query: 164 XXNSDKEDEVHANTGAEESGXXXXXXXXXXXXXXXXSKEMKET----PLEINRVTEILTT 219
              S +  +  AN  + +S                   E+K+       ++   T +LT 
Sbjct: 137 ---SSESPQTQANGESIDSFAGKIEELVRTLDVSTEYDELKQKNDDPTFDVRLATLVLTA 193

Query: 220 IHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSK 279
           +HKKC T  D T VLT PYD   D+K F EE SK+LY++N+P +  Q++LE WF Q G  
Sbjct: 194 LHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIPSELNQTDLEGWFQQKGVA 253

Query: 280 PVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHKEATDALLLNGRSILS 339
            V FWT+KNI ++               +   DS+ GF  FQSH +A  AL L+G   + 
Sbjct: 254 SVGFWTLKNISDDATLASQRNHGKM---LSIPDSMFGFAIFQSHNDAEYALNLHG--TVM 308

Query: 340 NMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRR 399
            +   K  + +E +++IQPSS+ +LE+VQD     PQ+KNKPRPGDWNC SCGFSNFQRR
Sbjct: 309 KIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKPRPGDWNCPSCGFSNFQRR 368

Query: 400 TACFRCSYP 408
           TACFRC++P
Sbjct: 369 TACFRCAFP 377

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/40 (72%), Positives = 32/40 (80%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDIN 579
           VPFRAGDWKC  C YHNFAKN+VCLRCGGPK+   + D N
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKN 571

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTM 583
           R GDW C +C + NF +   C RC  P  +  SG+     M
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGKLPM 391

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408
           R GDW C  C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  232 bits (592), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 109/200 (54%), Positives = 141/200 (70%), Gaps = 6/200 (3%)

Query: 210 INRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSEL 269
           I+  T++L +++KKC++ EDI  VLT+PYD   D K F EE +++++++NLPPD TQ+EL
Sbjct: 160 IDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNEL 219

Query: 270 ESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSISGFVSFQSHKEATDA 329
           E+WFA   SKP+ +WT K   E +             YV  Q SI GF+ FQ+H+EA  +
Sbjct: 220 ETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAKQS 273

Query: 330 LLLNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCM 389
           LLLNG+SI S+  + KQ   VEHI+E+ PSS  VL+  QDI  PFPQSKNKPR GDWNC 
Sbjct: 274 LLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCP 333

Query: 390 SCGFSNFQRRTACFRCSYPA 409
           SCGFSNFQRRTACFRCS+PA
Sbjct: 334 SCGFSNFQRRTACFRCSFPA 353

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 1/127 (0%)

Query: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60
           M+Y+V+E ++ H   T KD TRI  LSYQ V+ +        + V  I+I ++S  +F+D
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSE-NFQD 59

Query: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120
            + QLD DIKT +G +EFV C+LNS+ +LRVT+ RQA D  V LP YL+  K+FDLW EF
Sbjct: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119

Query: 121 NRWAKNH 127
            ++  NH
Sbjct: 120 KKFCANH 126

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 28/31 (90%)

Query: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPK 570
           VPFRAGDWKC +C+YHNFAKN+ CLRCG PK
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 7/41 (17%)

Query: 371 SAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411
           S PF       R GDW C SC + NF +  AC RC  P  S
Sbjct: 445 SVPF-------RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 212 RVTEILTTIHKKCTTEEDITLVLTKPYDSN---SDFKAFKEEASKL-------------- 254
           R+    + + KK   EE I  +L+KP  +N   ++  A  +++ K+              
Sbjct: 172 RLRRARSKLRKKDLDEETIQKLLSKPRKTNPEGTNKTAMSQQSEKVSSTKKVFDIVGNPP 231

Query: 255 ---LYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNI 289
              L + NLP D TQ ELE  F   G K V   +V+N+
Sbjct: 232 HHVLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [891
           bp, 296 aa] {ON}
           complement(146455..147322,147425..147447) [891 nt, 297
           aa]
          Length = 296

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 251 ASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNI 289
           A+ +L + NLP  TT+ +L+  FAQ G K V   +V+N+
Sbjct: 223 ANNILLVQNLPNGTTEVQLKELFAQTGLKEVRLVSVRNL 261

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 26/122 (21%)

Query: 255 LYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETXXXXXXXXXXXXPYVEEQDSI 314
           +Y+ N+ P+T Q E E  F+Q+G+       + + V ET               E +   
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDN-------------EGKLRG 262

Query: 315 SGFVSFQSHKEATDALL------LNGRSILSNMANTKQPRVVEHIVEIQPSSVTVLERVQ 368
            GFV+F+ H  A  A+        NG+ +    A  K  R+ E   + + S +  L + Q
Sbjct: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322

Query: 369 DI 370
            +
Sbjct: 323 GV 324

>CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 674

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 222 KKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKP 280
           +K  ++ D++L+   P  +N    A +      LY+ NLPPDT++ EL   F+ Q G + 
Sbjct: 530 EKGMSQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDTSEQELRQLFSPQPGFRR 586

Query: 281 VSFWTVKN 288
           +SF    N
Sbjct: 587 LSFKNKNN 594

>KNAG0F01120 Chr6 complement(199529..201436) [1908 bp, 635 aa] {ON}
           Anc_2.52 YNL197C
          Length = 635

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F AQ G + +SF
Sbjct: 473 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRHLFSAQQGFRRLSF 528

>KLLA0F20834g Chr6 complement(1942016..1943866) [1851 bp, 616 aa]
           {ON} some similarities with Saccharomyces cerevisiae
           YDL224C WHI4 and to uniprot|P34761 Saccharomyces
           cerevisiae YNL197C WHI3
          Length = 616

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSFW 284
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F  Q G K +SF 
Sbjct: 425 SQVDLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFGGQKGFKRLSFR 481

Query: 285 TVKN 288
              N
Sbjct: 482 NKNN 485

>Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)
           [1803 nt, 601 aa]
          Length = 600

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G + +SF
Sbjct: 435 SQADLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQQGFRRLSF 490

>CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 671

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLP D T+ EL   F+ QFG + +SF
Sbjct: 520 SQADLSLLARIPPPAN---PADQNPPCNTLYVGNLPSDATEQELRQLFSNQFGFRRLSF 575

>KAFR0F00290 Chr6 complement(71809..73851) [2043 bp, 680 aa] {ON}
           Anc_2.52 YNL197C
          Length = 680

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 221 HKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSK 279
           ++   ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G +
Sbjct: 527 NESAISQADLSLLAKIPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQEGFR 583

Query: 280 PVSF 283
            +SF
Sbjct: 584 RLSF 587

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 255 LYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           LY+ NLPPDTT+ EL   F  Q G + +SF
Sbjct: 555 LYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 255 LYMNNLPPDTTQSELESWFAQFGSKPVSF 283
           +++ N+P D TQ  LE  FAQFG  PV +
Sbjct: 284 VFIRNVPYDATQESLEEHFAQFG--PVKY 310

>TPHA0H00860 Chr8 (176257..178023) [1767 bp, 588 aa] {ON} Anc_2.52
           YNL197C
          Length = 588

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G + +SF
Sbjct: 427 SQADLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQPGFRRLSF 482

>Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON}
           YDL224C (REAL)
          Length = 650

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSFW 284
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF 
Sbjct: 510 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSFR 566

Query: 285 TVKN 288
              N
Sbjct: 567 NKMN 570

>NCAS0D00290 Chr4 complement(39189..41069) [1881 bp, 626 aa] {ON}
           Anc_2.52
          Length = 626

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G + +SF
Sbjct: 492 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQEGFRRLSF 547

>YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}
           WHI4Putative RNA binding protein and partially redundant
           Whi3p homolog that regulates the cell size requirement
           for passage through Start and commitment to cell
           division
          Length = 649

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 509 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSF 564

>KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2.52
           YNL197C
          Length = 571

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 418 SQADLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSKQQGFRRLSF 473

>Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON}
           YDL224C (REAL)
          Length = 651

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 510 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSNQPGFRRLSF 565

>Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON}
           YDL224C (REAL)
          Length = 652

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 512 SQADLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSF 567

>ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 745

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F  Q G + +SF
Sbjct: 593 SQADLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSGQQGFRRLSF 648

>Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar to
           Ashbya gossypii ABL158C
          Length = 689

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G + +SF
Sbjct: 543 SQVDLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQKGFRRLSF 598

>ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL224C
           (WHI4) and YNL197C (WHI3)
          Length = 729

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 226 TEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWF-AQFGSKPVSF 283
           ++ D++L+   P  +N    A +      LY+ NLPPD T+ EL   F +Q G + +SF
Sbjct: 583 SQVDLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSSQKGFRRLSF 638

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 229 DITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 500 DLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 229 DITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 524 DLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>SAKL0E13354g Chr5 (1103459..1105474) [2016 bp, 671 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and uniprot|P34761 Saccharomyces cerevisiae YNL197C WHI3
          Length = 671

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 229 DITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 531 DLSLLARVPPPAN---PADQNPPCNTLYVGNLPPDATEHELRQLFSGQRGFRRLSF 583

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 229 DITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFA-QFGSKPVSF 283
           D++L+   P  +N    A +      LY+ NLPPD T+ EL   F+ Q G + +SF
Sbjct: 587 DLSLLAKVPPPAN---PADQNPPCNTLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
           Anc_3.497
          Length = 1150

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 209 EINRVTEILTTIHKKCTTEEDITLVLTKPYDSNSDFKAFKEEASKLLYMNNLP 261
           E+  VT++LT +      +EDI  +    YD  +DFK   EE  ++  M + P
Sbjct: 571 ELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYNDFKDDVEEQEEMEIMGSFP 623

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,966,179
Number of extensions: 2180995
Number of successful extensions: 5964
Number of sequences better than 10.0: 59
Number of HSP's gapped: 6118
Number of HSP's successfully gapped: 135
Length of query: 684
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 568
Effective length of database: 40,180,143
Effective search space: 22822321224
Effective search space used: 22822321224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)