Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.317.350ON38038020080.0
TPHA0F029707.350ON38137717500.0
Skud_4.897.350ON38538017230.0
YDL168W (SFA1)7.350ON38637717060.0
Suva_4.787.350ON38537917060.0
Smik_4.707.350ON38637916950.0
CAGL0L01111g7.350ON38137816940.0
KLTH0H01254g7.350ON38137616890.0
NCAS0A141607.350ON45137916950.0
Kwal_56.246427.350ON38137616860.0
KLLA0D12342g7.350ON38437916810.0
TBLA0E00390singletonON38337916580.0
SAKL0F11374g7.350ON38337816460.0
Ecym_47237.350ON38137816380.0
ZYRO0F11704g7.350ON38238016330.0
ACL148C7.350ON38137816150.0
TDEL0C019807.350ON38538015970.0
KAFR0B008807.350ON38137915740.0
KNAG0C037907.350ON38238214150.0
NDAI0A018907.350ON42237914170.0
SAKL0A00880gsingletonON38837412171e-167
KLLA0B00451gsingletonON3863872936e-29
KLLA0D19929gsingletonON3863592691e-25
SAKL0C10164g3.118ON3512902478e-23
CAGL0D00198g7.3ON3833882453e-22
YBR145W (ADH5)3.118ON3512832425e-22
NCAS0I01720singletonON3513772408e-22
CAGL0J01441g2.480ON3722692391e-21
KLLA0F00506g7.3ON3853292391e-21
SAKL0B00814g8.16ON3543612381e-21
Suva_4.3943.118ON3512892382e-21
Ecym_53313.118ON3482632362e-21
Smik_13.520na 1ON3483042363e-21
Skud_13.2402.480ON3752682364e-21
YOL086C (ADH1)3.118ON3483042344e-21
Skud_13.477na 1ON3483042345e-21
AER032W3.118ON3512892345e-21
KLTH0G18986g8.16ON3543632337e-21
SAKL0F06270gna 2ON3513322337e-21
TPHA0G032102.480ON3772682338e-21
TDEL0C003908.16ON3533832311e-20
YLR070C (XYL2)8.16ON3563822302e-20
KLTH0G15686g3.118ON3513102302e-20
Skud_15.683.118ON3483042292e-20
Suva_10.1548.16ON3563762302e-20
YMR303C (ADH2)na 1ON3483042292e-20
KAFR0G014203.118ON3512902293e-20
Suva_13.2612.480ON3752682293e-20
Skud_2.2723.118ON3512892283e-20
KLTH0D00616g7.3ON3823372293e-20
Smik_15.713.118ON3483042283e-20
KNAG0K020003.118ON3502802265e-20
NDAI0H021602.480ON3812632275e-20
KLLA0B09064gna 3ON3743752276e-20
Smik_2.2843.118ON3512892267e-20
NCAS0I023503.118ON3513792259e-20
Suva_13.494na 1ON3483042249e-20
Suva_15.813.118ON3483042231e-19
NCAS0A077802.480ON3732682232e-19
Smik_13.2662.480ON3752682214e-19
KLTH0D05588g2.480ON3892632214e-19
KLLA0F18260gsingletonON3482642204e-19
CAGL0I07843g3.118ON3523042204e-19
Ecym_73912.480ON3753792205e-19
KLLA0F13530g2.480ON3752682205e-19
Kwal_26.6684singletonON3563582196e-19
ZYRO0B05940g3.118ON3793012196e-19
TPHA0M007303.118ON3502842187e-19
KLLA0F21010g3.118ON3502832188e-19
TBLA0I011402.480ON3772632189e-19
YMR083W (ADH3)2.480ON3752682189e-19
KAFR0A007902.480ON3773062171e-18
NDAI0A069303.118ON3513022161e-18
YAL060W (BDH1)7.3ON3822382162e-18
TBLA0E03430singletonON3512902152e-18
SAKL0B08184gna 3ON3733802143e-18
SAKL0E02838g2.480ON3772632143e-18
Kwal_56.231983.118ON3512932133e-18
TDEL0D050503.118ON3513072133e-18
Kwal_55.19574singletonON3563592133e-18
TDEL0H044607.3ON3822782144e-18
TBLA0E034403.118ON3512902134e-18
Suva_12.260singletonON3573842124e-18
AAR084WsingletonON3852892125e-18
ZYRO0G03388g2.480ON3703032117e-18
Kwal_26.77992.480ON3872632119e-18
KLTH0E05588gna 2ON3482842099e-18
ABL033C2.480ON3732902091e-17
Smik_1.67.3ON3823242091e-17
TBLA0A042907.3ON3952392092e-17
TDEL0A025602.480ON3732632072e-17
Smik_48.1singletonON3573672063e-17
KAFR0L02010singletonON3512692045e-17
KNAG0E025902.480ON3742682055e-17
YJR159W (SOR1)na 4ON3573922037e-17
Kpol_1036.193.118ON3532922037e-17
Kpol_1058.118.16ON3533462029e-17
Kpol_431.82.480ON3802632031e-16
Skud_1.37.3ON3822402011e-16
ABR229C8.16ON3533612001e-16
YDL246C (SOR2)singletonON3573922002e-16
ZYRO0C12562gna 2ON3483011974e-16
Skud_20.2singletonON3573641966e-16
Skud_4.2singletonON3573641966e-16
Suva_1.77.3ON3822401958e-16
NCAS0J003008.16ON3573751958e-16
ZYRO0G03410gsingletonON3733541958e-16
KAFR0L02000singletonON3612691941e-15
Kpol_1049.187.2ON3862411941e-15
SAKL0D14872g7.3ON3833061941e-15
ZYRO0F02552g8.16ON3513851931e-15
KNAG0K01040singletonON3913791932e-15
Kwal_26.67397.3ON3822301904e-15
KLTH0A00418gsingletonON3562611871e-14
SAKL0D14894g7.2ON3852401871e-14
NDAI0H020507.3ON3852451852e-14
Kwal_55.20564singletonON2162351765e-14
TDEL0F03190na 2ON3512871799e-14
NCAS0A076607.3ON3862441772e-13
KAFR0I001707.3ON3812951744e-13
KAFR0I001607.2ON3853241736e-13
KLLA0D05511g8.16ON3543741711e-12
KNAG0I00120singletonON3812311674e-12
KNAG0D00110singletonON3623421621e-11
KLLA0F00528g7.2ON3813151585e-11
TPHA0H03100singletonON3922411585e-11
NCAS0A076707.2ON4392421551e-10
TPHA0J00170singletonON3613451532e-10
Skud_1.27.2ON4172291532e-10
Suva_1.67.2ON4172291532e-10
YAL061W (BDH2)7.2ON4172291523e-10
Smik_1.57.2ON4172291523e-10
TDEL0D037203.253ON3352481452e-09
NCAS0C03020singletonON3623571442e-09
Kwal_47.17532na 5ON3733471442e-09
KAFR0C005803.253ON3342751408e-09
NDAI0H02950singletonON3633391391e-08
YBR046C (ZTA1)3.253ON3342491372e-08
Smik_2.1703.253ON3342501353e-08
NDAI0G04880singletonON3613091353e-08
KNAG0E042007.2ON3853171345e-08
SAKL0H22088gna 5ON3763111311e-07
SAKL0D14938gsingletonON3782811311e-07
KLTH0E07964gna 5ON3743001301e-07
KLTH0C07854g3.253ON3583471292e-07
Skud_2.1623.253ON3342501292e-07
CAGL0M14047gna 6ON3593521283e-07
NDAI0A063203.253ON3492861221e-06
CAGL0H06853gsingletonON3603521193e-06
KAFR0A08730singletonON3602821184e-06
KLTH0B04972gna 7ON3603561175e-06
SAKL0D03872g3.253ON3483591176e-06
NDAI0A08470singletonON3633461176e-06
ZYRO0A03366g3.253ON3493271168e-06
KLLA0A10549g3.253ON353881151e-05
NDAI0H020607.2ON3993431151e-05
KLLA0F00638gna 8ON3822461141e-05
NCAS0D01220na 9ON3623161123e-05
KNAG0B06990singletonON3583401095e-05
ABL090W3.253ON3342261079e-05
NCAS0I017303.253ON3492601061e-04
CAGL0H09944g3.253ON3333271033e-04
KLLA0E19889gna 7ON3662331033e-04
KLTH0B00506gna 8ON3983291016e-04
KNAG0K02680singletonON3592831008e-04
Ecym_1093singletonON383283980.001
Skud_13.494na 6ON360348980.001
Smik_13.535na 6ON360318960.002
Suva_13.513na 6ON360319920.007
SAKL0C00264gsingletonON359347910.009
TDEL0A00140singletonON405229910.010
YMR318C (ADH6)na 6ON360352890.015
Kwal_26.9050singletonON36494850.055
KLTH0C10538gsingletonON273164820.10
Suva_6.13singletonON6859730.17
SAKL0H00374gsingletonON428360810.17
TDEL0F02300na 5ON379292800.23
Kpol_526.18singletonON361285780.31
ZYRO0G10318gna 5ON37692780.38
Skud_86.1singletonON8959720.44
TDEL0A063308.688ON72371770.63
Smik_26.3singletonON12580710.89
TPHA0E007307.413ON97861751.1
Suva_7.5singletonON212106711.9
Kpol_1018.1077.413ON1127115722.5
KLTH0C06182g7.413ON1025108722.5
Kwal_27.107337.413ON1014108713.3
ZYRO0B00748gna 10ON1209168704.5
AFR625C1.139ON36887685.4
YLR460Cna 11ON376173685.6
AFR675W1.75ON35372685.7
TBLA0I010807.413ON155534696.3
Skud_77.1singletonON255207676.4
SAKL0D11242g1.461ON21480668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.31
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   778   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   678   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   668   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   661   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   661   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   657   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   657   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   655   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   657   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   654   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   652   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      643   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   638   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   635   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   633   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   626   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   619   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   610   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   549   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    550   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   473   e-167
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   117   6e-29
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   108   1e-25
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   100   8e-23
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    99   3e-22
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    98   5e-22
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               97   8e-22
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    97   1e-21
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    97   1e-21
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    96   1e-21
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    96   2e-21
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    96   2e-21
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    96   3e-21
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    96   4e-21
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    95   4e-21
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    95   5e-21
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    95   5e-21
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    94   7e-21
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    94   7e-21
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    94   8e-21
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    94   1e-20
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    93   2e-20
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    93   2e-20
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    93   2e-20
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    93   2e-20
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    93   2e-20
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    93   3e-20
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    93   3e-20
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    92   3e-20
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    93   3e-20
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    92   3e-20
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    92   5e-20
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     92   5e-20
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    92   6e-20
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    92   7e-20
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     91   9e-20
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    91   9e-20
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    91   1e-19
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    91   2e-19
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    90   4e-19
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    90   4e-19
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    89   4e-19
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    89   4e-19
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    89   5e-19
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    89   5e-19
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    89   6e-19
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    89   6e-19
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    89   7e-19
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    89   8e-19
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    89   9e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    89   9e-19
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    88   1e-18
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    88   1e-18
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    88   2e-18
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               87   2e-18
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    87   3e-18
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    87   3e-18
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    87   3e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    87   3e-18
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    87   3e-18
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    87   4e-18
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    87   4e-18
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    86   4e-18
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    86   5e-18
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    86   7e-18
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    86   9e-18
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    85   9e-18
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    85   1e-17
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     85   1e-17
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    85   2e-17
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    84   2e-17
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    84   3e-17
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              83   5e-17
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    84   5e-17
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    83   7e-17
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    83   7e-17
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    82   9e-17
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    83   1e-16
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     82   1e-16
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    82   1e-16
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    82   2e-16
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    80   4e-16
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     80   6e-16
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    80   6e-16
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     80   8e-16
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       80   8e-16
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    80   8e-16
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              79   1e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    79   1e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    79   1e-15
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    79   1e-15
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    79   2e-15
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    78   4e-15
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    77   1e-14
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    77   1e-14
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    76   2e-14
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    72   5e-14
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    74   9e-14
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    73   2e-13
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    72   4e-13
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    71   6e-13
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    70   1e-12
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  69   4e-12
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   67   1e-11
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    65   5e-11
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    65   5e-11
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    64   1e-10
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                64   2e-10
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      64   2e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     64   2e-10
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    63   3e-10
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     63   3e-10
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    60   2e-09
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    60   2e-09
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    60   2e-09
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    59   8e-09
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    58   1e-08
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    57   2e-08
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    57   3e-08
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    57   3e-08
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    56   5e-08
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    55   1e-07
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    55   1e-07
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    55   1e-07
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    54   2e-07
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    54   2e-07
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    54   3e-07
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    52   1e-06
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    50   3e-06
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    50   4e-06
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    50   5e-06
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    50   6e-06
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             50   6e-06
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    49   8e-06
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    49   1e-05
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    49   1e-05
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    49   1e-05
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               48   3e-05
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             47   5e-05
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    46   9e-05
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     45   1e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    44   3e-04
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    44   3e-04
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    44   6e-04
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    43   8e-04
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    42   0.001
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    42   0.001
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    42   0.002
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    40   0.007
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    40   0.009
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 40   0.010
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    39   0.015
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    37   0.055
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    36   0.10 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    33   0.17 
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    36   0.17 
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    35   0.23 
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    35   0.31 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    35   0.38 
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    32   0.44 
TDEL0A06330 Chr1 (1108746..1110917) [2172 bp, 723 aa] {ON} Anc_8...    34   0.63 
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      32   0.89 
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    33   1.1  
Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)      32   1.9  
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    32   2.5  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    32   2.5  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    32   3.3  
ZYRO0B00748g Chr2 complement(56195..59824) [3630 bp, 1209 aa] {O...    32   4.5  
AFR625C Chr6 complement(1570346..1571452) [1107 bp, 368 aa] {ON}...    31   5.4  
YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON...    31   5.6  
AFR675W Chr6 (1683945..1685006) [1062 bp, 353 aa] {ON} Syntenic ...    31   5.7  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    31   6.3  
Skud_77.1 Chr77 (2..769) [768 bp, 255 aa] {ON} YCR102C (REAL)          30   6.4  
SAKL0D11242g Chr4 complement(934163..934807) [645 bp, 214 aa] {O...    30   8.9  

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/380 (100%), Positives = 380/380 (100%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE
Sbjct: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60

Query: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180
           GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT
Sbjct: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180

Query: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240
           TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA
Sbjct: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240

Query: 241 TDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           TDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA
Sbjct: 241 TDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 361 NDAFEELHHGNCLRTVLSFK 380
           NDAFEELHHGNCLRTVLSFK
Sbjct: 361 NDAFEELHHGNCLRTVLSFK 380

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/377 (85%), Positives = 351/377 (93%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS VGKPITC AA+AYEA KPL V EIVVDPPKAHEVRIKI+ TAVCHTDAY+LSGVDPE
Sbjct: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60

Query: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           GLFPCVLGHEGSGIVES+G +VT VK GDHV+ALYTAECGKCKFCLSGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180
           GKGVMPDGT RFH+K G+P+YHFMGCSTFS+YTVVADVS+VA D +   +   LLGCGVT
Sbjct: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180

Query: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240
           TGYGAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+NNDKK+WS EFGA
Sbjct: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240

Query: 241 TDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           TDFVNP EL + +DIVSKL+EMTDGGLDFTFDCTGNVNVMR+ALEACHKGWGQSIIIGVA
Sbjct: 241 TDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ+G+LKVDEFIT RRPF EI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 361 NDAFEELHHGNCLRTVL 377
           N AFE+LH+G+CLRTVL
Sbjct: 361 NAAFEDLHNGSCLRTVL 377

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/380 (84%), Positives = 348/380 (91%), Gaps = 1/380 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +TVGKPI C AAVAY A K L VEEI VDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEG+GIVESVGD+V TVKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFHN KGE +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAKSRGASKII VDINN K+++S+ FGAT
Sbjct: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243

Query: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DF+NP E L E Q IV KL++MTDGGLDFTFDCTGN N+MRDALEACHKGWGQSIIIGVA
Sbjct: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G+LKV+EFIT+RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363

Query: 361 NDAFEELHHGNCLRTVLSFK 380
           N AFE+LH+G+CLRTVL F+
Sbjct: 364 NQAFEDLHNGDCLRTVLRFQ 383

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/377 (84%), Positives = 345/377 (91%), Gaps = 1/377 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +TVGKPI C AAVAY+A KPL VEEI VD PKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPCVLGHEG+GIVESVGD+V TVKPGDHV+ALYTAECGKCKFC SGKTNLCG+VRATQG
Sbjct: 64  LFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQG 123

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFHN KGE +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           G+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII +DINN KK++ ++FGAT
Sbjct: 184 GFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGAT 243

Query: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DFVNP E L + Q IV KL+EMTDGGLDFTFDCTGN  +MRDALEACHKGWGQSIIIGVA
Sbjct: 244 DFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G+LKV+EFIT+RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363

Query: 361 NDAFEELHHGNCLRTVL 377
           N AFE+LH+G+CLRTVL
Sbjct: 364 NQAFEDLHNGDCLRTVL 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/379 (83%), Positives = 345/379 (91%), Gaps = 1/379 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           STVGKPI C AA+AY+A KPL VEEI VDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 4   STVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEG+GIVESVGD+VTTVKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           +G+MPD T RFHN KGE +YHFMGCSTFSEYTVVADVSVVAIDP APLD+  LLGCGVTT
Sbjct: 124 RGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTT 183

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK+RGASKII +DINN KK++  +FGAT
Sbjct: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGAT 243

Query: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DF+NP E L +GQ IV KL+E TDGGLDFTFDCTGN  +MRDALEACHKGWGQSIIIGVA
Sbjct: 244 DFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNG+LKV+EFIT+RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEI 363

Query: 361 NDAFEELHHGNCLRTVLSF 379
           N AFE+LH G+CLRTVL F
Sbjct: 364 NQAFEDLHQGDCLRTVLKF 382

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/379 (83%), Positives = 344/379 (90%), Gaps = 1/379 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +TVGKPI C AAVAY+A KP  VEEI VD PKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEG+GIVESVGD V TVKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFHN KG+ +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTT 183

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VDINN+KK++ ++FGAT
Sbjct: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGAT 243

Query: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DF+NP E L + Q IV KLVEMTDGGLDFTFDCTGN  +MRDALEACHKGWGQSIIIGVA
Sbjct: 244 DFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFIT+RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363

Query: 361 NDAFEELHHGNCLRTVLSF 379
           N AFE+LH+G+CLRTVL F
Sbjct: 364 NHAFEDLHNGDCLRTVLKF 382

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/378 (83%), Positives = 345/378 (91%), Gaps = 1/378 (0%)

Query: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62
           T GKPI C AAVAYEA KP VVE+IVVDPPKAHEVRIKI+NTAVCHTDAYTLSG DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FPCVLGHEG+GIVESVGD VT VKPGDHV+ALYTAEC KCKFCLSGKTNLCG+VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182
           GVMPDGT RFHNKKGE LYHFMGCSTFSEYTVVADVSVVAID TAPL+SVCLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KK++  +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           F+NP+ +L E + IV+KL+EMTDGGLD TFDCTGNVNVMR ALEACHKGWGQS+IIGVAA
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT+RR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 362 DAFEELHHGNCLRTVLSF 379
           +AF++LH+G CLRTVLSF
Sbjct: 362 EAFDDLHNGLCLRTVLSF 379

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/376 (84%), Positives = 340/376 (90%), Gaps = 1/376 (0%)

Query: 5   GKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64
           GKPITC AAVAYEA KPL VEEIVVDPPKAHEVRIK+  TAVCHTDAYTLSGVDPEG FP
Sbjct: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63

Query: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEG+G+VESVG+ VT VK GDHV+ALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 64  SILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
           MPDGT RFHNKKGE L HFMGCSTFS+YTVVADVSVVAIDP APLD  CLLGCGVTTGYG
Sbjct: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
           AA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIN+ KK+WS +FGATDFV
Sbjct: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243

Query: 245 NPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG 303
           NPS+ L +GQ IV KLVEMTDGGLDFTFDCTGN +VMR ALEACHKGWGQSIIIGVAAAG
Sbjct: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA 363
           KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFIT+RR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 364 FEELHHGNCLRTVLSF 379
           FE+LHHG+CLRTVL  
Sbjct: 364 FEDLHHGDCLRTVLDL 379

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/379 (86%), Positives = 350/379 (92%), Gaps = 1/379 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST GKPITC AAVAY A KPL VE+IVVDPPKAHEVRIKI  TAVCHTDAYTLSG+DPEG
Sbjct: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEGSGIVESVG+ VT VK GDHV+ALYTAECGKCKFC SGKTNLCGSVRATQG
Sbjct: 131 AFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFHN+KGEPL HFMGCSTFS+YTVVADVSVVA+DP APLDS+ LLGCGVTT
Sbjct: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTT 250

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKK+WS +FGAT
Sbjct: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310

Query: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DFVNP E L EG+ IV KL+EMTDGGL++TFDCTGNV VMRDALEACHKGWG+SIIIGVA
Sbjct: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVA 370

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
            AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQNG LKVDEFIT+RRPF EI
Sbjct: 371 GAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430

Query: 361 NDAFEELHHGNCLRTVLSF 379
           NDAFE+LHHG+CLRTVL  
Sbjct: 431 NDAFEDLHHGDCLRTVLDL 449

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/376 (83%), Positives = 341/376 (90%), Gaps = 1/376 (0%)

Query: 5   GKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64
           GKPITC AAVAYEA KPL +EEIVVDPPKAHEVR+KI  TAVCHTDAYTLSGVDPEG FP
Sbjct: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63

Query: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEG+GIVES+G+ VT VKPGDHV+ALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
           MPDGT RFHNKKGE + HFMGCSTFS+YTV+ADVSVVAIDP APLD  CLLGCGVTTGYG
Sbjct: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
           AA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVDIN+ KK+W+ EFGATDFV
Sbjct: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243

Query: 245 NPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG 303
           NPS +L +G+ IV  LVEMTDGGLD+TFDCTGN +VMR ALEACHKGWG+SIIIGVAAAG
Sbjct: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA 363
           KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +G LKVDEFIT+RR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 364 FEELHHGNCLRTVLSF 379
           FE+LHHG+CLRTVL  
Sbjct: 364 FEDLHHGDCLRTVLDL 379

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/379 (82%), Positives = 343/379 (90%), Gaps = 1/379 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +T GKPI C AAVAYEA KPL VE+I+VD PKAHEVR+++ +TAVCHTDAYTLSGVDPEG
Sbjct: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEG+GIVESVGD VT VK GDHVV LYTAECGKCKFC S KTNLCGSVRATQG
Sbjct: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFHN KGEPL HFMGCSTFS+YTVVADVS+V IDP+APL SVCLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KK+WS +FGAT
Sbjct: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243

Query: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
            FVNP  +L EG+ IVSKL++MTDGGLDFTFDCTGNV VMRDALEACHKGWGQSIIIGVA
Sbjct: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FIT++RPF EI
Sbjct: 304 AAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363

Query: 361 NDAFEELHHGNCLRTVLSF 379
           N+AFE+LHHG+CLRTVL  
Sbjct: 364 NNAFEDLHHGDCLRTVLDL 382

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/379 (82%), Positives = 343/379 (90%), Gaps = 1/379 (0%)

Query: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62
           T GKPI C AAVAY+AA+PL VEEI+V+PP+AHEVRIKI +TAVCHTDAYTLSGVDPEG 
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FPCVLGHEGSGIVESVG+ V++VK GDHV+ALYTAECG CKFC SGKTNLCGSVR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182
           GVMPDGT RF N KGE L HFMGCSTFS+YTVVADVSVVAI+ TAPL SVCLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
           YGAAIKTANVQK DTVAVFGAGTVGLSVVQGA++RGASKII+VD+N+ K+ +S +FGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 243 FVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           F+NP ++L  G+ IVSKLVEMTDGGLD TFDCTGNV VMRDALE CHKGWGQSIIIGVAA
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQ G LKVD+FITN+RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 362 DAFEELHHGNCLRTVLSFK 380
            AFE+LHHG+CLRTVL  +
Sbjct: 364 AAFEDLHHGDCLRTVLDLE 382

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/378 (83%), Positives = 344/378 (91%), Gaps = 1/378 (0%)

Query: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62
           TVGKPITC AAVAYEA KPL VEEI+V+PPKAHEVRI+I  TAVCHTDAYTLSGVDPEG 
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FP +LGHEG+G+VESVG  VT VKPGDHVVALYTAEC KCKFC SGKTNLCGSVRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182
           GVMPDGT RF  K GE + HFMGCSTFS+YTVVADVSVVA+D  APLD +CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
           YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVDIN+ KK+W+++FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           FVNPS +L EG+ IVSKL+E+TDGGLDFTFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFIT+RRPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 362 DAFEELHHGNCLRTVLSF 379
            AF++LHHG+CLRTVL  
Sbjct: 364 AAFDDLHHGDCLRTVLDL 381

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/378 (80%), Positives = 337/378 (89%), Gaps = 1/378 (0%)

Query: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62
           T GK I C+AA+AY A  PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSGVDPEG+
Sbjct: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FP +LGHEGSGIVESVG  VT VK GDHV+ LYTAEC +CKFC+SGKTNLCGSVRATQGK
Sbjct: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182
           G+MPDGT RF N KGE +YHFMGCSTFSEYTVVADVSVVAID  APLD VCLLGCGVTTG
Sbjct: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183

Query: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
           YGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVDIN+DKK+WS +FGATD
Sbjct: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243

Query: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           F+NP+ +L +G+ IVSKL++MTDGGLD TFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363

Query: 362 DAFEELHHGNCLRTVLSF 379
           D   +LHHG+CLRTVL+F
Sbjct: 364 DGLTDLHHGDCLRTVLNF 381

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/380 (82%), Positives = 346/380 (91%), Gaps = 1/380 (0%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MST GKP+T  AAVAYEA KPL VEEI VDPPKAHEVRI++  TAVCHTDAYTLSG DPE
Sbjct: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60

Query: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           G FP +LGHEG+GIVESVG+ VT+VKPGDHVVALYTAECGKCKFC SGKTNLCGSVRATQ
Sbjct: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180
           GKGVMPDGT RF NKKGE L HFMGCSTFSEYTVVADVSVVA+DP APL+S CLLGCGVT
Sbjct: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVT 180

Query: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240
           TGYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VDIN+ KK++  EFGA
Sbjct: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240

Query: 241 TDFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGV 299
           TDF+NP ++L  GQ IV KL+EMTDGGLDFTFDCTGNV VMRDALEACHKGWG S++IGV
Sbjct: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGV 300

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE 359
           AA+G+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G+LKVDEFITNRRPF +
Sbjct: 301 AASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360

Query: 360 INDAFEELHHGNCLRTVLSF 379
           IN+AFE+LH G+ LRTVL++
Sbjct: 361 INEAFEDLHAGDSLRTVLNY 380

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/378 (80%), Positives = 346/378 (91%), Gaps = 1/378 (0%)

Query: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62
           T GKPI C AAVAY A +PL +E++ VDPPKAHEVRIKI+N+A+CHTDAYTLSG DPEGL
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FPC+LGHEGSGIVESVG+ VT VKPGDHVV LYTAEC +CKFC+SGKTNLCG+VRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182
           GVMPDGT RF N KGE LYHFMGCSTFSEYTVVADVSVVA+D  APL++VCLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
           YGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVDIN+ K+EW+++FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 243 FVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           F+NP ++L EG+ IV++L+EMTDGGLD TFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY NG+LKV EF+T++RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 362 DAFEELHHGNCLRTVLSF 379
             FE+LHHG+CLRTVLS 
Sbjct: 364 SGFEDLHHGDCLRTVLSL 381

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 340/380 (89%), Gaps = 1/380 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +T GK ITC AAVAYEA KPL VEEI V+ P+AHEVRIKI  TAVCHTDAYTLSGVDPEG
Sbjct: 5   ATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEG 64

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEG+GIVESVG+ VT VKPGDHV+ALYTAEC KCKFC SGKTNLC SVRATQG
Sbjct: 65  AFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQG 124

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RF N+KGE L HFMGCSTFS+YTVVADVSVVA+DP+APL+S+CLLGCGVTT
Sbjct: 125 KGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTT 184

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VDIN+ K+++  EFGAT
Sbjct: 185 GYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT 244

Query: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DF+NP S+L +GQ IV KL+EMTDGGLD+TFDCTGN  VMRDALEACHKGWG S+IIGVA
Sbjct: 245 DFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVA 304

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AA +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G+LKVDEFITN RPF EI
Sbjct: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEI 364

Query: 361 NDAFEELHHGNCLRTVLSFK 380
           N AFE+LH G+CLRTVL  K
Sbjct: 365 NKAFEDLHAGDCLRTVLDLK 384

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/379 (76%), Positives = 336/379 (88%), Gaps = 1/379 (0%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST GK I C+AAVAYEA KPLVV++++VD PKAHEVRIKI+NTA+CHTDAYTLSGVDPEG
Sbjct: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEGSGIVES+G+ VT+VK GDHV+ LYTAEC KCKFC SGKTNLCG+VR TQG
Sbjct: 63  LFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
           KGVMPDGT RFH  +G+ ++HFMGCSTFSEYTVVADVSVVAID    L+   LLGCGVTT
Sbjct: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           G+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIN++KK++S +FGAT
Sbjct: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242

Query: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DFVNP ++L +G+ IV+KL+ MTDGGLD+TFDCTGNV+VMR+ALEACHKGWGQS IIGVA
Sbjct: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFIT+RR F EI
Sbjct: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362

Query: 361 NDAFEELHHGNCLRTVLSF 379
           ND FE+LH G CLRTVL F
Sbjct: 363 NDGFEDLHMGTCLRTVLKF 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/382 (72%), Positives = 315/382 (82%), Gaps = 6/382 (1%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +T G+ ITC AAVAY A KPL VE+I V+ P     R    +   C+     +  V    
Sbjct: 3   NTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 62  LFPCV---LGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRA 118
              CV    G  G+G+VESVG +VT+VK GDHV+ALYTAEC +CK C SGKTNLC +VRA
Sbjct: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           TQGKGVMPDGT RF N KGEPL HFMGCSTF+EYTVVADVSVVAID  APL+ VCLLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
           VTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVDIN+ KK+++ +F
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 239 GATDFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIII 297
           GATDFVNP ++L +GQ IV KLVEMTDGGLDFTFD TGNV VMRDALEACHKGWGQSIII
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPF 357
           GVAAAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G+LK+DEFITN+RPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 358 VEINDAFEELHHGNCLRTVLSF 379
            EIN+ FE+LHHG+CLRTVL++
Sbjct: 361 KEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/379 (72%), Positives = 302/379 (79%), Gaps = 47/379 (12%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           +T GKPITC AAVAYEA KPL VE+IVVDPPKAHEVRIKI  TAVCHTDAYTLSGVDPEG
Sbjct: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEG 147

Query: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEGSGIVESVG+ VT VK GDHV+ALYTAECG+CKFC SG             
Sbjct: 148 AFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX---------- 197

Query: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
                                                   A+D  AP+DS+CLLGCGVTT
Sbjct: 198 ------------------------------------XXXXAVDKNAPMDSICLLGCGVTT 221

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KK+WS +FGAT
Sbjct: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281

Query: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300
           DF+NP ++L EG+ IVSKL+EMTDGGL++TFDCTGN  VMRDALEACHKGWG+SIIIGVA
Sbjct: 282 DFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVA 341

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNG+LKVDEFIT+RRPF EI
Sbjct: 342 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEI 401

Query: 361 NDAFEELHHGNCLRTVLSF 379
           N+AFE+LHHG+CLRTVL  
Sbjct: 402 NNAFEDLHHGDCLRTVLDL 420

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  473 bits (1217), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 219/374 (58%), Positives = 284/374 (75%), Gaps = 2/374 (0%)

Query: 5   GKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64
           G+PI C AAVAY   KPLV+E+I+VDPP+ HEVR+K+ NTA+C TD +TL G++PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           CVLGHEGSGIVES G  V TVK GDHV+ LY  ECG C  C S K+NLC  ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
           MP G+ R HN + + L+HFMGCS+FS+Y VV+D+S V I   APLD +CLLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
           A I    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ ++K+EW+  FGATDF+
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 245 NPSELPEGQDIVSKLVEMTDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG 303
           NP ++P+ + ++  L++ + G G DFTFDCTG+ +VMR ALE+C KGWG S+IIG+A AG
Sbjct: 245 NPQKIPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGAG 304

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA 363
           +EIST P+ L+ GR W+G AFGG+KGRSE+  L++ Y N  +K+DE+ITN+RP  EIN+A
Sbjct: 305 EEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINEA 364

Query: 364 FEELHHGNCLRTVL 377
            +EL  G  L+TVL
Sbjct: 365 LKELEDGLVLKTVL 378

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  117 bits (293), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 108/387 (27%), Positives = 174/387 (44%), Gaps = 53/387 (13%)

Query: 13  AVAYEAAKPLVVEEIVVDPPKAHEVR---IKIINTAVCHTDAYTLSGVDPE--------- 60
           A+ Y  A  L  E+  +  PK  + R   IK+ NT++C TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 61  GLFP-CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRAT 119
           G F   VLGHEG+GIV  VGD V  +K GD V+      CG C+ C  G    C      
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC------ 144

Query: 120 QGKGVMPDGTPRFHNKKGEPL-YHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                M DG        G  L Y   G       T  AD S+ A+      ++  LL   
Sbjct: 145 -----MNDG--------GWALGYSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSDA 191

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
           + T +   ++  NV+ GD+VA+ GAG VG+  V  ++    S +IVVD+++++ E + E 
Sbjct: 192 LPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEM 251

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIII 297
           GAT  +N  +    +D V+K++E+T+G G+D   +  G     +   + C     Q I  
Sbjct: 252 GATHTINSGK----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QIIKE 299

Query: 298 GVAAAGKEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRR 355
           G   A   +  +P      ++W    +   G+   +    L+K+  +G L+ D+ +++  
Sbjct: 300 GGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHC 359

Query: 356 PFVEINDAFEELHHG---NCLRTVLSF 379
            F ++ + +    H      L+ ++SF
Sbjct: 360 NFKDMANNYNIFKHAAKEKALKLLISF 386

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 163/359 (45%), Gaps = 50/359 (13%)

Query: 39  IKIINTAVCHTDAYTLSGVDPE---------GLFP-CVLGHEGSGIVESVGDNVTTVKPG 88
           IK+ +T++C TD     G +PE         G F   +LGHEG GI++ VGD V   K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 89  DHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
           D V+    + CG C+ C     + C     T G G                +  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 149 FSEY--TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTV 206
            +EY  T  AD S+ ++      ++  +L   + T +   ++  NV+ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG- 265
           G+  V  ++    S +IVVDI++++   + E G+T  +N ++    +D VSK++E T+G 
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK----EDAVSKILEYTNGR 275

Query: 266 GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVW--KGSA 323
           G+D   +  G      D  +   K  G    +GV         +P      ++W    + 
Sbjct: 276 GVDCVMEAVG-AQATWDICQRVIKEGGHLANVGVHG-------KPVNFEIDKLWIKNLTI 327

Query: 324 FGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHG---NCLRTVLSF 379
             G+   +  G L+K   +G LK +  +T+   F E++  +    H      ++ +++F
Sbjct: 328 TSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKHAAEEKAMKLLITF 386

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 99.8 bits (247), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 135/290 (46%), Gaps = 36/290 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + YE    L  ++I V  PK++E+ I I  + VCHTD +   G  P 
Sbjct: 1   MSAPQIPETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+GIV  +G+NV   K GD+  +      C  C++C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   PD     +   G          +F +Y     V    I P   L  V  + C
Sbjct: 116 --------PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFK 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           E G   F+   +  + +D+V  +V+ T+GG         NV+V   A+EA
Sbjct: 216 ELGGEVFI---DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 108/388 (27%), Positives = 165/388 (42%), Gaps = 92/388 (23%)

Query: 29  VDPPKA---HEVRIKIINTAVCHTD----------------AYTLSGVDPEGLFPCVLGH 69
           +D PK    HE+ I +    +C TD                 + LSG+D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 70  EGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSGKTNLCGS 115
           E SGIV+ VG  VT  KPGD VV   T  CG               C  C  G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 116 VRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLL 175
             + QG G +  G                    F+E  VV +  VV I    PLD   L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 176 GCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWS 235
              ++  + AA + A  ++G    V G+G +GL+++   K   A KI+V +    ++E +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 236 AEFGATDFVNPSELPEGQDIVSKLVEMT--DGGLDFTFDCTGNVNVMRDALE-ACHKGWG 292
            +     F NP+     Q+ + KL E++  D G D+TFDC+G  +    A++ AC +G  
Sbjct: 231 EKLNVVVF-NPTHT-RAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH- 287

Query: 293 QSIIIGVAAAG-KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ-------NGS 344
              I+ VA  G K ++  P  +          +G  K    MG + +D++        G 
Sbjct: 288 ---IVNVAIWGPKPVAFHPMDM---------TYGEKKLTGTMGYVTRDFEEVVDAIDKGY 335

Query: 345 LKVDE---FITNRRPFVEINDAFEELHH 369
           + ++E    IT R   V++ D  E+  H
Sbjct: 336 ISIEECKLLITGR---VKLEDGMEKGFH 360

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 127/283 (44%), Gaps = 34/283 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P   +A V YE    L  +++ V  PK +E+ + +  + VCH+D +   G  P  L FP 
Sbjct: 7   PEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           + GHEG+G+V  +G NV   K GD   +      C  C++C  G  + C  +        
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-------- 118

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DGT   H+             TF EY     V    I P   L  V  + C   T Y 
Sbjct: 119 --DGTGFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY- 163

Query: 185 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K ANV  G  V + GA G +G   +Q A + G  ++I +D  N K++   + G   F
Sbjct: 164 KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIF 222

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           +   +  E +DIV  +++ T+GG         NV+V   A+EA
Sbjct: 223 I---DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEA 258

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 100/377 (26%), Positives = 167/377 (44%), Gaps = 43/377 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS+   P T +A +      PL  ++I V  PK++E+ + I  + VCHTD +   G  P 
Sbjct: 1   MSSPVIPKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
           +   P V GHEG+GIV ++GDNV   K GD+  V      C  C++C  G  + C +   
Sbjct: 61  DTKLPLVGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADL 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I     L  V  + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIPAGTNLSEVAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ G+ VA+ GA G +G   +Q A + G  +++ +D  +DK +   +
Sbjct: 159 GMTVY-KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQ 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQS 294
                F+   +  + +D++S++ ++T+GG         NV+V   A+EA  K     G  
Sbjct: 217 LHGEVFI---DFTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTKYCRANGTV 269

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNR 354
           +++G+    K  S    Q+V      GS  G    R++    +  +  G +K    +   
Sbjct: 270 VLVGLPGGAKCKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAPIHVA-- 324

Query: 355 RPFVEINDAFEELHHGN 371
            P   +   FE++  G 
Sbjct: 325 -PLSTLPTIFEKMEKGQ 340

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 125/269 (46%), Gaps = 30/269 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
            ST+  P + +  + YE    L  +++ V  PK +E+ I +  + VCHTD +   G  P 
Sbjct: 22  QSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPL 81

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
           G   P V GHEG+G+V + G +VT  + GD+  +      C  C+FC  G  + C     
Sbjct: 82  GAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADL 141

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     +    I     L  V  + C 
Sbjct: 142 S---GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILCA 179

Query: 179 VTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K ++V+ G  VA+ G AG +G   VQ AK+ G  +++ +D  ++K++    
Sbjct: 180 GVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFES 237

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGG 266
            G   FV   +  + +D+VS++ E+T+GG
Sbjct: 238 LGGNHFV---DFTKTKDLVSEIQEITEGG 263

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 147/329 (44%), Gaps = 57/329 (17%)

Query: 58  DPEGL-FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAEC--------------GKC 102
           D  GL  P  +GHE SGIV  VG  VT +K GDHVV   T  C               +C
Sbjct: 61  DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC 120

Query: 103 KFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVA 162
             C  G  N C  +    G GV   G                    F+E  VV++  VV 
Sbjct: 121 AACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVK 159

Query: 163 IDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 222
           I  T PLD   L+     + +  A++ + +QKG +  V GAG +GL+ +   +  GASKI
Sbjct: 160 IPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKI 217

Query: 223 IVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVM 280
           +V +    ++  +A+ G   F +PSE  E  D V+ L ++  G  G DF +DC+G V   
Sbjct: 218 VVSEPAEIRRNQAAKLGVETF-DPSEHKE--DAVNILKKLAPGGEGFDFAYDCSG-VKPT 273

Query: 281 RDALEACHKGWGQSIIIGVAAAG-KEISTRPFQL-VTGRVWKGSAFGGIKGRSEMGGLIK 338
            D     H    + + + +A  G K I  +P  + +  +   GS    IK   +   +++
Sbjct: 274 FDT--GVHATTFRGMYVNIAIWGHKPIDFKPMDVTLQEKFVTGSMCYTIK---DFEDVVQ 328

Query: 339 DYQNGSLKVDE---FITNRRPFVEINDAF 364
              NGS+ +D+    IT R+   +I D F
Sbjct: 329 ALGNGSIAIDKARHLITGRQ---KIEDGF 354

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 161/361 (44%), Gaps = 58/361 (16%)

Query: 35  HEVRIKIINTAVCHTDA-YTLSGVDPEGLF----PCVLGHEGSGIVESVGDNVTTVKPGD 89
           H V++ I  T +C +D  Y  +G    G F    P VLGHE SG+V  VG  VT+VK GD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 90  HVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTF 149
            V           K   SG  NLC S+       +  DGT                    
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGT------------------LL 127

Query: 150 SEYTVVADVSVVAIDPTAPLDSVCL--LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVG 207
             Y    D  V   D  +  +  C+  L  GV      A K A+V+ G  V VFGAG VG
Sbjct: 128 KYYLSPEDFLVKLPDSVSFEEGACVEPLSVGVH-----ANKLADVRFGSKVVVFGAGPVG 182

Query: 208 LSVVQGAKSR--GASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG 265
           L  + GA SR  GA+ ++ VD+ + K E + EFGAT  VN S+     D+V ++  +  G
Sbjct: 183 L--LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSKFKSEDDLVKEIQRVLSG 240

Query: 266 GL-DFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG-----KEISTRPFQLV-TGRV 318
              +  F+C+G    +R  ++AC  G G+ + +G+          E+ ++  Q++ T R 
Sbjct: 241 EQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKDNVNFPISEVVSKELQVLGTFRY 299

Query: 319 WKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFE-ELHHG-NCLRTV 376
             G     +K  SE          G + V   IT+R  F +   A+E  + HG + ++T+
Sbjct: 300 CFGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYEFNIEHGEDVVKTI 349

Query: 377 L 377
           +
Sbjct: 350 I 350

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 129/289 (44%), Gaps = 34/289 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS+   P + +A V YE    L  ++I V  PKA+E+ + +  + VCH+D +   G  P 
Sbjct: 1   MSSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G NV   K GD   +      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                   DGT   H+             TF EY     V    +     L  V  + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    KK+    
Sbjct: 159 GVTVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEG 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            G   F++     + +DIV  +++ TDGG         NV+V   A+EA
Sbjct: 217 LGGEVFID---FTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 95.5 bits (236), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 121/263 (46%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A + YE    L   +I V  PK  E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV   K GD   +      C  C++C     + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
            PD     +   G          +F +Y     V    I     L  V  + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+A +Q G+ VA+ GA G +G   VQ AK+ G  +I+ +D   +KK+   E G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           ++     E +D+V++++++T+GG
Sbjct: 220 ID---FAESKDVVAEVIKVTNGG 239

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 138/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE+   L  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++GDNV   K GD   +    + C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +  + +DIVS +V+ TDGG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 95.5 bits (236), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 121/268 (45%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST   P T +  + YE    L  ++I V  PK +E+ I +  + VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLA 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +G NV   K GD   +      C  C+FC SG  + C     +
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEADLS 145

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F ++     +    I P   L  V  + C  
Sbjct: 146 ---GYTHDG-------------------SFQQFATADAIQAAKIQPGTDLAEVAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K++   + 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQL 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F+   +  + +D+VS + E T GG
Sbjct: 242 GGEVFI---DFTKTKDMVSDIQEATKGG 266

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 138/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE+   L  ++I V  PKA+E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G+NV   K GD+  +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +  + +DIV  +++ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 137/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE+   L  + I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++GDNV   K GD   V    + C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQSIIIGVA 300
           +   +  + +DI+  +V+ TDGG         NV+V   A+EA  K     G  +++G+ 
Sbjct: 220 I---DFTKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTKYCRANGTVVLVGLP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 131/289 (45%), Gaps = 34/289 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + YE   PL   +I V  PKA E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPTIPRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G+NV   K GD   +      C  C++C     + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----- 115

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                  P+     +   G          +F +Y     V    I     L  V  + C 
Sbjct: 116 -------PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ GD VA+ GA G +G   +Q A + G  +++ +D   +K++   +
Sbjct: 159 GITVY-KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            G   F+   +  + +DIV+ +V+ T+GG         NV+V   A+E+
Sbjct: 217 LGGEVFI---DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIES 258

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 164/363 (45%), Gaps = 49/363 (13%)

Query: 28  VVDPPKAHEVRIKIINTAVCHTDA-YTLSGVDPEGLF--PCVLGHEGSGIVESVGDNVTT 84
           + DP   H V+++I  T +C +D  Y ++G   + +   P +LGHE SG+V  VG  V+ 
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILGHESSGLVVEVGSEVSR 82

Query: 85  VKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTP-RFHNKKGEPLYHF 143
           V+ GD V               +G+ NLC  ++      +  DGT  +++    + L   
Sbjct: 83  VRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPEDFLVKL 140

Query: 144 MGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGA 203
               ++ E  +V  +SV                 GV      A K A V     VAVFGA
Sbjct: 141 PDHVSYEEGALVEPLSV-----------------GVH-----ANKLAGVAFNQRVAVFGA 178

Query: 204 GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMT 263
           G VGL     A++ GAS+++ +D+   K   S+ FG T FVN + + +  D+V ++  + 
Sbjct: 179 GPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSANIKDEDDLVKEIERVL 238

Query: 264 DGGL-DFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWK-- 320
            G   D  FDCTG    +R  ++ C+ G G  + +G+   G +    P   +  +  K  
Sbjct: 239 GGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GHDDVNFPIGAIGAKELKVL 294

Query: 321 ---GSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFE-ELHHGN-CLRT 375
                AFG  +   ++        +G + V   +T+R  F +   A+E  + HG+  ++T
Sbjct: 295 GCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSEVIKT 348

Query: 376 VLS 378
           ++S
Sbjct: 349 IIS 351

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 149/332 (44%), Gaps = 39/332 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + YE    L  ++I V  PK++E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSASQIPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+G+V ++G+NV   K GD+  +      C  C++C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   P+     +   G          +F +Y     V    I     L  V  + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D   +K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFK 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQ 293
           E G   F+   +  + +D+V  +V+ T+GG         NV+V   A+EA     +  G 
Sbjct: 216 ELGGEVFI---DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGT 268

Query: 294 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
            +++G+    K  S    Q+V      GS  G
Sbjct: 269 VVLVGLPGGAKCKSDVFNQVVKSTTIVGSYVG 300

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 94.4 bits (233), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 83/268 (30%), Positives = 122/268 (45%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST   P T +  + YE   PL  ++I V  PK++E+ I +  + VCHTD +   G  P  
Sbjct: 28  STYQIPKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLP 87

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +GDNV   K GD   +      C  C+ C +G    C     +
Sbjct: 88  VKLPLVGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS 147

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y     V    I     L +V  + C  
Sbjct: 148 ---GYTHDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAG 185

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+KTA+++ GD VA+ G AG +G   VQ A + G  ++I +D   DKK+   + 
Sbjct: 186 VTVY-KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKC 243

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F+   +  + +DIV  + E T GG
Sbjct: 244 GGEVFI---DFTKSKDIVKDIQEATHGG 268

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 170/383 (44%), Gaps = 45/383 (11%)

Query: 8   ITCQAAVAYEAAKPLVVEEIVVDPPK-AHEVRIKIINTAVCHTDAYTLSGVDPEGLF--- 63
           +  Q AV  E  + + +E   +   K  H+V+I+I  T +C +D +  +     G F   
Sbjct: 1   MASQEAVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFTQ-GSIGDFVVK 59

Query: 64  -PCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
            P VLGHE +G+V  VGD V++VK GD V           K  +SG  NLC  +      
Sbjct: 60  SPLVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATP 119

Query: 123 GVMPDGTP-RFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181
               DGT  +++    + +Y      +F E  VV  +SV                     
Sbjct: 120 PY--DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV------------------- 158

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
               A + AN   G  V V GAG VGL     AK+ GA+ ++ VDI   K E + +FGAT
Sbjct: 159 ---HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGAT 215

Query: 242 DFVNPSELPEGQDIVSKLVEMTDGGL--DFTFDCTGNVNVMRDALEACHKGWGQSIIIGV 299
             V      +  D+VS LV  + GGL  D  F+C+G    +R A+++  +G G  + +G+
Sbjct: 216 RTVLFKPDSDENDLVS-LVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVGM 273

Query: 300 AAAGKEISTRPFQLVTGR--VWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPF 357
              GK+    P    + +   +KG  F   +G  +    +K    G + V   IT   PF
Sbjct: 274 ---GKDNINFPINEFSQKEATFKG-CFRYYEG--DFDDAVKLLSTGKVNVKPLITKVFPF 327

Query: 358 VEINDAFEE--LHHGNCLRTVLS 378
            +  +A++    H  +  +T+++
Sbjct: 328 EQAVEAYKHNVEHAKDVTKTIIT 350

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 103/382 (26%), Positives = 169/382 (44%), Gaps = 45/382 (11%)

Query: 8   ITCQAAVAYEAAKPLVVEEIVV----DPPKAHEVRIKIINTAVCHTDA-YTLSGVDPEGL 62
           +T Q A+  E    + +  + +    DP   +EV I+I  T +C +D  Y   G     +
Sbjct: 4   LTTQEAIVLERPGKITLTNVSIPKISDP---NEVIIQIKATGICGSDIHYYTHGRIANYV 60

Query: 63  F--PCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120
              P VLGHE SGIV  +G+NV T+K GD V                G+ NL  +++   
Sbjct: 61  VESPMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAA 120

Query: 121 GKGVMPDGT-PRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
                 DGT  +++    + +Y      +F E  ++  +SV                   
Sbjct: 121 TPPF--DGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAI----------------- 161

Query: 180 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFG 239
                 A K A ++ G    VFGAG +GL   + A   GA+ ++ VD+  +K E + +FG
Sbjct: 162 -----HANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFG 216

Query: 240 ATDFVNPSELPEGQDIVSKLVE-MTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIG 298
           AT  VN  +LP G  + S + + +   G D  F+C+G    +R  +E C  G G  + +G
Sbjct: 217 ATHIVNSGDLPHGVTVDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVG 275

Query: 299 VAAAGKEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPF 357
           +   G+E    P  ++ T  +     F   +G  +    I+   +  L +  FIT+R  F
Sbjct: 276 M---GQEEIQFPISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSF 330

Query: 358 VEINDAFEELHHG--NCLRTVL 377
            +  +AFEE  H   N ++T++
Sbjct: 331 KDAVEAFEETSHHPLNNIKTII 352

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/310 (27%), Positives = 141/310 (45%), Gaps = 37/310 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS    P T +  + YE    L  ++I V  PKA+E+ + +  + VCHTD +   G  P 
Sbjct: 1   MSAHEIPKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
            +  P V GHEG+G+V ++G+NV   K GD   +      C  C+ C  G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----- 115

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                  P+     +   G          +F +Y     V    I   A L  +  + C 
Sbjct: 116 -------PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN+Q GD VA+ G AG +G   VQ AK+ G  +++ +D   +K++   +
Sbjct: 159 GITVY-KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQS 294
            G   F+   +    +DI  ++++ T+GG         NV+V   A+E+     +  G  
Sbjct: 217 LGGEVFI---DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTV 269

Query: 295 IIIGVAAAGK 304
           +++G+ A  K
Sbjct: 270 VLVGLPAGAK 279

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 137/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE+   L  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV     GD   +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    + P   L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  ++I +D    K+E     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           V   +  + +DIV  +++ T+GG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 V---DFTKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 ANAK 276

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 166/376 (44%), Gaps = 59/376 (15%)

Query: 9   TCQAAVAYEAAKPLVVEEIVVDPPK---AHEVRIKIINTAVCHTDAYTLSGVDPEGLF-- 63
           T Q AV  E    +V+  + +  PK   A++V ++I  T +C +D +  +          
Sbjct: 5   TTQEAVVLEQPGKIVLTNVNI--PKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVK 62

Query: 64  -PCVLGHEGSGIVESVGDNVTTVKPGDHVVA------LYTAECGKCKFCLSGKTNLCGSV 116
            P VLGHE SG+V  +GDNV T+K GD V         +++E  + ++ L        + 
Sbjct: 63  SPMVLGHESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATP 122

Query: 117 RATQGKGVMPDGT-PRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLL 175
                     DGT  +++    + +Y      +F E  ++  +SV               
Sbjct: 123 PY--------DGTLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVAV------------- 161

Query: 176 GCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWS 235
                     A + A ++ G    VFGAG VGL   + A   GA+ ++ VD++  K E +
Sbjct: 162 ---------HANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERA 212

Query: 236 AEFGATDFVNPSELPEG---QDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWG 292
            +FGAT  VN  +LP+G   + ++ K +     G D  F+C+G    +R  +E C  G G
Sbjct: 213 KQFGATHMVNSGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-G 269

Query: 293 QSIIIGVAAAGKEISTRPFQLVTGR--VWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEF 350
             + +G+   G+E    P   +  +   ++GS F   +G  +    I+   +G L +   
Sbjct: 270 TYVQVGM---GQEEIQFPISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPL 323

Query: 351 ITNRRPFVEINDAFEE 366
           IT R  F E  +AF+E
Sbjct: 324 ITRRYQFKEAIEAFDE 339

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 137/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A + YE+   L  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G+NV   K GD+  +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F EY     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G   A+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +  + +DIVS +V+ T+GG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEASTRYCRANGTVVLVGLP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 134/290 (46%), Gaps = 36/290 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS    P T +  + YE    L  ++I V  PKA+E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
            +  P V GHEG+G+V ++G+NV   K GD+  +      C  C++C LS ++N      
Sbjct: 61  DVKLPLVGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   P+     +   G          +F +Y     V    I     L  V  + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+AN+  G+ VA+ GA G +G   +Q AK+ G  +I+ +D  ++K     
Sbjct: 158 AGITVY-KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFK 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           E G   F+   +  + +DI + ++E T+GG         NV+V   A+E+
Sbjct: 216 ELGGEVFI---DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIES 258

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 121/268 (45%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST+  P T +  + YE    L  ++I V  PK +E+ I +  + VCHTD +   G  P  
Sbjct: 26  STIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +G NV   K GD   +      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
                 PD     +   G          +F ++     +    I     L  V  + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K++   + 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQL 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F+   +  + +D+VS + E T GG
Sbjct: 242 GGEVFI---DFTKTKDMVSDIQEATKGG 266

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 128/289 (44%), Gaps = 34/289 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS+   P T +A V YE    L  +++ V  PK +E+ + +  + VCH+D +   G  P 
Sbjct: 1   MSSQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G NV   K GD   +      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                   DGT   H+             TF EY     V    I     L  V  + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K AN+  G  V + GA G +G   VQ A + G  ++I +D    K++   E
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEE 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
                F++     + +D+V  +++ TDGG         NV+V   A+EA
Sbjct: 217 LHGEIFID---FTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 144/337 (42%), Gaps = 66/337 (19%)

Query: 13  AVAYEAAKPLVVEEIVVDPPKAHE--VRIKIINTAVCHTDAYTL-------------SGV 57
           A+AY   K +   + +  P  +HE  V I +    VC +D +                 +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 58  DPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAEC--------------GKCK 103
             +GL P  +GHE SGIV  VG +V+ VK GDHVV      C              G C 
Sbjct: 63  SGQGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREGLCI 121

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST--FSEYTVVADVSVV 161
            C +G  N C  +                        +  +GC +  F+E  V+++ +VV
Sbjct: 122 ACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLSERNVV 158

Query: 162 AIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASK 221
            I  + PLD   L+     + +  A++ + +Q G T  V GAG +GL+ V   +S GA  
Sbjct: 159 KIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGT 216

Query: 222 IIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNV 279
           IIV +  + +++ +   GA  F NP+E   G +++  L ++  G  G +F++DC G    
Sbjct: 217 IIVSEPADTRRQKAEALGAQTF-NPTE--HGDNVIEALRKLAPGGEGFNFSYDCCGTSET 273

Query: 280 MRDALEACHKGWGQSIIIGVAAAG-KEISTRPFQLVT 315
               L   H    + + + +A  G K I   P  + T
Sbjct: 274 FSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTT 307

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 138/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE+   L  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV     GD+  +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +  + +DIV+ +++ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 ANAK 276

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 130/280 (46%), Gaps = 35/280 (12%)

Query: 11  QAAVAYEA-AKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPCVLG 68
           Q  V +E+   PL  +EI V  PKA+E+ I +  + VCHTD +   G  P  +  P V G
Sbjct: 9   QMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGG 68

Query: 69  HEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPD 127
           HEG+GIV ++GD+V     GD+  +      C  C+ C     + C     +   G   D
Sbjct: 69  HEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHD 125

Query: 128 GTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI 187
           G                   +F +Y     V    I     L  V  + C   T Y  A+
Sbjct: 126 G-------------------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KAL 165

Query: 188 KTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNP 246
           K+AN++ GD VA+ GA G +G   +Q A + G  +++ +D   +K E   + G   F+  
Sbjct: 166 KSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFI-- 222

Query: 247 SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            +  + +D++++++E+TDGG         NV+V   A+EA
Sbjct: 223 -DFTKCKDVIAEILEVTDGGAHGVI----NVSVSEAAIEA 257

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A V YE   PL  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEGSG+V  VG+NV   K GD   +      C  C+ C +G  + C     +   G 
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GY 153

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 154 THDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D    K+E     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           +   +  + +D+V  + E T GG
Sbjct: 253 I---DFTKSKDMVKDIQEATKGG 272

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 92.0 bits (227), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 165/375 (44%), Gaps = 47/375 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE    L  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G+NV     GD   +      C  C++C LS ++N C          
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESN-C---------- 138

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
             PD     +   G          +F +Y     V    I     L  V  + C   T Y
Sbjct: 139 --PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY 186

Query: 184 GAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +   + G   
Sbjct: 187 -KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEA 244

Query: 243 FVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGV 299
           FV   +  + +D+V+++ E+T+GG         NV+V   A+ A     +  G  +++G+
Sbjct: 245 FV---DFTKTKDMVAEIQEITNGGPHGVI----NVSVSEAAMNASTQFVRPTGTVVLVGL 297

Query: 300 AAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFV 358
             AG  I +  F  V   +  KGS  G    R++    I  + NG +     +       
Sbjct: 298 -PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVVG---LS 350

Query: 359 EINDAFEELHHGNCL 373
           E+   +E +  G  L
Sbjct: 351 ELPKVYELMEQGKIL 365

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 128/289 (44%), Gaps = 34/289 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS+   P T +A V YE    L  +++ V  PK +E+ + +  + VCH+D +   G  P 
Sbjct: 1   MSSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G NV   K GD   +      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
                   DGT   H+             TF EY     V    I     L  V  + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    K++   +
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEK 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            G   F+   +  + +D+   +++ T+GG         NV+V   A+EA
Sbjct: 217 LGGEIFI---DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEA 258

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 166/379 (43%), Gaps = 43/379 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A +       L  ++I V  PK++E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++GD V   K GD+  +      C  C++C  G  + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADL 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I P + L  V  + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIAPGSDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K +   +
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKD 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQS 294
            G   F+   +  + +DIV  +++ T+GG         NV+V   A++A  K     G +
Sbjct: 217 LGGEVFI---DFTKTKDIVGDIIKATNGGAHGVI----NVSVSEQAIDASVKYCRANGTA 269

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNR 354
           +++G+    +  S    Q+V      GS  G    R++    +  +  G +K    I   
Sbjct: 270 VLVGMPGGAQVKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIHIAKL 326

Query: 355 RPFVEINDAFEELHHGNCL 373
               EI   FE++  G  +
Sbjct: 327 SDVPEI---FEKMEKGQIV 342

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 90.9 bits (224), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 137/304 (45%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE+   L  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV   K GD   +    + C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +  + +DIV  +++ TDGG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 135/304 (44%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE+   L  ++I V  PKA+E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV     GD   +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           +   +    +DIV  +++ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEASTRYCRANGTTVLVGMP 272

Query: 301 AAGK 304
           A  K
Sbjct: 273 AGAK 276

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 119/268 (44%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           STV  P   +  + YE   PL  ++I V  PKA+E+ I +  + VCHTD +   G  P  
Sbjct: 24  STVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLA 83

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
              P V GHEGSG V ++G+NV   K GD   +      C  C+ C SG  + C     +
Sbjct: 84  TKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS 143

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y     V    I     +  V  + C  
Sbjct: 144 ---GYTHDG-------------------SFQQYATADAVQAARIPKGTNMAEVAPILCAG 181

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D    K+E     
Sbjct: 182 ITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSL 239

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   FV+     + +DIV+++ E T GG
Sbjct: 240 GGEIFVD---FTKTKDIVAEIQEATRGG 264

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 120/268 (44%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST   P T +  + YE    L  ++I V  PK +E+ I +  + VCHTD +   G  P  
Sbjct: 26  STAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +G NV   K GD   +      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
                 PD     +   G          +F ++     +    I     L  V  + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K++   + 
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F++     + +D+VS + E T GG
Sbjct: 242 GGEVFID---FTKTKDMVSDIQEATKGG 266

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P   +  + YE    L  +++ V  PK +E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G+NVT  + GD+  +      C  C+ C  G    C     +   G 
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GY 161

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  +  + C   T Y 
Sbjct: 162 THDG-------------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KTA+V+ G  VA+ G AG +G   VQ AK+ G  +++ +D   DKK+   + G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           ++       +D+V  + E T GG
Sbjct: 261 ID---FRTTKDMVGAIQEATQGG 280

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 122/264 (46%), Gaps = 32/264 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE    L  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G+NV     GD   +      C  C++C LS ++N            
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
             PD     +   G          +F +Y     V    I     L  V  + C   T Y
Sbjct: 113 --PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY 160

Query: 184 GAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+K+A+++ GD VA+ GA G +G   +Q AK+ G  +++ +D   +K +   E G   
Sbjct: 161 -KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEY 218

Query: 243 FVNPSELPEGQDIVSKLVEMTDGG 266
           FV   +    +D++ ++V+ T+GG
Sbjct: 219 FV---DYAVSKDLIKEIVDATNGG 239

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 135/304 (44%), Gaps = 37/304 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE    L  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G+NV   K GD+  +      C  C++C     + C     +   G 
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEADLS---GY 124

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 125 THDG-------------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN+  G+ VA+ G AG +G   VQ AK+ G  +I+ +D  ++KK    E G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSIIIGVA 300
           V   +  + +++   ++  T+GG         NV+V   A+E+     +  G  +++G+ 
Sbjct: 224 V---DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLP 276

Query: 301 AAGK 304
           A  K
Sbjct: 277 ANAK 280

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 104/379 (27%), Positives = 163/379 (43%), Gaps = 45/379 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ++ G P+T +A + YE    L  ++I V  PK +E+ + +  + VCHTD +   G  P  
Sbjct: 26  TSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLA 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
              P V GHEG+GIV + G NVT  + GD+  V      C  C++C +G  + C     +
Sbjct: 86  TKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS 145

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y     V    I     L  V  + C  
Sbjct: 146 ---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+KTAN+  G  VA+    G +G   VQ AK+ G  +++ +D    K     + 
Sbjct: 184 VTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKL 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQSI 295
           G   F+   +  + +DIV+ + E T+GG         NV+V   A+    K     G  +
Sbjct: 242 GGEVFI---DFTKSKDIVADIQEATNGGPHGAV----NVSVSEAAIVQSVKYIRPTGTVV 294

Query: 296 IIGVAAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNR 354
           ++G+  A   +++  F  V   +  KGS  G    R++M   I  +  G +K    I   
Sbjct: 295 LVGL-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKIIG- 349

Query: 355 RPFVEINDAFEELHHGNCL 373
               E+  A+ EL  GN +
Sbjct: 350 --LSELPTAYHELEAGNMV 366

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 123/268 (45%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           S+   P T +  + YE    L  +++ V  PKA+E+ I +  + VCHTD +   G  P  
Sbjct: 26  SSFAIPETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+GIV + G+NV   + GD+  +      C  C+ C  G  + C     +
Sbjct: 86  VKLPLVGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLS 145

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y     V    I     L  +  + C  
Sbjct: 146 ---GYTHDG-------------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +++ +D  + K+E   + 
Sbjct: 184 VTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQC 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F++     + +D+V+ + E T+GG
Sbjct: 242 GGEVFID---FRKSKDMVADIQEATNGG 266

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 154/358 (43%), Gaps = 42/358 (11%)

Query: 32  PKAHEVRIKIINTAVCHTDA-YTLSGVDPEGLF--PCVLGHEGSGIVESVGDNVTTVKPG 88
           P  H V++ I  T +C +D  Y  SG   + +   P VLGHE SG V  VG  V ++K G
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 89  DHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
           D V                G+ NLC  +       +  DGT                   
Sbjct: 87  DRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGT------------------L 126

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCL--LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTV 206
              Y   AD  V   D  +  +  C+  L  GV      A K A V  G  V VFGAG V
Sbjct: 127 VKYYVSPADFLVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVVVVFGAGPV 181

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQ-DIVSKLVEMTDG 265
           GL     AK+ GAS++I VD+ ++K E +  FGAT  +N   LP G+ D VS  V    G
Sbjct: 182 GLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNYLG 241

Query: 266 G--LDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSA 323
           G   D  F+C+G    +   + +   G G  + IG+   GK     P   V+G+  + S 
Sbjct: 242 GALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGK--EMSV 295

Query: 324 FGGIK-GRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEE--LHHGNCLRTVLS 378
            G  +    +    ++    G ++V + ITNR  F +   A++    + G  ++T+++
Sbjct: 296 IGCFRYSFGDYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIANGGEVVKTIIA 353

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 130/301 (43%), Gaps = 37/301 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  V  E+  PL  +EI V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G V ++G NV   K GD   +      C  C+ C     + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
            PD     +   G          +F +Y     V    I P   L  V  + C   T Y 
Sbjct: 144 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K+E     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQSIIIGVA 300
           +   +  +  DIV  +V  T+GG         NV+V   A+ A  K     G S+++G+ 
Sbjct: 251 I---DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGMP 303

Query: 301 A 301
           A
Sbjct: 304 A 304

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 133/284 (46%), Gaps = 36/284 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE   PL  ++I V  P  +E+ I ++ + VCHTD +   G  P  +  P 
Sbjct: 6   PKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V  +G +V   K GD+  +      C  C+ C LS ++N            
Sbjct: 66  VGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC----------- 114

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
             P+     +   G          +F +Y     V    I   A L ++  + C   T Y
Sbjct: 115 --PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY 162

Query: 184 GAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             AIK+AN++ GD +A+ GA G +G   +Q  K+ G  +I+ +D   +K+E   + G   
Sbjct: 163 -KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEY 220

Query: 243 FVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           F+   +  + +DI++++ + T+GG         NV+V   A+EA
Sbjct: 221 FI---DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 130/283 (45%), Gaps = 36/283 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE    L  ++I V  PKA+E+ I +  + VCHTD +   G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G+NV   K GD   +      C  C++C LS ++N C     +   G
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESN-CPEADLS---G 121

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
              DG                   +F +Y     V    I     L  V  + C   T Y
Sbjct: 122 YTHDG-------------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY 162

Query: 184 GAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +   + G   
Sbjct: 163 -KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEY 220

Query: 243 FVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALE 285
           F+   +  + ++I  +++E T GG         NV+V   A+E
Sbjct: 221 FI---DFTKSKNIPEEVIEATKGGAHGVI----NVSVSEFAIE 256

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 88.6 bits (218), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +A V YE   PL    I V  PK +E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G  V   + GD+  +      C  C+ C  G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GY 149

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 185 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KTA+V+ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++KK+     G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           V   +  +   IV  + ++T+GG
Sbjct: 249 V---DFTKTHSIVKDIQDVTNGG 268

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 88.6 bits (218), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 120/268 (44%), Gaps = 30/268 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST   P T +  + YE    L  ++I V  PK +E+ I +  + VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +G NV   K GD   +      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
                 PD     +   G          +F ++     +    I     L  V  + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K++   + 
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F+   +  + +++VS + E T GG
Sbjct: 242 GGEVFI---DFTKTKNMVSDIQEATKGG 266

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 131/306 (42%), Gaps = 34/306 (11%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           ST+  P   +  + YE   PL  +++ V  PK +E+ I +  + VCHTD +   G  P  
Sbjct: 25  STIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLP 84

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+GIV + G NV   + GD   +      C  C+ C  G  + C     +
Sbjct: 85  VKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS 144

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y          I     L  V  + C  
Sbjct: 145 ---GYTHDG-------------------SFQQYATADATQAAQIPRGTDLAEVAPILCAG 182

Query: 180 TTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+KTA +Q G+ VA+ GA G +G   +Q AK+ G  +++ +D    K +   E 
Sbjct: 183 VTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKEL 240

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQSI 295
           G   F++ ++    + ++  + E T GG         NV+V   A+ A     +  G  +
Sbjct: 241 GGETFIDFTKYKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVV 296

Query: 296 IIGVAA 301
           I+G+ A
Sbjct: 297 IVGMPA 302

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 135/302 (44%), Gaps = 31/302 (10%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS    P T +A +       L  ++I V  PK+ E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+GIV  VG+NV   K GD   +      C  C++C  G  + C +   
Sbjct: 61  ATKLPLVGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADL 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I     L  V  + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +I+ +D   +K++   E
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRE 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIII 297
            G   F+   +  + +DIV  +++ T+GG     + + +   +  + E C    G  +++
Sbjct: 217 LGGEIFI---DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLV 272

Query: 298 GV 299
           G+
Sbjct: 273 GL 274

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 102/238 (42%), Gaps = 38/238 (15%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE SGIV  VG  VT VK GDHVV    + C                C  C  G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             NLC       G GV+  G                    F+E  VV+   ++ +    P
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     T +  A+K +  +KG +  V GAG +GL  +   K  GASKI+V +I 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
             + E + + G   F NPS+       + + +  +  G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKA 280

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 133/290 (45%), Gaps = 36/290 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + YE+   L  +++ V  PK +E+ I I  + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
           +   P + GHEG+G+V  +G NV   K GD+  V      C  C+ C LS ++N      
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   P+     +   G          +F EY     V    I   A L  V  + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+A++  G+ VA+ GA G +G   VQ AK+ G  +++ +D   +KK+   
Sbjct: 158 AGVTVY-KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFH 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           E G   F++       +D+ + +++ T+GG         NV+V   A+EA
Sbjct: 216 EMGGEVFLD---FRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 101/380 (26%), Positives = 161/380 (42%), Gaps = 45/380 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           M+T   P   +  + YE    L  E+I V  PK +E+ I +  + VCHTD +   G  P 
Sbjct: 23  MATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPL 82

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G+NV   K GD   +      C  C++C     + C     
Sbjct: 83  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADL 142

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I     L  V  + C 
Sbjct: 143 S---GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPILCA 180

Query: 179 VTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K E   +
Sbjct: 181 GVTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKK 238

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACH---KGWGQS 294
            G   F+   +  + +++V  + E T+GG         NV+V   A+ A     +  G  
Sbjct: 239 LGGEVFI---DFTKHKNLVEAVQEATNGGPHGVI----NVSVSEAAMTASTQFVRPTGTV 291

Query: 295 IIIGVAAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITN 353
           +++G+  AG  I +  F  V   +  KGS  G    R++    I  +  G +K    +  
Sbjct: 292 VLVGL-PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSPIHVVG 347

Query: 354 RRPFVEINDAFEELHHGNCL 373
                E+   +E +  G  L
Sbjct: 348 ---LSELPKVYELMEKGKIL 364

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +  + YE+   L  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G+NV   + GD   +      C  C+ C  G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLS---GY 149

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +I+ +D    K+E     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           +   +  + +DIVS + E T GG
Sbjct: 249 I---DFTKTKDIVSAIQEATKGG 268

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 131/293 (44%), Gaps = 36/293 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + YE   PL  ++I V  P A E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPEIPKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+G+V ++G+NV   K GD+  +      C  C+ C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   P+     +   G          +F +Y     V    I     L  V  + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+AN+  GD VA+ GA G +G   +Q A + G  +++ +D   +K E   
Sbjct: 158 AGITVY-KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFK 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK 289
           + G   F++       +D+  ++++ T+GG         NV+V   A+E+  +
Sbjct: 216 QLGGEVFID---FTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIESSTR 261

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 137/307 (44%), Gaps = 37/307 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60
           MS    P T +  + YE    L  ++I V  P  +E+ I +  + VCHTD +   G  P 
Sbjct: 1   MSAPTIPETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
            +  P V GHEG+G+V ++G NV   K GD+  +      C  C+ C  G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADL 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I P   L  V  + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+A ++ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++K +   E
Sbjct: 159 GLTVY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKE 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEAC---HKGWGQS 294
            G   F+   +  + +DI+ ++V+ T+GG         NV+V   A+ A     +  G  
Sbjct: 217 LGGEYFI---DFTKCKDIIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTV 269

Query: 295 IIIGVAA 301
           +++G+ A
Sbjct: 270 VLVGLPA 276

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 153/359 (42%), Gaps = 50/359 (13%)

Query: 35  HEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV 91
           +  ++ +  T +C +D   Y   G+    L  P VLGHE SG+V  VG  V  +K GD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 92  VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE 151
                          +GK NLC  +       +  DGT                      
Sbjct: 90  AIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGT------------------LVKY 129

Query: 152 YTVVADVSVVAIDPTAPLDSVCL--LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 209
           Y   AD  V   D  +  +  C+  L  GV +      K A V+ G TV VFGAG VGL 
Sbjct: 130 YLSPADFLVKLPDHVSFEEGACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLL 184

Query: 210 VVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEG--QDIVSKLVEMTDGGL 267
               AK+ GAS ++ VD+ + K E +  FGAT  +N ++LP+   Q +  ++ ++  G L
Sbjct: 185 TGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGGAL 244

Query: 268 -DFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWK-----G 321
            D  F+C+G  + +   ++A   G G  + IG+   GK     P   V+G+         
Sbjct: 245 ADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLVGCFR 300

Query: 322 SAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA--FEELHHGNCLRTVLS 378
            ++G  K    +         G + V + IT+R  F +   A  F   H G  ++T+++
Sbjct: 301 YSYGDYKDAVNL------VSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKTIIA 353

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 116/278 (41%), Gaps = 55/278 (19%)

Query: 36  EVRIKIINTAVCHTDAYTLS----------GVDPEG--LFPCVLGHEGSGIVESVGDNVT 83
           EV I++    +C TD +  S          G  P      P  +GHE SGIV  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 84  TVKPGDHVVALYTAEC-------------GK-CKFCLSGKTNLCGSVRATQGKGVMPDGT 129
            VK GDHVV      C             GK C  C  G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 130 PRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT 189
                              F+E   V+    + I    PLD   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 190 ANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSEL 249
           A  QKG T  V GAG +GL+ +   K  GASKI+V ++   +++ +A  G   F NP+  
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPA-- 241

Query: 250 PEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALE 285
            E +D +++L ++ +G  G D  FDC+G       AL 
Sbjct: 242 -EHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTALH 278

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 131/290 (45%), Gaps = 36/290 (12%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS    P T +A + Y+   PL  +++ V  PK +E+ I I  + VCHTD +   G  P 
Sbjct: 1   MSAPVIPQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVR 117
           +   P + GHEG+G+V  +G NV   K GD+  V      C  C+ C LS ++N      
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----- 115

Query: 118 ATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   P+     +   G          +F EY     V    I     L  V  L C
Sbjct: 116 --------PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLC 157

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSA 236
              T Y  A+K+A++  G  VA+ GA G +G   +Q AK+ G  +++ +D   +KK+   
Sbjct: 158 AGVTVY-KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFH 215

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           E G   F++       +D+ + +++ T+GG         NV+V   A+E+
Sbjct: 216 ELGGEVFLD---FRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIES 258

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 162/384 (42%), Gaps = 73/384 (19%)

Query: 22  LVVEE----IVVDPPKAHEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPCVLGHEGSGI 74
           +VVE+    I+ DP   H V+I I  T +C +D   Y   G+    L  P VLGHE SG 
Sbjct: 17  IVVEQRPVPIIEDP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQ 73

Query: 75  VESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHN 134
           V  VG  VT VK GD V                G+ NLC                P    
Sbjct: 74  VVEVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLC----------------PHMAF 117

Query: 135 KKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI------- 187
               P+       T  +Y +            +P D +  L  GV+   GA +       
Sbjct: 118 AATPPI-----DGTLVKYYL------------SPEDFLVKLPEGVSYEEGACVEPLSVGV 160

Query: 188 ---KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
              K A V+ G  V VFGAG VGL     A++ GAS ++ +D+ ++K + + EFGAT   
Sbjct: 161 HSNKLAGVRFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTF 220

Query: 245 NPSELP--EGQDIVSKLVEMTDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301
           N S+ P  + Q++  ++ ++  G   D  F+C+G  +   DA     K  G  + IG+  
Sbjct: 221 NSSKFPADKTQELADEVEKLLSGHHADIVFECSG-ADACIDAGVKITKVGGTMVQIGM-- 277

Query: 302 AGKEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRP 356
            GK  +  P   V+G+  K       +FG  +        +K   +G + V   IT+R  
Sbjct: 278 -GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFK 330

Query: 357 FVEINDA--FEELHHGNCLRTVLS 378
           F +   A  F   H G  ++T+++
Sbjct: 331 FEDAAKAYDFNIAHGGEVVKTIIA 354

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 129/289 (44%), Gaps = 34/289 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           MS+   P T  A V  +   PL   EI V  PK  E+ I +  + VCHTD +   G  P 
Sbjct: 35  MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPL 94

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G+NV   + GD   +      C  C+ C  G  + C     
Sbjct: 95  PTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEADL 154

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           +   G   DG                   +F +Y     V    I     L  V  + C 
Sbjct: 155 S---GYTHDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 192

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ G+ VA+ GA G +G   +Q A++ G  +++ +D  ++K+    +
Sbjct: 193 GITVY-KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRK 250

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            G   FV   +  + +D+V+ +V+ T GG         NV+V   A+E+
Sbjct: 251 LGGEVFV---DFRKSKDVVADVVKATGGGAHGVI----NVSVSEAAIES 292

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 133/303 (43%), Gaps = 31/303 (10%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-E 60
           ST+  P T +  + YE+   L  +++ V  P+ +E+ + +  + VCHTD +   G  P +
Sbjct: 21  STISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLD 80

Query: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
              P V GHEG+G+V + G+NV   + GD   +      C  C+ C  G  + C     +
Sbjct: 81  TKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS 140

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   TF +Y     +    I     L  V  + C  
Sbjct: 141 ---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAG 178

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A++++  + G+ VA+ G AG +G    Q A++ G  +++ +D   DK +     
Sbjct: 179 VTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSL 236

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIG 298
           G   F+   +  + +DI + ++E T GG     + + +   M  ++E   +  G  +++G
Sbjct: 237 GGEIFI---DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVG 292

Query: 299 VAA 301
           + A
Sbjct: 293 LPA 295

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 117/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE    L  +++ V  PK +E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G+NVT  + GD   +      C  C+ C  G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    +     L  V  + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KTA++  G  VA+ G AG +G   VQ AK+ G  +++ +D  ++KKE   + G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           ++ +     +D+V  + E T GG
Sbjct: 259 IDYTTT---KDMVGAIQEATQGG 278

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 85.1 bits (209), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 132/284 (46%), Gaps = 36/284 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +A V       L  ++I V  P A+E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V  +G+NV   K GD   +      C  C+ C LS ++N C     +   G
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESN-CPHADLS---G 119

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
              DG                   +F +Y     V    I     L  V  + C   T Y
Sbjct: 120 YTHDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY 160

Query: 184 GAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  ++I +D  ++K++   + G   
Sbjct: 161 -KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEY 218

Query: 243 FVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
           FV   +  + +D+V++++E+T GG         NV+V   A+E+
Sbjct: 219 FV---DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIES 255

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 128/290 (44%), Gaps = 34/290 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSG---V 57
           +S+   P T +A V YE    L   +I V  PK +E+ + I  + VCHTD +   G   +
Sbjct: 23  LSSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAI 82

Query: 58  DPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSV 116
            P+   P V GHEG+G+V + G NVT  + GD+  V      C +C+FC  G    C + 
Sbjct: 83  KPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETP 140

Query: 117 RATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLG 176
             +   G   DG                   TF +Y     +    I P   L  V  + 
Sbjct: 141 TLS---GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPIL 178

Query: 177 CGVTTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWS 235
           C   T Y  A+KTA +  G  VA+    G +G   VQ A + G  +++ +D  N+K+   
Sbjct: 179 CAGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALF 236

Query: 236 AEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALE 285
              G   FV   +  + +DIVS + E T GG     + + + N +  ++E
Sbjct: 237 RSLGGETFV---DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVE 283

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 138/324 (42%), Gaps = 54/324 (16%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE SGIV  VG  VT VK GDHVV    + C                C+ C  G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             NLC +     G GV+  G                    F+E   V++  ++ +    P
Sbjct: 127 SENLC-THGGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     T +  A+K +  +KG +  V GAG +GL  +   K  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             + E +   G   F NPS+   GQ  +  L  +T    G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKNLGVEVF-NPSK--HGQKSIEVLRGLTKSHDGFDYSYDCSGIQVTFETSLKA 280

Query: 287 C-HKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSL 345
              KG   +I +      K +  +P  +         + G +    +  G+++   NG +
Sbjct: 281 LTFKGTATNIAV---WGPKPVPFQPMDVTLQEKILTGSIGYV--VEDFEGVVQAIHNGDI 335

Query: 346 KVD---EFITNRRPFVEINDAFEE 366
            ++   + IT ++   +I D +E+
Sbjct: 336 TLEDCKQLITGKQ---KIEDGWEK 356

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 101/239 (42%), Gaps = 40/239 (16%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G+V  VG  V   K GDHVV   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNICSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  A++  N +KG +  V G+G +GL ++      G + I+V +  
Sbjct: 166 LDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALE 285
             +++++ E GAT F +PS LP  ++ +  L  +  G  G D+TFDC+GN      ++E
Sbjct: 224 KIRRDFAKELGATVF-DPSSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P T +  + YE    L  ++I V  PK +E+ I I  + VCHTD +   G  P  +  P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G +VT  + GD   V    + C  C++C  G  + C     +   G 
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GY 145

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     +    I     L  V  + C   T Y 
Sbjct: 146 THDG-------------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KT+  + G  VA+ G AG +G   VQ A + G  +++ +D    K+E     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           V+     + +D+VS + E T+GG
Sbjct: 245 VD---FTKTKDMVSAIQEATNGG 264

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 157/367 (42%), Gaps = 66/367 (17%)

Query: 35  HEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPCVLGHEGSGIVESVGDNVTTVKPGDHV 91
           H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  VG+ VT VK GD V
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTRVKVGDRV 90

Query: 92  VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE 151
                           G+ NLC                P        P+       T  +
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLC----------------PHMAFAATPPI-----DGTLVK 129

Query: 152 YTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI----------KTANVQKGDTVAVF 201
           Y +            +P D +  L  GV+   GA +          K A V+    V VF
Sbjct: 130 YYL------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFSTRVVVF 177

Query: 202 GAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELP--EGQDIVSKL 259
           GAG VGL     A++ GAS ++ VD+ ++K + + +FGAT+  N S++P  + Q++ S++
Sbjct: 178 GAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEV 237

Query: 260 VEMTDGG-LDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRV 318
            ++  G   D  F+C+G  +V  DA     K  G  + +G+   GK  +  P   V+G+ 
Sbjct: 238 EKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GKNYTNFPIAEVSGKE 293

Query: 319 WK-----GSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEE--LHHGN 371
            K       +FG  +    +         G + V   IT+R  F +   A++    H G+
Sbjct: 294 MKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKAYDYNISHGGD 347

Query: 372 CLRTVLS 378
            ++T+++
Sbjct: 348 VVKTIIA 354

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 122/269 (45%), Gaps = 30/269 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSG-VDP 59
           MS    P T +A +  E    L  ++I V  PK++E+ I ++ + VCH+D +   G +  
Sbjct: 1   MSAPTIPKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPL 60

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V  +G NV   K GD+  +      C  C+FC       C     
Sbjct: 61  PLKLPLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADF 120

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           T   G + DG                   +F +Y     V    I     L ++  L C 
Sbjct: 121 T---GTVHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCA 158

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  A+K+AN++ G  VA+ GA G +G   +Q A + G  +++ +D   +K ++   
Sbjct: 159 GLTAY-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKT 216

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGG 266
            G   F+   +  + +D+V+ +++ TDGG
Sbjct: 217 LGGEVFI---DYKKSKDVVADVIKATDGG 242

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 116/268 (43%), Gaps = 27/268 (10%)

Query: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61
           STV  P T +  + YE    L  ++I V  PK +E+ + +  + VCHTD +   G  P  
Sbjct: 22  STVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLS 81

Query: 62  L-FPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V + G NV   + GD   +      C  C+ C SG  + C     +
Sbjct: 82  VKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS 141

Query: 120 QGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              G   DG                   +F +Y     V    I     L  V  + C  
Sbjct: 142 ---GYTHDG-------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAG 179

Query: 180 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            T Y  A+K A++  G  V + G AG +G   VQ  K+ G  ++I +D    K+E     
Sbjct: 180 ITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSL 237

Query: 239 GATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G   F++ ++     D+V+ + + T+GG
Sbjct: 238 GGEVFIDFTKQKTDSDMVAAIQKATNGG 265

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 105/392 (26%), Positives = 162/392 (41%), Gaps = 73/392 (18%)

Query: 13  AVAYEAAKPLVVEE----IVVDPPKAHEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPC 65
           AV  E    + +E+     + DP   H V++ I  T +C +D   Y   G+    L  P 
Sbjct: 8   AVVLEKVGDIAIEQRPIPTIKDP---HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPM 64

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVM 125
           VLGHE SG V  VGD VT VK GD V                G+ NLC            
Sbjct: 65  VLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLC------------ 112

Query: 126 PDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGA 185
               P        P+       T  +Y +            +P D +  L  GV+   GA
Sbjct: 113 ----PHMAFAATPPI-----DGTLVKYYL------------SPEDFLVKLPEGVSYEEGA 151

Query: 186 AI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWS 235
            +          K A V+ G  V VFGAG VGL     A++ GA+ +I VD+ ++K + +
Sbjct: 152 CVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 236 AEFGATDFVNPSELP--EGQDIVSKLVEMTDGG-LDFTFDCTGNVNVMRDALEACHKGWG 292
            +FGAT+  N S+    + QD+   + ++  G   D  F+C+G  +V  DA     K  G
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSG-ADVCIDAAVKTTKVGG 270

Query: 293 QSIIIGVAAAGKEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQNGSLKV 347
             + +G+   GK  +  P   V+G+  K       +FG  +    +         G + V
Sbjct: 271 TMVQVGM---GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNV 321

Query: 348 DEFITNRRPFVEINDAFEE--LHHGNCLRTVL 377
              IT++  F +   A++    H G  ++T++
Sbjct: 322 KPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 133/292 (45%), Gaps = 38/292 (13%)

Query: 1   MSTVGK--PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVD 58
           M+T+    P T +  + YE    L  +++ V  PK  E+ I ++ + VCHTD +   G  
Sbjct: 1   MATIAADVPKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDW 60

Query: 59  P-EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGS 115
           P +   P V GHEG+G+V  +G +V   K GD   +      C  C+ C LS ++N    
Sbjct: 61  PLDTKLPLVGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC--- 117

Query: 116 VRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLL 175
                     P+     +   G          +F +Y     V    I   A +  V  +
Sbjct: 118 ----------PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPI 157

Query: 176 GCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEW 234
            C   T Y  A+K+A ++ GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K+++
Sbjct: 158 LCAGVTVY-KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKF 215

Query: 235 SAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
               G   FV+       +DIV  + E T+GG      C  NV+V   A+EA
Sbjct: 216 FKSMGGEVFVD---FMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 145/346 (41%), Gaps = 52/346 (15%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLF----PCVLGHEGSGIVESVGDNVTTVKPGDH 90
           H V+++I  T +C +D +  +     G F    P VLGHE SGIV  VG  VT V  GD 
Sbjct: 31  HFVKVQIKATGICGSDVHFCTH-GAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDR 89

Query: 91  VVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTP-RFHNKKGEPLYHFMGCSTF 149
           V           +  +SG  NLC  ++      V  DGT  ++     + +Y      TF
Sbjct: 90  VAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVTF 147

Query: 150 SEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 209
            E  +V  ++V                         A+K A V+ GD V VFGAG VGL 
Sbjct: 148 EEGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGPVGLL 185

Query: 210 VVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDF 269
           V    K+ GA++++ +D+ + K + S E G+T  +N  ++ E    +    ++     + 
Sbjct: 186 VGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSKDMAEEALALEIQNDLNGQHPNK 245

Query: 270 TFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKG 329
             DCTG    +R ++ AC  G G  + +G+      +       V+  V K   F G   
Sbjct: 246 VIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNASLP------VSDIVIKELTFKG--- 295

Query: 330 RSEMGGLIKDYQNG-------SLKVDEFITNRRPFVEINDAFEELH 368
              M     DYQ+         + V   IT+R  F   +DA + L 
Sbjct: 296 --SMRYCHGDYQDAIQLLKYKKVDVKAIITHRFSF---DDAIKALQ 336

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL-FPC 65
           P   +  V  E    L   +I V  PK++E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 36  PKVQKGVVFTEHNGELKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 95

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G+NV   K GD   +      C  C+ C +G    C     +   G 
Sbjct: 96  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GY 152

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I   + L  +  + C   T Y 
Sbjct: 153 THDG-------------------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY- 192

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+KTAN++ G+ VA+ G AG +G   VQ AK+ G  +++ +D   +K++     G   F
Sbjct: 193 KALKTANLKPGEWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVF 251

Query: 244 VNPSELPEGQDIVSKLVEMTDGG 266
           V   +  + +DIV+ +   T GG
Sbjct: 252 V---DFTKSKDIVADIQNATKGG 271

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 103/240 (42%), Gaps = 42/240 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE SGI+  VG  VT VK GDHVV    + C                C+ C  G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             NLC       G GV+  G                    F+E  VV++  ++ +    P
Sbjct: 127 SENLCAH-SGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     T +  A+K +  +KG +  V GAG +GL  +   K  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             + + +       F NP++   G   V  L  +T+   G D+++DC+G       +L+A
Sbjct: 224 ERRLKMAKSLDVEVF-NPAQ--HGHKSVELLRGLTESHDGFDYSYDCSGIQATFETSLKA 280

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 146/361 (40%), Gaps = 44/361 (12%)

Query: 11  QAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDA-YTLSGVDPEGLF----PC 65
           + A+ YE     V+E    DP   H V++KI  T +C +D  Y L G    G F    P 
Sbjct: 14  KGAIVYEHRPVPVIE----DP---HYVKVKIEKTGICGSDVHYYLHG--SIGPFVVRSPM 64

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVM 125
           VLGHE SG V  VG +VT V+ GD V           +   SG  NLC  +R        
Sbjct: 65  VLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFA------ 118

Query: 126 PDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGA 185
              TP +               T  +Y +  +  +V +  +  L+   L  C        
Sbjct: 119 --ATPPYDG-------------TLVKYYISPEDFLVKLPDSVSLEEGAL--CEPLAVAVH 161

Query: 186 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVN 245
           A + A  Q    V VFGAG VGL     AK+ GA+ + +VDI+  K   +   G T  V+
Sbjct: 162 ANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD 221

Query: 246 PSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKE 305
            S+    + + +KL       +D  FDC+G    +  A+  C  G      + V ++   
Sbjct: 222 SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTH---VQVGSSRDY 278

Query: 306 ISTRPFQLVTGRVWKGSAFGGIK-GRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAF 364
           +S   F L    V +    G  +    +    ++   +  +     +T+R PF    +A+
Sbjct: 279 VS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAY 335

Query: 365 E 365
           +
Sbjct: 336 K 336

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 105/392 (26%), Positives = 161/392 (41%), Gaps = 73/392 (18%)

Query: 13  AVAYEAAKPLVVEE----IVVDPPKAHEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPC 65
           AV  E    + +E+     + DP   H V++ I  T +C +D   Y   G+    L  P 
Sbjct: 8   AVVLEKVGDIAIEQRPIPTIKDP---HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPM 64

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVM 125
           VLGHE SG V  VGD VT VK GD V                G  NLC            
Sbjct: 65  VLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLC------------ 112

Query: 126 PDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGA 185
               P        P+       T  +Y +            +P D +  L  GV+   GA
Sbjct: 113 ----PHMAFAATPPI-----DGTLVKYYL------------SPEDFLVKLPEGVSYEEGA 151

Query: 186 AI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWS 235
            +          K A V+ G  V VFGAG VGL     A++ GA+ +I VD+ ++K + +
Sbjct: 152 CVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 236 AEFGATDFVNPSELP--EGQDIVSKLVEMTDGG-LDFTFDCTGNVNVMRDALEACHKGWG 292
            +FGAT+  N S+    + QD+   + ++  G   D  F+C+G  +V  DA     K  G
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSG-ADVCIDAAVKTTKVGG 270

Query: 293 QSIIIGVAAAGKEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQNGSLKV 347
             + +G+   GK  +  P   V+G+  K       +FG  +    +         G + V
Sbjct: 271 TMVQVGM---GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNV 321

Query: 348 DEFITNRRPFVEINDAFEE--LHHGNCLRTVL 377
              IT++  F +   A++    H G  ++T++
Sbjct: 322 KPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 129/301 (42%), Gaps = 37/301 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A +  E   PL  ++I V  PK +E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G V ++G +V   K GD   +      C  C+ C     + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
            PD     +   G          +F +Y     V    I     L  V  + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ A++ G  +++ +D    K+E     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 244 VNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK---GWGQSIIIGVA 300
           ++     +  DI   +++ T+GG         NV+V   A+ A  K     G S+++G+ 
Sbjct: 220 ID---FTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMP 272

Query: 301 A 301
           A
Sbjct: 273 A 273

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 158/364 (43%), Gaps = 50/364 (13%)

Query: 29  VDPPKAHEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPCVLGHEGSGIVESVGDNVTTV 85
           +D P  H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  VGD VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 86  KPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTP-RFHNKKGEPLYHFM 144
           K GD V                G+ NLC  +       +  DGT  R++    + L    
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVKLP 142

Query: 145 GCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAG 204
              ++ E   V  +SV                 GV +      K A V+ G  V VFGAG
Sbjct: 143 DGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFGAG 180

Query: 205 TVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELP--EGQDIVSKLVEM 262
            VGL     A + GAS +I VD+ +++ + + +FGA+   N S+    E Q +  ++ ++
Sbjct: 181 PVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKL 240

Query: 263 TDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWK- 320
             G   D  F+C+G  +V  DA     K  G  + +G+   GK  +  P   V+G+  + 
Sbjct: 241 LGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMRL 296

Query: 321 ----GSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEE--LHHGNCLR 374
                 +FG  +    +        +G + V   IT+R  F +   A++    H G+ ++
Sbjct: 297 IGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVK 350

Query: 375 TVLS 378
           T+++
Sbjct: 351 TIIA 354

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 158/364 (43%), Gaps = 50/364 (13%)

Query: 29  VDPPKAHEVRIKIINTAVCHTDA--YTLSGVDPEGL-FPCVLGHEGSGIVESVGDNVTTV 85
           +D P  H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  VGD VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 86  KPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTP-RFHNKKGEPLYHFM 144
           K GD V                G+ NLC  +       +  DGT  R++    + L    
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVKLP 142

Query: 145 GCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAG 204
              ++ E   V  +SV                 GV +      K A V+ G  V VFGAG
Sbjct: 143 DGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFGAG 180

Query: 205 TVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELP--EGQDIVSKLVEM 262
            VGL     A + GAS +I VD+ +++ + + +FGA+   N S+    E Q +  ++ ++
Sbjct: 181 PVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKL 240

Query: 263 TDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWK- 320
             G   D  F+C+G  +V  DA     K  G  + +G+   GK  +  P   V+G+  + 
Sbjct: 241 LGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMRL 296

Query: 321 ----GSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEE--LHHGNCLR 374
                 +FG  +    +        +G + V   IT+R  F +   A++    H G+ ++
Sbjct: 297 IGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVK 350

Query: 375 TVLS 378
           T+++
Sbjct: 351 TIIA 354

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 102/240 (42%), Gaps = 42/240 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE SGI+  VG  VT VK GDHVV    + C                C  C  G
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             NLC       G GV+  G                    F+E  VV++  ++ +    P
Sbjct: 127 CENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     T +  A++ +  +KG +  V GAG +GL  +   K  GA +I+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             + E +   G   F +P +   G+  V  L  +T    G D+++DC+G       +L+A
Sbjct: 224 ERRMELARRLGVEIF-DPRK--HGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 148/375 (39%), Gaps = 82/375 (21%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLF----PCVLGHEGSGIVESVGDNVTTVKPGDH 90
           H V+++I  T +C +D +        G F    P VLGHE SGI+  VG  V T+K GD 
Sbjct: 31  HWVKVQIKATGICGSDVH-FYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDR 89

Query: 91  VVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCS--- 147
           V           +  +SG  NLC                         P  HF       
Sbjct: 90  VALEPGYPSRYTEATMSGHYNLC-------------------------PFMHFAATPPCD 124

Query: 148 -TFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI----------KTANVQKGD 196
            T ++Y +             P D V  L   V+   GA +          K A  + GD
Sbjct: 125 GTLTKYYL------------TPFDFVYKLPDNVSYEEGALLEPLSVGVHANKQAGTRFGD 172

Query: 197 TVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDI- 255
            V VFGAG VGL     AK  GA +++ +D+ ++K E +  FGAT  +N S+L    +  
Sbjct: 173 KVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFE 232

Query: 256 VSKLVEMTDGGL--DFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPF-Q 312
           ++  ++   GG+  D   +CTG    +R  + A   G G  + +G+   GK+ +  P  Q
Sbjct: 233 LAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG-GTFVQVGM---GKDDANIPITQ 288

Query: 313 LVTGRVWKGSAFGGIKGRSEMGGLIKDYQN-------GSLKVDEFITNRRPFVEINDA-- 363
                +     F    G         DYQN       G + V   +T R  F E   A  
Sbjct: 289 FSCREITLKGCFRYCHG---------DYQNALDLVATGKIPVKLLVTRRFTFDEAVKAYM 339

Query: 364 FEELHHGNCLRTVLS 378
           F   H    +++++S
Sbjct: 340 FNAEHAEEVVKSIIS 354

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 149/354 (42%), Gaps = 37/354 (10%)

Query: 22  LVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPCVLGHEGSGIVESVGD 80
           L  E++ V  P ++EV I +  + VCHTD +T  G  P +   P V GHEG+G+V + G 
Sbjct: 42  LYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGK 101

Query: 81  NVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEP 139
           +V T + GD   V    + C  C+ C  G    C     +   G   DG           
Sbjct: 102 DVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS---GSSHDG----------- 147

Query: 140 LYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVA 199
                   TF +Y  +  +    +     L +V  + C   + Y  A+K  N+Q    VA
Sbjct: 148 --------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVA 198

Query: 200 VFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSK 258
           +FGA G +G   VQ AK+ G   + +     ++K+     G   F++ +++    +I + 
Sbjct: 199 IFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFLDYTQV---DNIPAA 255

Query: 259 LVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVT-GR 317
           + + T GG     + T ++      ++ C +  G  + +GV      + T  F +V  G 
Sbjct: 256 VKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGF 314

Query: 318 VWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGN 371
             KGSA G    R++    +  +  G +K    I       E+  AFE L  G 
Sbjct: 315 SIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQ 362

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 115/269 (42%), Gaps = 30/269 (11%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP- 59
           +S +  P T +A V  E    L   +I V   KA+E+ I +  + VCH+D Y      P 
Sbjct: 11  LSVMTLPKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPM 70

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V  +G NV   K GD   V    + C  C+ C  G    C     
Sbjct: 71  TSKLPLVGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LK 127

Query: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178
           ++  G   +G                   +F +Y  V  +    +     L  +    C 
Sbjct: 128 SEYNGFTRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCA 168

Query: 179 VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
             T Y  AIK+AN++ G  +A+ GA G +G   +Q  K+ G  +++ +D    K     E
Sbjct: 169 GVTVY-KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKE 226

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGG 266
            G   F+   +  + +D+V+ +V  T+GG
Sbjct: 227 LGGEVFI---DFTKSKDLVADVVSATNGG 252

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 104/241 (43%), Gaps = 41/241 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAEC--------------GKCKFCLSG 108
            P  +GHE SGI+ SVG      K GDHVV   TA C                C+ C +G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C  +  T G GV   G                    F+E  V+ +     I    P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  A+K ++ ++G +V + G G +GL  +   K  G   I+V +  
Sbjct: 166 LDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             ++E + + GA  F +PS +     I + L EM  G  G D+TFDC+G    ++ A+E 
Sbjct: 224 LIRRELAEKMGARVF-DPSNMSLDNSIKT-LTEMAPGSQGFDYTFDCSGIPATLKVAIEC 281

Query: 287 C 287
           C
Sbjct: 282 C 282

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 124/306 (40%), Gaps = 59/306 (19%)

Query: 13  AVAYEAAKPLVVEEIVVDPP--KAHEVRIKIINTAVCHTDAYTL-------------SGV 57
           A+AY   K +     +  P     +E+ I I    +C +D +                GV
Sbjct: 3   ALAYFGKKDIHFSADIAKPEIGADNELEIDISWCGICGSDLHEYLDGPIFFPEEGKTHGV 62

Query: 58  DPEGLFPCVLGHEGSGIVESVGDNVT-TVKPGDHVVALYTAEC--------------GKC 102
              GL P  +GHE SGIV  VG  V    K GDHVV   T  C                C
Sbjct: 63  SGIGL-PQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPC 121

Query: 103 KFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVA 162
             C  G  N C  +    G G    G                    FSE  V+++  V+ 
Sbjct: 122 SACKRGIYNCCTHL-GFCGLGAHGGG--------------------FSEKVVISEQHVIK 160

Query: 163 IDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 222
           I    PLD   L+     + +  A+K +N++ G +  V GAG +GL+ +   +  GA KI
Sbjct: 161 IPKEIPLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKI 218

Query: 223 IVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVM 280
           +V +    ++E +A+ G   F NP E   G+  V +L ++  G  G DF+FDC+G     
Sbjct: 219 VVSEPAQIRREQAAKLGVETF-NPFE--HGEKAVEELRKIPPGGDGFDFSFDCSGMKATF 275

Query: 281 RDALEA 286
              L A
Sbjct: 276 DTGLHA 281

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 107/385 (27%), Positives = 170/385 (44%), Gaps = 51/385 (13%)

Query: 8   ITCQAAVAYEAAKPLVVEEIVVDPPK---AHEVRIKIINTAVCHTDA--YTLSGVDPEGL 62
           +T Q A+  +  KP V+     D P+    H V++ I  T +C +D   YT   +   G 
Sbjct: 1   MTKQDAIVLQ--KPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI---GQ 55

Query: 63  F----PCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRA 118
           F    P VLGHE SGIV  VG  VT VK GD V              +SG  NLC  +  
Sbjct: 56  FVVKSPMVLGHESSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVF 115

Query: 119 TQGKGVMPDGT-PRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGC 177
                   DGT  +++    + +Y      +F E  +   +SV                 
Sbjct: 116 AATPPY--DGTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSV----------------- 156

Query: 178 GVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAE 237
           GV      A K A  + G  V V GAG VGL     A++ GA++++ VDI  +K E S +
Sbjct: 157 GVH-----ANKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQ 211

Query: 238 FGATDFVNPSELPEGQDIVSKLVEMTDGGL-DFTFDCTGNVNVMRDALEACHKGWGQSII 296
           FGAT  V+ S   + +  VS++ ++  G L +   +C+G    +R  ++AC K  G  + 
Sbjct: 212 FGATHTVSSSS--DEERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQ 268

Query: 297 IGVAAAGKEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRR 355
           +G+   GK+    P   V +  +     F   KG  +    +    +G +     I++R 
Sbjct: 269 VGM---GKDDVNFPISAVGSKEITFHGCFRYKKG--DFADSVALLSSGRINGKPLISHRF 323

Query: 356 PFVEINDAFE-ELHHGN-CLRTVLS 378
            F +  +A++    HGN  ++T+++
Sbjct: 324 AFDKAPEAYKFNAEHGNEVVKTIIT 348

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/379 (22%), Positives = 150/379 (39%), Gaps = 66/379 (17%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPC--------------VLGHEGSGIVESVGDN 81
           E+ I II   +C TD +  +  D    FP                +GHE +GIV  VG  
Sbjct: 28  ELLIDIIFCGICGTDLHEYT--DGPIFFPSDGHKHEISNNELPQAMGHEMAGIVREVGSG 85

Query: 82  VTTVKPGDHVVALYTAECG--------------KCKFCLSGKTNLCGSVRATQGKGVMPD 127
           VT  K GDHV    T  C               KC  C  G  N+C  +    G GV   
Sbjct: 86  VTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSG 144

Query: 128 GTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI 187
           G                    F+E  V+ +     +    P++ V L+     + +  A+
Sbjct: 145 G--------------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AV 182

Query: 188 KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPS 247
           + +  + G +V + G G +GLS +      G ++I+V +    +++ + + GA  + +P 
Sbjct: 183 RVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVY-DPM 241

Query: 248 ELPEGQDI-VSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEI 306
           +    ++I   + +     G D+ FDC+G    +R ++E C    G ++ + + A GK I
Sbjct: 242 QHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVAMWATGKPI 300

Query: 307 STRPFQLVTG-RVWKGSAFGGIKGRSEMGGLIKDYQNGSL---KVDEFITNRRPFVE-IN 361
              P  +    + + GS         +  G+I   + G++   K    IT + P      
Sbjct: 301 DFFPMDITQQEKSYTGSM---CYTHHDFEGVIDALEKGTIDPEKAQHMITAKVPLERGFE 357

Query: 362 DAFEEL--HHGNCLRTVLS 378
           DA   L  H    ++ +L+
Sbjct: 358 DAMMRLITHKEETIKVLLT 376

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 112/230 (48%), Gaps = 22/230 (9%)

Query: 50  DAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGK 109
           + + +SGV   GL P  +GHE SG+V  +G  V  +K GDHVV   T  C K ++     
Sbjct: 58  EKHAMSGV---GL-PQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTC-KDRYRWPDV 112

Query: 110 TNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST--FSEYTVVADVSVVAIDPTA 167
            +      A   K         F+N   E  +  +GC +  F+E  V+++  VV +    
Sbjct: 113 KHASDEECAACKK--------DFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDI 164

Query: 168 PLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDI 227
           PLD   L+     + +  A++ + ++ G +  + GAG +GL+ V   +  GA  I+V + 
Sbjct: 165 PLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEP 222

Query: 228 NNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTG 275
           +  +++ +   GA  F NP +   G   V +L ++  G  G DF++DC+G
Sbjct: 223 SASRRKQAEALGALTF-NPFD--HGDKAVDELRKIPPGSDGFDFSYDCSG 269

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 123/261 (47%), Gaps = 32/261 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P+T +A +  + +  L ++ I V  PKA+E+ I +  + VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+GIV ++G +V   K GD+  +    + C  C+ C LS + N C     +   G
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPN-CAYADIS---G 125

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
              DG                   +F +Y     V    I P   L  V  + C   T +
Sbjct: 126 FTRDG-------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF 166

Query: 184 GAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+KTAN+  G+ VA+ GA G +G   +Q AK+ G S ++ +D   +K+    + G   
Sbjct: 167 -KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDV 224

Query: 243 FVNPSELPEGQDIVSKLVEMT 263
           F+   +  + +++V ++V  T
Sbjct: 225 FL---DFSKSENLVPEVVSAT 242

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 103/240 (42%), Gaps = 41/240 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAEC--------------GKCKFCLSG 108
            P  +GHE +G+V  +G  V   + GDHVV   T+ C                C  C  G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C  +    G GV   G                    FSE  V+    V+ I    P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     + +  AI+ + +  G +  V G G +GL  +   ++ GASKI+V +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
            +++E +   GA  F +P+E  E  + V  L ++  G  G D++FDC+G     R ++ A
Sbjct: 224 KNRRELAKLMGAEVF-DPTEWEE-HEAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVHA 281

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 111/245 (45%), Gaps = 49/245 (20%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECG-------------------KCK 103
            P  +GHE SG V+++G NVT V+ GD VV    A CG                    C 
Sbjct: 67  LPQPMGHEFSGFVKAIGSNVTKVEVGDKVVV--EAGCGCKDVHRWPDSKLYEKRKDTFCS 124

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAI 163
            C +G  N C +   T G GV+                       F+E  VV +  +V +
Sbjct: 125 ACENGIDNCCENYDFT-GLGVV--------------------GGAFAERVVVGERHIVKL 163

Query: 164 DPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKII 223
               P D   L+   ++  +  A++ +  +KG +  + GAG +GL+ +   K+ GASKI+
Sbjct: 164 PEEVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIV 221

Query: 224 VVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMR 281
           V ++   ++  +++ G   F +PS+   G + V++L  +  G  G D+ FDC+G      
Sbjct: 222 VSELAERRRILASKMGVEVF-DPSK--HGDNAVTELRNIPRGQHGFDYAFDCSGVKATFN 278

Query: 282 DALEA 286
            AL+A
Sbjct: 279 TALKA 283

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 103/235 (43%), Gaps = 27/235 (11%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A V       L  ++I V  P + E+ I +  + VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G+NV   K GD   +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 185 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
            A+K+A+++ G  VA+ GA G +G   VQ A++ G  +++ +D  +DK++   E 
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKLFKEL 214

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 126/287 (43%), Gaps = 35/287 (12%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDP-EGLFPC 65
           P T +A V       L  ++I V  P+ +E+ I +  + VCHTD +   G  P     P 
Sbjct: 6   PKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 66  VLGHEGSGIVESVGDNVTT-VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
           V GHEG+GIV + G  V    + GD   +      C  C++C     + C     +   G
Sbjct: 66  VGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS---G 122

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGY 183
              DG                   +F +Y     V    +     L  V  + C   T Y
Sbjct: 123 YTHDG-------------------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY 163

Query: 184 GAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242
             A+K+AN++ G+ VA+ GA G +G   VQ AK+ G  +++ +D  ++K +   + G   
Sbjct: 164 -KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEY 221

Query: 243 FVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK 289
           F+   +  + +D+++++++ TDGG         NV+V   A+ A  +
Sbjct: 222 FI---DFTKSKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTR 261

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 104/244 (42%), Gaps = 46/244 (18%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECG----------------KCKFCL 106
            P  +GHE  G V+++G+ VT V  GD VV    A CG                +C  C 
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 107 SGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPT 166
            G  N C     T G GV+                       F+E  VV +  VV +   
Sbjct: 125 KGFDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEE 163

Query: 167 APLDSVCLLGCGVTTGYGAAIKTANVQKGD--TVAVFGAGTVGLSVVQGAKSRGASKIIV 224
            P D   L+       +  A+K A  +KG      V GAG +GL+ +   K+ GASKI+V
Sbjct: 164 VPTDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVV 221

Query: 225 VDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTD--GGLDFTFDCTGNVNVMRD 282
            ++   ++E + + G   F +PS+  + +  + KL E+ +   G DF FDC+G       
Sbjct: 222 SELAAIRRELALKMGVEVF-DPSKHGDEKQGIKKLREIPEDHDGFDFAFDCSGVETTFNT 280

Query: 283 ALEA 286
           AL +
Sbjct: 281 ALHS 284

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 129/295 (43%), Gaps = 54/295 (18%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECG--------------KCKFCLSG 108
            P  +GHE SGIV  VG NVT VK GD VV   ++ C               KC  C  G
Sbjct: 67  LPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N C     T G G +  G                    F+E  +V +  +V I    P
Sbjct: 127 YDNCCAYAGFT-GLGFIGGG--------------------FAEQILVGEQHIVRIPDEIP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+     T + A  K     KG T  + G+G +GL+++   K+ GASKI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             +++  AE    +  +PS    G++  ++L  +T+   G DF FDC+G    M  A+  
Sbjct: 224 QVRRKL-AEKMKVEVFDPS--VHGKNTSNELRLLTENKDGFDFAFDCSGLEVTMNTAI-- 278

Query: 287 CHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ 341
            H    +  I+ VA  G   ST  F ++   + + +  G I      G +++D++
Sbjct: 279 -HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI------GYVVRDFE 323

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/324 (23%), Positives = 129/324 (39%), Gaps = 52/324 (16%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  +G  VT  K GDHVV      C                C  C  G
Sbjct: 67  LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C ++    G GV   G                     +E   + +     +    P
Sbjct: 127 HYNVCSNL-GLIGNGVQSGGC--------------------AERMCINESHCFKVPKDMP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           +D   L+     + +  AIK A  ++G +V V G G +GL  +   +  G S I+V +  
Sbjct: 166 MDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEA 286
             ++E +   GAT + +PS+    ++I   L +M  G  G D+ FD +G    +  A+E 
Sbjct: 224 KVRRELAERMGATTY-DPSQHNTEKNI-QNLRKMILGGDGFDYVFDNSGTPETLETAIE- 280

Query: 287 CHKGWGQSIIIGVAAAGKEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGLIKDYQNGSL 345
           C    G ++ + +    K +   P  +    +++ GS       + +  G+I  ++ G +
Sbjct: 281 CLTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGSM---CYTQFDFEGVIDAFERGLI 337

Query: 346 KVD---EFITNRRPFVEINDAFEE 366
             D     IT + P   I D  E+
Sbjct: 338 DKDIARHMITAKVP---IEDGLED 358

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 158/374 (42%), Gaps = 48/374 (12%)

Query: 11  QAAVAYEAAKPLVVEEIVV-DPPKAHEVRIKIINTAVCHTD--AYTLSGVDPEGLF---- 63
           Q AV  +    +  E+I   +   +H V+I +  T +C +D   YT   +   G F    
Sbjct: 5   QKAVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKK 61

Query: 64  PCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
           P VLGHE SG+V  VG +VT V+ GD V               SG  NLC  +       
Sbjct: 62  PMVLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFA---- 117

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCL--LGCGVTT 181
                TP +              +    Y    D  V   D  +  +  C   L  GV  
Sbjct: 118 ----ATPPYDG------------TLVKYYLAPEDFLVKLPDHVSFEEGACAEPLAVGV-- 159

Query: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
               A + A    G  V VFGAG VGL     A + GAS ++ VD+  +K E S +FGAT
Sbjct: 160 ---HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGAT 216

Query: 242 DFVNPSELPEGQDIVSKLV--EMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGV 299
           + +N ++  + +D +++++  E+     +   DC+G    +R A++   K  G  + +G+
Sbjct: 217 NTINSTKY-KSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVL-KAGGSYVQVGM 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGR-SEMGGLIKDYQNGSLKVDEFITNRRPFV 358
              GK+    P  ++  +  +    G  +   ++    +K    G + V + IT+   F 
Sbjct: 275 ---GKDNINFPIAMIGAKELR--VLGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFE 329

Query: 359 EINDAFE-ELHHGN 371
           E  DA+   L HG+
Sbjct: 330 EAIDAYNFNLEHGS 343

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 100/231 (43%), Gaps = 22/231 (9%)

Query: 64  PCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
           P  +GHE SG V  VG  VT VK GD VV   T  C         K     +  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 124 VMPDGTPRFHNKKGEPLYHFMGCS----TFSEYTVVADVSVVAIDPTAPLDSVCLLGCGV 179
              D    +          FMG       F+E  V  +  VV +    P+D   L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 180 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFG 239
           +  + AA + +    G +  V GAG +GL+++   K++GASKIIV +    ++E +    
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 240 ATDFVNPSELPEGQDIVSKLVEMT-DG-GLDFTFDCTGNVNVMRDALEACH 288
              F +PS    G   V+ L   T DG G DF FDC+G        L+A H
Sbjct: 235 VETF-DPST--HGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/342 (25%), Positives = 140/342 (40%), Gaps = 36/342 (10%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
            ++ +KI    VC +D +  SG   +   P ++GHE  G V  VG N T+ VK GD V +
Sbjct: 34  RDIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGL 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                 C KCK CL+G  + C +   T         TP            ++    +++Y
Sbjct: 94  GAQALSCMKCKRCLNGNESYCPNAIQTY-------STPYEDG--------YVSKGGYADY 138

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 212
             V +   V I    P      L CG  T +   ++      G  VA+ G G +G   V 
Sbjct: 139 VRVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVL 197

Query: 213 GAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFD 272
            AK+ GA ++  +   + KKE + + GA  F+   E P+         E     LD    
Sbjct: 198 LAKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWH-------EKYFDELDLVVV 249

Query: 273 CTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C G+V ++  + L       G+ + I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSME--- 305

Query: 332 EMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           E+  L+K      +K+        P  E  +++ FE +  G+
Sbjct: 306 ELKQLLKLVSEKDIKI---WVETVPISEKGVHEVFERMDKGD 344

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 131/315 (41%), Gaps = 55/315 (17%)

Query: 13  AVAYEAAKPLVVEEIVVDP--PKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP------ 64
           A+AY   + +     + +P   K  +V I I+   +C TD + L  +D    FP      
Sbjct: 3   ALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETH 60

Query: 65  --------CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK----------CKFCL 106
                     +GHE +G+V  VG +VT  +PGDHVV   T  C            CK C 
Sbjct: 61  EISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACK 120

Query: 107 SGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPT 166
            G  N+C  +    G GV   G                    F+E  V+ +     +   
Sbjct: 121 RGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVPSW 159

Query: 167 APLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD 226
            PLD   L+       +  A+K   V++G +  + G G +GL ++   +  G + I+V +
Sbjct: 160 IPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSE 217

Query: 227 INNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDAL 284
               +++ + + GA    NP +    ++ +  L  ++    G DFTFDC+G ++V  ++ 
Sbjct: 218 PAKIRRDLAEKMGAI-VSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG-ISVTFESS 275

Query: 285 EACHKGWGQSIIIGV 299
             C    G +I + V
Sbjct: 276 IKCLTFRGTAINVAV 290

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 103/241 (42%), Gaps = 41/241 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE SG+VE VG    T K GDHVV   T  C                C  C  G
Sbjct: 67  LPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
            TN+C  + A  G G+   G                    F+E  V+ +  V  I    P
Sbjct: 127 MTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  A+K A+ +KG +  + G G +GL  +   K  G   I++ +  
Sbjct: 166 LDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEM--TDGGLDFTFDCTGNVNVMRDALEA 286
             ++E++ + GA  + +P+ +P  +  V  L EM     G D+TFDC+G    +  A+E 
Sbjct: 224 TIRREYAGKMGAKVY-DPTGVPFDES-VKTLREMGPNGDGFDYTFDCSGLPITLNAAIEC 281

Query: 287 C 287
           C
Sbjct: 282 C 282

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 101/242 (41%), Gaps = 42/242 (17%)

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFC 105
           EGL P  +GHE +G +   G  VT  K GD VV   T  C                C  C
Sbjct: 104 EGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAAC 162

Query: 106 LSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDP 165
             G  N+C ++    G GV   G                    F+E  V+ +     +  
Sbjct: 163 KKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCYKVPD 201

Query: 166 TAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVV 225
              +D   L+     + +  A++ +  +KG +V + GAG +GL  +      G S+++V 
Sbjct: 202 HMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVS 259

Query: 226 DINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDA 283
           +    +++++ + GA  + +PS     + I   L  +  G  G D+ FDC+GN   ++ A
Sbjct: 260 EPAKIRRDFAEKMGAIVY-DPSAKDHDESI-KYLRSIAPGGDGFDYAFDCSGNPATLKAA 317

Query: 284 LE 285
           +E
Sbjct: 318 IE 319

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 142/345 (41%), Gaps = 41/345 (11%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
            +V IK+I   VC +D +  +G        CV+GHE  G V  VG   T  VK GD V V
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPR-----FHNKKGEPLYHFMGCS 147
              +  C +C+ C++G    C          + PDG+        H +  E   H     
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSKAQGGFGSHVRTHEYFVH----- 148

Query: 148 TFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVG 207
                 +  ++  V   P         L CG  T +   ++   V  G TV + G G +G
Sbjct: 149 -----PIPKELDTVNAAP---------LLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIG 193

Query: 208 LSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGL 267
              +  AK+ GA K+I +  +  KKE   + GA +++  +   EG D   K      G +
Sbjct: 194 HIAILFAKAMGA-KVIAISRSASKKEDCLKLGADEYIASA---EGDDWKQKFA----GSI 245

Query: 268 DFTFDCTGNVNVMR-DALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG 326
           DF   C  + +    D+L +  K  G+   IG+      +S  P  L+ G  +  SA G 
Sbjct: 246 DFMLLCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLL-GIKFGFSALGS 304

Query: 327 IKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGN 371
                +M  L+K   N  L V+      +    +++AFE + +G+
Sbjct: 305 RNEFQKMFELVKK-NNIKLWVETLPIGEKG---LHEAFERVENGD 345

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 89/229 (38%), Gaps = 41/229 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  VG  V  +K GD VV   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C S     G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  AI     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSE--LPEGQDIVSKLVEMTDGGLDFTFDCTG 275
             ++E + + GA  + +P+E    E  D +  + E  D G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAAKESIDYLRSIAEGGD-GFDYTFDCSG 270

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 89/229 (38%), Gaps = 41/229 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  VG  VT  K GD VV   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C S     G GV   G                    F+E  V+ +     +    P
Sbjct: 127 LYNIC-SYLGLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  AI   + + G T  + GAG +GL  +    + G S I V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTG 275
             ++E + + GA  F +P+     +D +  L  +  G  G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVF-DPTA-HAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 90/229 (39%), Gaps = 41/229 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  VG  V  +K GD VV   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C S     G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  AI+    + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTG 275
             ++E + + GA  + +P+     ++ +  L  + DG  G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVY-DPTA-HAAKESIDYLRSIADGGDGFDYTFDCSG 270

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 89/229 (38%), Gaps = 41/229 (17%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  VG  V  +K GD VV   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAP 168
             N+C S     G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 LDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDIN 228
           LD   L+       +  AI     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 229 NDKKEWSAEFGATDFVNPSE--LPEGQDIVSKLVEMTDGGLDFTFDCTG 275
             ++E + + GA  + +P+E    E  D +  + E  D G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAARESIDYLRSVAEGGD-GFDYTFDCSG 270

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 102/248 (41%), Gaps = 62/248 (25%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVAL 94
           +E+ IK     +   +AY   G+ P  L P +LG E +G+V + G +V     GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKVA-- 93

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTV 154
                                                           +M  STF++YT 
Sbjct: 94  ------------------------------------------------YMSSSTFAQYTK 105

Query: 155 VADVSVVAIDPTAPLD-SVCLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLS 209
            +   +++  P+   D  + +    +  G  A     +   V++GD + ++ A G VGL 
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYILLYAAAGGVGLL 165

Query: 210 VVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMT-DGGLD 268
           + Q  K RGA  I VV    +K+E + +FGA   +N S+    +DI+ + +E+T D G+D
Sbjct: 166 MDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK----EDILKRALEITNDKGVD 220

Query: 269 FTFDCTGN 276
             FD  G 
Sbjct: 221 AVFDSVGK 228

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 149/357 (41%), Gaps = 42/357 (11%)

Query: 25  EEIVVDPPKA--HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNV 82
           +++  DP K   H++ IK+    VC +D +  SG   +   P V+GHE  G V  +G+N 
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 83  TT-VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPL 140
            + +K GD V V      C  C+ C +     C     T G+   PDG   + +K G   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG---YSSKGG--- 136

Query: 141 YHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTV 198
                   +++Y  V +   V I    P      L CG  T Y   ++      +K   V
Sbjct: 137 --------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIV 188

Query: 199 AVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSK 258
            + G G  GL     AK+ GA ++  +   + KKE + + GA  F+   E P   D  +K
Sbjct: 189 GIGGIGHQGLLF---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEP---DWGTK 241

Query: 259 LVEMTDGGLDFTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGR 317
             +      D    C  ++ +V  + +    K  G  + I V    + +S +PF L  G 
Sbjct: 242 YFDT----FDLIVVCASSLTDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL-KGV 296

Query: 318 VWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGNC 372
               SA G I   SEM  L+K     ++K+        P  E  + +AFE +  G+C
Sbjct: 297 SISNSALGSI---SEMRDLLKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGDC 347

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 137/347 (39%), Gaps = 58/347 (16%)

Query: 32  PKA---HEVRIKIINTAVCHTDAYTLSGVDPEGLFPC----------VLGHEGSGIVESV 78
           PKA   H+V I++    +C ++ + L          C          V+GHE  G V +V
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 79  GDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKG 137
           G  V+    GD V +    + C +C  C SG    C +  +T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 138 EPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDT 197
                ++    ++ +    +     I P  P + V  L CG  T +    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 198 VAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVS 257
           VAV G G +G   +  A++ GA ++      + K++ + + GA  FV   +         
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVATGDAD------- 244

Query: 258 KLVEMTDGGLDFTFD----CTGNVNVMR-DALEACHKGWGQSIIIGVAAAGKEISTRPFQ 312
                 + GLD TFD    C  + + +  +A+  C K     + +G+    +E+S +PF 
Sbjct: 245 -----WNAGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPFS 299

Query: 313 LVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE 359
                   GS+   +  RSE   L++      L V+    N RP+VE
Sbjct: 300 FFKNGCNIGSS--KLGSRSEAIELMQ------LAVEH---NFRPWVE 335

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 111/275 (40%), Gaps = 70/275 (25%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALY 95
           EV IK   T V + ++Y   G+ P  L P VLG E  G V ++G +V  +K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 96  TAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVV 155
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 156 ADVS-VVAIDPTAPLDSVCLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLSV 210
            + + V  +  T   + + L   G+  G  A     +  +V+KGD V ++ A G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 211 VQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLDF 269
            Q  + RGA  I V    N+K   + E GA   +N  E     +I+ K+ ++T G G+D 
Sbjct: 166 NQLLRMRGAHTIAVAS-TNEKLSLAKENGAEFLINSKE----DNILEKVQQITKGNGVDV 220

Query: 270 TFDCTGNVNVMRDALE---ACHKGWGQSIIIGVAA 301
            FD  G     +D  E   +C K  G  +  G A+
Sbjct: 221 AFDSVG-----KDTFETTLSCLKRKGTFVSYGNAS 250

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 141/339 (41%), Gaps = 31/339 (9%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHV-VA 93
           ++V +KI    VC +D +T SG   E   P V+GHE  G V  +G     +K GD V + 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYT 153
                C +C  C S     C     T  K    D T  +++K G           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 154 VVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQG 213
            + +   V I    P      L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 214 AKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDC 273
           AK+ GA +   +  ++ KKE + + GA  F+   E P   D  +K  +      D    C
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATKEEP---DWATKYFDT----FDLIVVC 253

Query: 274 TGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSE 332
           + ++ ++  + +    K  G+ + I V    + ++ +PF L+ G     SA GGI    +
Sbjct: 254 SNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIKQ 312

Query: 333 MGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGN 371
           M  L+   +N  + V+    + +   E+   FE +  G+
Sbjct: 313 MLDLVSK-KNLKIWVETIPISEKGVKEV---FERMEKGD 347

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 103/249 (41%), Gaps = 64/249 (25%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDP-EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVA 93
            E+ IK   T V + ++Y   G+ P E   P VLG E SG V + G  VT  + GD V  
Sbjct: 36  EELLIKNKYTGVNYIESYFRKGIYPCEK--PYVLGREASGTVVAKGKGVTNFEVGDQVA- 92

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYT 153
                                                            ++  STF++Y+
Sbjct: 93  -------------------------------------------------YISNSTFAQYS 103

Query: 154 VVADVSVVAIDPTAPLDS-VCLLGCG---VTTGYGAAIKTANVQKGDTVAVFGA-GTVGL 208
            ++    V   P    D  + L   G   V T      +  +V+KGD V +F A G VGL
Sbjct: 104 KISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGL 163

Query: 209 SVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GL 267
            + Q  K +GA  I V    ++K + + E+GA   +N S+    +DI+ ++++ T+G G+
Sbjct: 164 ILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK----EDILRQVLKFTNGKGV 218

Query: 268 DFTFDCTGN 276
           D +FD  G 
Sbjct: 219 DASFDSVGK 227

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 108/250 (43%), Gaps = 70/250 (28%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPC----VLGHEGSGIVESVGDNVTTVKPGDHV 91
           ++ IK   T V + ++Y       +GL+PC    +LG E +G + + G +VT  + GD V
Sbjct: 37  DLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVAKGKDVTNFEIGDKV 91

Query: 92  VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE 151
                                                              ++  STF++
Sbjct: 92  A--------------------------------------------------YISNSTFAQ 101

Query: 152 YTVV-ADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT---ANVQKGDTVAVF-GAGTV 206
           YT   ++ +V+ +      + + L   G+     A   T    +V+KGD + +F  AG V
Sbjct: 102 YTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGV 161

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG- 265
           GL + Q  + +GA  I V    ++K E + E+GA   +N S+    +DI+ K++E+T+G 
Sbjct: 162 GLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK----EDILKKVLEITNGE 216

Query: 266 GLDFTFDCTG 275
           G+D +FD  G
Sbjct: 217 GVDASFDSVG 226

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 130/309 (42%), Gaps = 34/309 (11%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-- 91
           H++ IKI    VC +D +T SG   +   P V+GHE  G V  +GD  T+ +K GD V  
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 92  --VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTF 149
              A    ECG+CK   S     C     T       DG    +N KG           +
Sbjct: 95  GAQAFSCLECGRCK---SDNEPYCTKSVWTYSTN-YEDG----YNSKG----------GY 136

Query: 150 SEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 209
           ++Y  + +   + I    P      L CG  T +   ++     +G  V + G G +G  
Sbjct: 137 ADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHM 195

Query: 210 VVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDF 269
            +  AK+ GA ++  +   + KK+ S + GA  F+   E P   D  +K  +      D 
Sbjct: 196 ALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATKEEP---DWATKYFDT----FDL 247

Query: 270 TFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIK 328
              C+ ++ ++  D +    K  G+ + I      + I+ +PF L+ G     SA GGI 
Sbjct: 248 IVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGGIN 306

Query: 329 GRSEMGGLI 337
              +M  L+
Sbjct: 307 EIKQMLDLV 315

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 127/317 (40%), Gaps = 57/317 (17%)

Query: 36  EVRIKIINTAVCHTDAYTLSG------VDPE-------GLFPCVLGHEGSGIVESVGDNV 82
           E+ + I+   +C TD + L+       +D E       GL P  +GHE +GIV +VG  V
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGL-PQAMGHEMAGIVTAVGSGV 86

Query: 83  TTVKPGDHVVALYTAECGK--------------CKFCLSGKTNLCGSVRATQGKGVMPDG 128
              + GDHV    T  C                C  C  G  N C  +    G GV   G
Sbjct: 87  KKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG 145

Query: 129 TPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIK 188
                               F+E  VV +          P +   L+       +  AI 
Sbjct: 146 --------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AIN 183

Query: 189 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSE 248
            A  + G +V + G G +GL  +      G ++IIV +    +++++ + GA  + +P +
Sbjct: 184 IAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPLQ 242

Query: 249 LPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEI 306
               Q I   L +M  G  G D+ FDC+G    ++ ++E C    G ++ + + A  K +
Sbjct: 243 CSHEQSI-PNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNKAV 300

Query: 307 STRPFQLVTG-RVWKGS 322
           +  P  +    +++ GS
Sbjct: 301 NFYPMDITKQEKIYTGS 317

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 113/311 (36%), Gaps = 52/311 (16%)

Query: 33  KAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPC----------VLGHEGSGIVESVGDNV 82
           +AH+V I++    +C ++ ++L          C          V+GHE  G V +VG NV
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 83  TTVKPGDHV-VALYTAECGKCKFCLSGKTNLC----GSVRATQGKGVMPDGTPRFHNKKG 137
           T    GD V +      C KC  C SG    C    G+  +    G +  G    H +  
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTYCSRYADGYISQGGYASHVRAH 153

Query: 138 EPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDT 197
           E                        I    P + V  L CG  T Y    +     K   
Sbjct: 154 EQF-------------------CFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPK 194

Query: 198 VAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVS 257
           VA+ G G +G   +  +K+ GA ++        KKE + + GA  F+   E         
Sbjct: 195 VAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE--------- 244

Query: 258 KLVEMTDGGLDFTFDCTGN-----VNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQ 312
              E  + GL+ TFD   N      ++  + L  C K     I +G+    ++   +PF 
Sbjct: 245 ---EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFS 301

Query: 313 LVTGRVWKGSA 323
             +     GS+
Sbjct: 302 FFSNGCCIGSS 312

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 114/281 (40%), Gaps = 39/281 (13%)

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V+GHE  G V +VG+ VT    G+ V +      C KC  C++G    C     T     
Sbjct: 79  VVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE- 137

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
            PDG              ++    ++ +    +  +V + P      V  L CG  T Y 
Sbjct: 138 YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVY- 182

Query: 185 AAIKTAN---VQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241
           + IK A      K   VA+ G G +G   +  +K+    ++  +  ++ KKE + + GA 
Sbjct: 183 SPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGAD 241

Query: 242 DFVNPSELPEGQDIVSKLVEMTDGGLDFTF----DCTGNVNVMR-DALEACHKGWGQSII 296
            FVN +E    +D+         GGL  TF     CT +   +  ++L       G+ I 
Sbjct: 242 HFVNTTE----KDVW--------GGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFIS 289

Query: 297 IGVAAAGKEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGL 336
           +G+ +  + +   P QL   G  +  S  G IK   E+  L
Sbjct: 290 VGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLAL 330

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 115/300 (38%), Gaps = 45/300 (15%)

Query: 66  VLGHEGSGIVESVGDNVTTVKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V+GHE  G V +VG  V+  K GD V +    + C +C  C S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP- 133

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184
            PDG              ++    ++ +    +     I P  P + V  L CG  T + 
Sbjct: 134 YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
              +    +K   VA+ G G +G   +  +K+ GA ++  V     K++ + + GA  F+
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

Query: 245 NPSELPEGQDIVSKLVEMTDGGLDFTFD----CTGNVNVMR-DALEACHKGWGQSIIIGV 299
             SE               + GLD TFD    C  + + +  +AL  C K     + +G+
Sbjct: 239 ATSE------------PNWNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGL 286

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE 359
               ++   +PF             G   G S++G   +  +   L V     N RP+VE
Sbjct: 287 PHIDEDFKVKPFSFFHN--------GCNIGSSKLGSREEAIELMQLAVKH---NFRPWVE 335

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/347 (20%), Positives = 129/347 (37%), Gaps = 75/347 (21%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVAL 94
           +E+ IK     + + ++Y   G+ P    P VLG E SG+V + GD VT     D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVA-- 115

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTV 154
                                                           ++  +TF++YT 
Sbjct: 116 ------------------------------------------------YLSSNTFAQYTK 127

Query: 155 VADVSVVAIDPTAPLDSVCLLGCG----VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSV 210
           +++   V+  P    D    L  G      T      +   V+KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 211 VQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLDF 269
                 +  +  I V   ++K + + E+GA   +N S+     D++++++E+T+G G++ 
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSK----DDVLARVLEITNGQGVEA 243

Query: 270 TFDCTGNVNVMRDALEACHKGWGQS-IIIGVAAAGKEISTRPFQLVTG---RVWKGSAFG 325
            FD  G     +D  E   K   +   ++    A   +      ++T    ++ + S FG
Sbjct: 244 AFDSVG-----KDTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLFG 298

Query: 326 GIKGRSEM----GGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELH 368
            I    E       L     +G+LK+   I+   P  E N A E+L 
Sbjct: 299 YIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLE 343

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 105/250 (42%), Gaps = 70/250 (28%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPC----VLGHEGSGIVESVGDNVTTVKPGDHV 91
           ++ IK   T V + ++Y       +GL+PC    VLG E +G++ + G +VT  + GD V
Sbjct: 37  DILIKNKYTGVNYIESYF-----RKGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 92  VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE 151
                                                              ++  STF++
Sbjct: 92  A--------------------------------------------------YISNSTFAQ 101

Query: 152 YTVVADVSVVAIDPTAPLDS-VCLLGCGVTTGYGAAIKT---ANVQKGDTVAVFGA-GTV 206
           YT       +   P+   D  + L   G+     A   T    +V+KGD + V+ A G V
Sbjct: 102 YTKFPSEGTIMKLPSGTSDEKMKLYAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGV 161

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG- 265
           GL + Q  + + A  I V     +K E + ++GA   ++ S+    +DI+++++E+TDG 
Sbjct: 162 GLILNQLLRMKDAHAIAVAS-TYEKLETAKDYGAEFLIDSSK----EDILTRVLEITDGK 216

Query: 266 GLDFTFDCTG 275
           G+D +FD  G
Sbjct: 217 GVDASFDSVG 226

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 141/352 (40%), Gaps = 38/352 (10%)

Query: 26  EIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT- 84
           E    P   ++V IKI    VC +D +  +G   +   P V+GHE  G V  VG    T 
Sbjct: 24  EFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTG 83

Query: 85  VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYH- 142
           +K GD V V      C +C+ C +     C                 RF     +P    
Sbjct: 84  LKIGDRVGVGAQVFSCLECERCKNDNEPYCA----------------RFVTTYSQPYEDG 127

Query: 143 FMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFG 202
           ++    ++ Y  V +   V I    P +    L CG  T Y   ++      G  V + G
Sbjct: 128 YVSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILG 186

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEM 262
            G +G   +  AK+ GA ++  +  +N KKE S + GA  ++   E P   D  +K  + 
Sbjct: 187 IGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEP---DWGTKYFDT 242

Query: 263 TDGGLDFTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
                D    C  ++ +V  D +    K  G+ + I V    + ++ +PF L+ G     
Sbjct: 243 ----FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEVLTMKPFGLI-GVSIAN 297

Query: 322 SAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           S  G I   +EM  L+K     ++K+        P  E  + +AFE +  G+
Sbjct: 298 SILGSI---AEMKQLLKLVSENNIKI---WVETLPVGEAGVKEAFERMDKGD 343

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 115/286 (40%), Gaps = 69/286 (24%)

Query: 1   MSTVGKPITCQAAV------AYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTL 54
           MS+V  P   +A +       Y+  K   +    +  P  +++ IK     V + ++Y  
Sbjct: 14  MSSVALPKIQKAIIIDGVSDGYDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFR 71

Query: 55  SGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCG 114
            G+ P  L P +LG E SG+V   G N+   + GD V     A  G C            
Sbjct: 72  KGIYPCAL-PAILGREASGVVVDKGTNIKNFEIGDKV-----AYIGNC------------ 113

Query: 115 SVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCL 174
                                            + +++T + +  ++ +   +  + + L
Sbjct: 114 ---------------------------------SMAQFTKIDNSMIMKLSSDSTNEDLKL 140

Query: 175 LGCGVTTGYGA---AIKTANVQKGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDINND 230
              G+  G  A     +   V+KGD + V+  AG  GL   Q  K+RGA  +I V  +++
Sbjct: 141 YAAGILQGLTALSFVTEAYEVKKGDYILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDE 199

Query: 231 KKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLDFTFDCTG 275
           K + + E GA   +N     +  DI++K++E+TD  G+   FD  G
Sbjct: 200 KLQLAKENGAEYLIN----SKTDDILTKVMEITDNKGVQAAFDSVG 241

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 134/352 (38%), Gaps = 38/352 (10%)

Query: 26  EIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT- 84
           E    P   H++ IKI    VC +D +  +G   +   P V+GHE  G V  +G    T 
Sbjct: 25  EFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTG 84

Query: 85  VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYH- 142
           +K GD V V      C +C  C +     C                P+F     +P    
Sbjct: 85  LKVGDRVGVGAQVFSCLECDRCKNDNEPYC----------------PKFVTTYSQPYEDG 128

Query: 143 FMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFG 202
           ++    ++ Y  V +   V I    P      L CG  T Y   ++           V  
Sbjct: 129 YVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGI 188

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEM 262
            G   + ++  AK+ GA ++  +  +N KKE S + GA  ++   E P          E 
Sbjct: 189 GGIGHMGLL-FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWG-------EK 239

Query: 263 TDGGLDFTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
                D    C  ++ +V  D +    K  G+ + I +    + ++ +PF L+ G     
Sbjct: 240 YFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIAN 298

Query: 322 SAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           SA G IK   E+  L+K      +K+        P  E  + +AFE +  G+
Sbjct: 299 SALGSIK---EIEQLLKLVSEKDIKI---WVETLPVGEAGVKEAFERMDKGD 344

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 116/282 (41%), Gaps = 27/282 (9%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
           +++ IKI    VC +D +  SG   +   P V+GHE  G V  VG   T+ +K GD V V
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                 C  C  C +     C +V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 212
             V +   V I    P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 213 GAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFD 272
            AKS GA ++  +  ++ KKE + + GA  F+   + P   D   K  +     LD    
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEP---DWGKKYFDT----LDLIVI 249

Query: 273 CTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQL 313
           C G++ +V  D L       G+ + I +  A +++    F L
Sbjct: 250 CAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL 291

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 143/356 (40%), Gaps = 42/356 (11%)

Query: 25  EEIVVDPPK--AHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNV 82
           ++I  +P K   ++V ++I    +C +D +  SG       P V+GHE  G V  VG   
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 83  TT-VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPL 140
            T VK GD V V    + C  C  C S     C     T  +   PDG            
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG------------ 128

Query: 141 YHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTV 198
             ++    ++ +    +  V+ I    P      L CG  T +   I       +K   V
Sbjct: 129 --YVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 199 AVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSK 258
            + G G +GL     AK+ GA ++  +  ++ KKE + + GA  F+   E P+ +   + 
Sbjct: 187 GIGGIGHMGLIF---AKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYA- 241

Query: 259 LVEMTDGGLDFTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGR 317
                   LD    C  ++  +  + L    +  G+ I I V    +E++ +PFQL +G 
Sbjct: 242 ------STLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGI 294

Query: 318 VWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
               S  G    R E+  L++   +  LK+        P  E  ++DAF  +  G+
Sbjct: 295 TIGNSQLG---SRKELIQLLQLVADKDLKI---WVETLPISEESVHDAFVRMEKGD 344

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 87/359 (24%), Positives = 133/359 (37%), Gaps = 79/359 (22%)

Query: 25  EEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT 84
           E+  V    A EV IK   + +   ++Y   G+ P    P VLG E +G V + GD V+ 
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 85  VKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFM 144
              GD V                                                   ++
Sbjct: 99  FNIGDKVA--------------------------------------------------YL 108

Query: 145 GCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTAN----VQKGDTVAV 200
              TF++YT   +   +   P    D       G       A+   N    V+KGD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 201 F-GAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKL 259
           +  AG  GL   Q  K +GA  I V    ++K + + E+GA   +N S+     D +SK+
Sbjct: 169 YAAAGGAGLIFNQLLKLKGAHTIAVAS-TDEKLKLAREYGAEYVINSSK----DDTLSKV 223

Query: 260 VEMTDG-GLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQL----- 313
           +E+T+G G+   FD  G  +    +L+A  +  G  +  G A+        PF +     
Sbjct: 224 LEITNGEGVAAAFDSIGK-DTFEISLQAIKRK-GTLVSFGNASG----PVPPFSINRLSS 277

Query: 314 VTGRVWKGSAFGGIKGRSE----MGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELH 368
              +V +   FG I    E       LI+   +G LKV  FI+   P  E   A E L 
Sbjct: 278 KNLKVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 140/346 (40%), Gaps = 36/346 (10%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   +++ IKI    VC +D +  +G   +   P V+GHE  G V  +G+N  + +K GD
Sbjct: 33  PFYPNDIDIKIECCGVCGSDIHAAAGHWGDLEKPLVVGHEVIGTVVRLGENCNSGLKLGD 92

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
            V V      C  C+ C S     C S   T G+    DG   + +K G           
Sbjct: 93  RVGVGAQVFSCLDCERCKSNNEPYCPSFVTTYGQS-YKDG---YSSKGG----------- 137

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGL 208
           +++Y  V +   V I    P      L CG  T +   ++           V   G   +
Sbjct: 138 YADYIRVHEHFAVPIPENIPSHLAAPLMCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHM 197

Query: 209 SVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLD 268
            ++  AK+ GA ++  +   + KKE + + GA  F+   E P   D  +K  +      D
Sbjct: 198 GLIF-AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEP---DWGTKYFDT----FD 248

Query: 269 FTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGI 327
               C  ++ +V  + +    K  G  + I V    + ++ +PF L+ G     SA GG+
Sbjct: 249 LIVVCANSLTDVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISNSALGGV 307

Query: 328 KGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           K   E+  L+      +LK+        P  E  +  AFE +  G+
Sbjct: 308 KEIKELLDLV---SKNNLKI---WVETLPIGEEGVKQAFERMDKGD 347

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 128/327 (39%), Gaps = 74/327 (22%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVAL 94
           +E+ +K   + +   ++Y   G+ P    P +LG E SG V + G++V     GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKVA-- 108

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTV 154
                                                           ++  S F++YT 
Sbjct: 109 ------------------------------------------------YLSGSAFAQYTK 120

Query: 155 V-ADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLS 209
           V A   VV +   A  +++ L   G+     A     +  NV+KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 210 VVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLD 268
           + Q  K RGA  I VV    +K E + + GA   +  S+    +DIV+++ E+T+  G+D
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSK----EDIVTRVKEITNNQGVD 235

Query: 269 FTFDCTGNVNVMRDALEACHKGWGQS-IIIGVAAAGKEISTRPFQLVTG--RVWKGSAFG 325
             FD  G     +D  E       +    +    A   +S  P   +TG  ++ + S F 
Sbjct: 236 AAFDSIG-----KDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLFS 290

Query: 326 GIKGRSEMGGLIKDY----QNGSLKVD 348
            I    E     +++     +G LK++
Sbjct: 291 YIATSEEWKHYSREFVSLVSSGKLKIN 317

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 7/88 (7%)

Query: 191 NVQKGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSEL 249
           NVQKGD + V+  AG VGL   Q  K+RGA + I V   ++K + + E+GA   +N ++ 
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTK- 221

Query: 250 PEGQDIVSKLVEMTDG-GLDFTFDCTGN 276
               DIV K+ E T+G G+   FD  G 
Sbjct: 222 ---DDIVEKVKEFTNGEGVAAAFDSIGK 246

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 138/343 (40%), Gaps = 56/343 (16%)

Query: 60  EGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECG--------------KCKFC 105
           EGL P  +GHE +GIV  +G  V   + GD VV   T  C               +C  C
Sbjct: 65  EGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAAC 123

Query: 106 LSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDP 165
             G  N+C ++    G GV   G                    F+E  V+ +     I  
Sbjct: 124 KKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKCYKIPE 162

Query: 166 TAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVV 225
              +D   L+     + +  A++ +  + G +V + G G +GL  +      G ++++V 
Sbjct: 163 HLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVS 220

Query: 226 DINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG--GLDFTFDCTGNVNVMRDA 283
           +    +++ + + GA  + +P      + I   L  +  G  G D+TFDC+GN   ++ A
Sbjct: 221 EPAKIRRDLAEKMGAVVY-DPMTRDHDESI-KYLRSIAPGGDGFDYTFDCSGNPATLKAA 278

Query: 284 LEACHKGWGQSIIIGVAAAGKE-ISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQ 341
           +E C    G +  + VA  GK  +S  P  L    + + GS         +   +IK ++
Sbjct: 279 IE-CLTFRGTA--VNVAIWGKNPVSFLPMDLTHQEKSYTGSM---CYTYHDFEAVIKAFE 332

Query: 342 NGSL---KVDEFITNRRPFVE-INDAFEEL--HHGNCLRTVLS 378
              +   K    IT R P    + DA   L  H    ++ +L+
Sbjct: 333 ERRIDEEKAKHMITGRVPIENGVKDAILRLITHKEQTIKIILT 375

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 96/246 (39%), Gaps = 49/246 (19%)

Query: 33  KAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVV 92
           K +E+ IK     + H D  +         FP V G E SGIV   G+ V          
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKV---------- 121

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                   + KF L G+  +  +                         Y  +  STF EY
Sbjct: 122 -------DEEKFPLGGEVFIASTT------------------------YRDLRTSTFQEY 150

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANV----QKGDTVAVFGAGT-VG 207
           TV     V  +     LD    +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 208 LSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGL 267
           + VVQ AKS G +KII +  +   +++    GAT  ++  E  + +DIV+++ ++   G+
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREE--KTEDIVNEIKKICPNGV 267

Query: 268 DFTFDC 273
               D 
Sbjct: 268 SHGVDL 273

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 130/316 (41%), Gaps = 31/316 (9%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
           H+++IK+    VC +D +  SG       P V+GHE  G V  VGD     +K GD V V
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                 C +C  C +   + C    AT G G  PDG              ++    ++++
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 212
             V +  VV I    P +    L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNG-CGPGKKVGIVGIGGIGHQGVI 197

Query: 213 GAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFD 272
            A + GA ++  +   + KK+ + + GA  F+   E P   D  +K  +      D    
Sbjct: 198 FANAMGA-EVYAISRTSKKKDDAFKLGAHHFIATKEEP---DWGTKYYDT----FDLIVV 249

Query: 273 CTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C  ++ ++  D +    K  G+ + I +    + +  +PF L  G     S  G IK   
Sbjct: 250 CANSLTDIDFDVVPHTMKIGGRIVSISIPEMSQVLKLKPFGL-KGVSISNSHLGSIK--- 305

Query: 332 EMGGLIKDYQNGSLKV 347
           E+  L+K     +L++
Sbjct: 306 ELKTLLKLVSEKNLRI 321

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 132/340 (38%), Gaps = 32/340 (9%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
           H++ I+++   VC +D +  SG   E   P V+GHE  GIV   G    + +K  D V V
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                 C  C  C       C +  +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 212
             V +   V I  + P      L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 213 GAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFD 272
            AK+ GA ++  +   + KK  + + G   F+   E P+         E     LD    
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIATKEEPDWH-------EKYFDTLDLLVI 249

Query: 273 CTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C G++ +V  D L       G+ + I +    + +  +PF LV G     S  G +K   
Sbjct: 250 CAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKELK 308

Query: 332 EMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGN 371
           E+  L+    N  + V+      +    +N+AF  +  G+
Sbjct: 309 ELLELVAK-NNIKIWVETIPIGEK---GVNEAFTRMEKGD 344

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 90/226 (39%), Gaps = 65/226 (28%)

Query: 61  GLFPC----VLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSV 116
           GL+PC    VLG E  G+V ++G +V   K GD V             CLS         
Sbjct: 57  GLYPCEKPYVLGREAVGVVAAIGADVRRFKVGDRVA------------CLS--------- 95

Query: 117 RATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLD-SVCLL 175
                                          TF++YT V++ S V   P    D  +  +
Sbjct: 96  -----------------------------SGTFAQYTAVSEKSNVLKLPDDIQDGELQAV 126

Query: 176 GCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDK 231
              +  G  A     +    Q G+ V V+ A G VG  ++Q   +R   ++I V   ++K
Sbjct: 127 AGSLVNGLTALTLVDEAYKPQVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEK 185

Query: 232 KEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLDFTFDCTGN 276
            + +   GA   +N S     +DIV+K++E TDG G+  ++D  G 
Sbjct: 186 LQIAKSRGAEFLINSSR----EDIVAKVLEFTDGEGVGASYDSVGK 227

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 104/260 (40%), Gaps = 63/260 (24%)

Query: 34  AHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVA 93
           ++E+ IK   + +   +AY   G+ P  L P + G E SGIV  VG +V   + GD V  
Sbjct: 52  SNEMVIKNSYSGINFIEAYFRKGIYPCEL-PYLPGREASGIVAEVGKDVKNFQIGDKVAY 110

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYT 153
           L+                                         GE         T +E+T
Sbjct: 111 LH-----------------------------------------GE---------TMAEFT 120

Query: 154 VVADVS-VVAIDPTAPLDSVCLLGCGVTTGYGAAI---KTANVQKGDTVAVF-GAGTVGL 208
            + +   ++ +   A  +++ L   G+     A     +   V+KG+ V V+  AG VGL
Sbjct: 121 KIKETDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVLVYAAAGGVGL 180

Query: 209 SVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GL 267
            + Q  K +GA  I V     +K E +   GA   +N  E    +++V +++E+T+  G+
Sbjct: 181 LLDQLLKMKGAHTIAVCS-TKEKLELAKANGAEFSINSKE----ENVVQRVMEITNNKGV 235

Query: 268 DFTFDCTGNVNVMRDALEAC 287
           D  +D  G      D L A 
Sbjct: 236 DVAYDSIGKA-TFEDTLAAL 254

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 127/327 (38%), Gaps = 75/327 (22%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALY 95
           +V +K     V   +AY   G  P  L P VLG E SG V  VG  V   K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 96  TAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVV 155
                                                          ++G STF++YT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 156 A-DVSVVAIDPTAPLDSVCLLGCGVT---TGYGAAIKTANVQKGDTVAVFGA-GTVGLSV 210
           + +  ++ +  + P + + L G  +    T      +   V +GD + V+ A G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 211 VQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GLDF 269
            Q    R A  +I V  + +K   + E GA   +N +E     DI+ K+++ T+G G+  
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAE----DDILEKVMQYTNGKGVHA 219

Query: 270 TFDCTGNVNVMRDALEACHKG----WGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
            FD  G      D      KG    +G +  +    A  ++S +  +L+  +V+     G
Sbjct: 220 AFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY-----G 274

Query: 326 GIKGRSEMG---GLIKDY-QNGSLKVD 348
            +  RSE      + K + Q+ SLKVD
Sbjct: 275 YLGTRSEWDHYCSIFKHFVQSKSLKVD 301

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 94/233 (40%), Gaps = 21/233 (9%)

Query: 17  EAAKPLVVEEIVVDPPKA---HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSG 73
           ++ K  +  E VV P K     +V I+I    VC +D +   G   E   P V+GHE  G
Sbjct: 14  DSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHEIIG 73

Query: 74  IVESVGDNVTT-VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPR 131
            V  +GD   T +K GD V V    + C  C  C +     C     T  +    DG   
Sbjct: 74  KVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG--- 130

Query: 132 FHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTAN 191
                      ++G   ++ +  V +  V+ I  +   ++V  L CG  T Y    +   
Sbjct: 131 -----------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVYSPLKRNGC 179

Query: 192 VQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
                   V   G   + ++  AK+ GA ++  +  ++ K+E S + GA  ++
Sbjct: 180 GPGKKVGIVGIGGIGHMGILL-AKAMGA-EVYAISRSHAKEETSKQLGADHYI 230

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 69/329 (20%), Positives = 127/329 (38%), Gaps = 75/329 (22%)

Query: 7   PITCQAAVAYEAAKPLVVEEIVVDPPKA--HEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64
           P+  QAAV     + ++V + +  P +   HE+ I+   T + H D  +         FP
Sbjct: 42  PLFQQAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFP 101

Query: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            + G E SGIV   G                 A+  + +F +  +  L  +         
Sbjct: 102 WINGRESSGIVVRRG-----------------AKVDRDRFPIGAEVFLASTC-------- 136

Query: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPL---DSVCLLGCGVTT 181
                           Y  +  STF E+TV  D  +V   P   L    +    G     
Sbjct: 137 ----------------YRELKTSTFQEFTVF-DSRLVWRLPREILPDGTTRKRFGLDFAA 179

Query: 182 GYGAAIKTA--------------NVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVD 226
           G G  + TA                 +G ++ V+G + +VG+  +Q A++ G  K I+  
Sbjct: 180 GVGVPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIFTIQLARNLGIFKNIIAV 239

Query: 227 INNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGN------VNVM 280
            +   +++  E GAT  ++ + LP  +++V K  E+   G+D+  D          + ++
Sbjct: 240 SSLRYEDYLKELGATAVIDRT-LP-SEELVQKFQELCPTGVDYGVDVISKKTAELVLEIL 297

Query: 281 RDALEACHKGWGQSIIIGVAAAGKEISTR 309
           +D      KG  +S++    A G+++  +
Sbjct: 298 KDG-----KGTKKSLVCLSGAPGEDVRAK 321

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 115/283 (40%), Gaps = 27/283 (9%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV-V 92
           H++ IKI    VC +D +  SG   +   P V+GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEY 152
                 C +C  C++     C  V  T       DG   + ++ G           ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANP-YEDG---YSSRGG-----------YANY 138

Query: 153 TVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 212
             V +   V I  + P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 213 GAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFD 272
            AK+ GA ++  +   + K++ + + GA  F+   E P+         E  D  LD    
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHK------EYFD-KLDLVVI 249

Query: 273 CTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLV 314
           C G++ ++  + L       G+ + I +    + +  +PF LV
Sbjct: 250 CAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 115/283 (40%), Gaps = 27/283 (9%)

Query: 34  AHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV- 91
           A ++ +K+    VC +D +  +G       P V+GHE  G V  VG      +K GD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 92  VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE 151
           V      C +C  C S     C ++  T      PDG              ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNMTGTYNFP-YPDG--------------YISQGGYAS 160

Query: 152 YTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV 211
           + +V +   + I    P      L CG  T +   +++ NV  G +V V G G +G   V
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 212 QGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTF 271
             AK+ GA+ +  +   ++KK+ + + GA  ++   E  +     +         LD   
Sbjct: 220 IFAKALGAN-VTAISRRSNKKDDALKLGADVYIAAVEDKDWHKTYANT-------LDLIV 271

Query: 272 DCTGNVNVMR-DALEACHKGWGQSIIIGVAAAGKEISTRPFQL 313
            C+ ++  +  D + +  K  G+ + I +  A + +  RP  L
Sbjct: 272 VCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL 314

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 138/348 (39%), Gaps = 40/348 (11%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   H+V IKI    VC +D +  +G       P V+GHE  G V  +G    + +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQ 89

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
            V V      C +C  C S     C     T  +    DG              ++    
Sbjct: 90  RVGVGAQVFSCLECNRCKSDNEPYCTKFVTTYSQP-YEDG--------------YVSQGG 134

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGTV 206
           ++ Y  V +  VV +    P      L CG  T Y   I+      +K   V   G G++
Sbjct: 135 YANYVRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSM 194

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G  +   AK+ GA +  V+  ++ KKE + + GA  ++      E +D   K  +  D  
Sbjct: 195 GSLI---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATL---EEEDWGEKYFDTFDLI 247

Query: 267 LDFTFDCTG-NVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
           +      TG + NVM  A+    K  G+ + I +    + ++ +P+ L    +   SA G
Sbjct: 248 VVCASSLTGIDFNVMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALG 302

Query: 326 GIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
            IK   E+  L+K      +K+        P  E  +++A E +  G+
Sbjct: 303 SIK---ELKQLLKLVSENDIKI---WVETLPIGEAGVHEALERMEKGD 344

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 128/318 (40%), Gaps = 40/318 (12%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   H+V IKI    VC +D +  +G       P V+GHE  G V  +GD   + +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
            V V      C +C  C S     C     T  +    DG              ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYCTKFVTTYSQP-YEDG--------------YISQGG 134

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGTV 206
           ++ Y  V +  +V I    P      L CG  T Y   ++      +K   V + G G++
Sbjct: 135 YANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G  +   +K+ GA +  V+  ++ KKE + + GA  ++  + L EG D   K  +     
Sbjct: 195 GTLI---SKAMGA-ETYVISRSSKKKEDAIKMGADHYI--ATLEEG-DWGEKYFDT---- 243

Query: 267 LDFTFDCTGNV-----NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
            D    C  ++     N+M  A+    K  G+ + I +    + ++ +P+ L    +   
Sbjct: 244 FDLIVVCASSLTDIDFNIMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SY 298

Query: 322 SAFGGIKGRSEMGGLIKD 339
           SA G IK   ++  L+ +
Sbjct: 299 SALGSIKELKQLLALVSE 316

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 127/319 (39%), Gaps = 42/319 (13%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   H+V IKI    VC +D +  +G   +   P V+GHE  G V  +G    + ++ G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQ 89

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
            V +      C +C  C S     C     T G+    DG              ++    
Sbjct: 90  RVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQGG 134

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGTV 206
           +++Y  V +  VV I    P      L CG  T Y   ++      +K   V   G G++
Sbjct: 135 YADYVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSM 194

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G  +   AK+ GA +  V+  ++ K+E + + GA  +            ++ L E   G 
Sbjct: 195 GTLI---AKAMGA-ETYVISRSSKKREDAMKMGADHY------------IATLEEENWGE 238

Query: 267 LDF-TFD----CTGNVN-VMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWK 320
             F TFD    C  ++  +  D +    K  G+ + I +    + ++ +P+ L    +  
Sbjct: 239 KYFDTFDLIVVCASSLTGIDFDVMPKAMKVGGRIVSISIPEQHEVLTLKPYGLKAVSI-S 297

Query: 321 GSAFGGIKGRSEMGGLIKD 339
            SA G IK   ++  L+ +
Sbjct: 298 YSALGSIKELKQLLKLVSE 316

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 133/347 (38%), Gaps = 38/347 (10%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   ++V I+I    VC +D +  +G   +   P V+GHE  G V  VG    T VK GD
Sbjct: 30  PFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIGD 89

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYH-FMGCS 147
            V V      C KC  C S     C                P+F     +P    ++   
Sbjct: 90  RVGVGAQVYSCLKCDRCKSDNEPYC----------------PKFVTTYSQPYEDGYVSQG 133

Query: 148 TFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVG 207
            ++ +    +  V+ I    P      L CG  T Y    +           V   G   
Sbjct: 134 GYASHIRCHEHFVIPIPENIPTHLAAPLLCGGITVYSPLSRNGCGPGKKVGIVGIGGIGH 193

Query: 208 LSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGL 267
           + ++  AK+ GA ++  +  ++ KKE +++ GA  F+      E ++   K  +      
Sbjct: 194 MGLI-FAKAMGA-EVYAISRSSAKKEDASKLGADHFIATK---EEENWSQKYFDT----F 244

Query: 268 DFTFDCTGNV-NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG 326
           D    C  ++ +V  D +    K  G+ + I V    + +  +P  L+   +    +  G
Sbjct: 245 DLVVVCASSLTDVDFDKMSRVMKIGGKIVSISVPEQSERLVLKPLGLLGVSI----SNSG 300

Query: 327 IKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           +  R E+  L++     +LK+        P  E  + +AFE +  G+
Sbjct: 301 LGSRKEIIQLLQLVSEKNLKI---WVETLPVGEKGVREAFERMDKGD 344

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 89/229 (38%), Gaps = 66/229 (28%)

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           FP + G E SGIV   G  V T                  KF +S +  L  +       
Sbjct: 101 FPWINGRESSGIVIRRGSKVDT-----------------QKFPISAEVFLASTS------ 137

Query: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCL-------- 174
                             Y  +  STF EYTV  D  +V   P   L +  L        
Sbjct: 138 ------------------YRDLETSTFQEYTVF-DSRLVWKLPQYRLPNGRLHKRFDLEF 178

Query: 175 ---LGCGVTTGYGAAIKT---------ANVQK-GDTVAVFGAGTVGLSVVQGAKSRGASK 221
              +G G+ T  G+AI +         A+ QK G+ V   G+ +VGL V+Q AK+    +
Sbjct: 179 AAGVGVGLVTA-GSAISSLVDLSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFE 237

Query: 222 IIVVDINNDKKEWSAEFGATDFVNPSELPEG--QDIVSKLVEMTDGGLD 268
            IVV   +  KE+  E GA+  ++  +  E    DI+S   E  D G+D
Sbjct: 238 KIVVVSASKHKEYLLELGASCIIDRHQSEEEILDDILSHCPEGIDFGID 286

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 141/352 (40%), Gaps = 48/352 (13%)

Query: 31  PPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGD 89
           P   H++ IKI    VC +D +  +G       P V+GHE  G V  +G    + +K G 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 90  HV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCST 148
            V V      C +C  C +     C     T  +    DG              ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQP-YEDG--------------YVSQGG 134

Query: 149 FSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGTV 206
           ++ Y  V +  VV I    P      L CG  T Y   ++      +K   V + G G++
Sbjct: 135 YANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 207 GLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGG 266
           G  +   +K+ GA +  V+  ++ K+E + + GA  ++  + L EG D   K  +     
Sbjct: 195 GTLI---SKAMGA-ETYVISRSSRKREDAMKMGADHYI--ATLEEG-DWGEKYFDT---- 243

Query: 267 LDFTFDCTGNV-----NVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
            D    C  ++     N+M  A+    K  G+ + I +    + +S +P+ L    +   
Sbjct: 244 FDLIVVCASSLTDIDFNIMPKAM----KVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SY 298

Query: 322 SAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE--INDAFEELHHGN 371
           SA G IK   E+  L+K      +K+        P  E  +++AFE +  G+
Sbjct: 299 SALGSIK---ELNQLLKLVSEKDIKI---WVETLPVGEAGVHEAFERMEKGD 344

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 25  EEIVVDPPK--AHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNV 82
           E+    PP     ++ ++I    VC +D + ++G       P  +GHE  G + ++G+ V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQV 81

Query: 83  TTVK--PGDHV-VALYTAECGKCKFCLSGKTNLC 113
              K   GD V V      CGKC  C  G+   C
Sbjct: 82  NKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 69/164 (42%), Gaps = 19/164 (11%)

Query: 150 SEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GTVGL 208
           +EY VV++ +V              LG  +TT    A++ A V+  D V+V GA G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 209 SVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDG-GL 267
            VVQ A+S G   +            +A    TD      + E ++  S L  +T G G+
Sbjct: 110 YVVQLAQSMGCRVL-----------RAARQSPTDVC----IAEDEEF-SALTSLTQGRGV 153

Query: 268 DFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPF 311
           D   D  G   +M+ A E    G   ++I     A   I  + F
Sbjct: 154 DVVIDTVGMPALMKAAAEKLAHGGRMAVISARYGAELAIHLKDF 197

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.7 bits (73), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 186 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244
           A++   V+ GD V V     +GL V    +  G  K++++   + KK+ S +FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 86/360 (23%), Positives = 136/360 (37%), Gaps = 56/360 (15%)

Query: 24  VEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSG-IVESVGDNV 82
           +E   V   K H+  +KI    +CH+D   L G  P       +GHE  G +V++  D  
Sbjct: 100 LENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQ-RYAMGHEICGELVQTYAD-- 156

Query: 83  TTVKPGDHVVALYT----AECGKCKFCLSGKTNLC-----GSVRATQGKGVMPDGTPRFH 133
              +P   V  LYT    A CG C  C  G  + C      +    Q  G+  DG   + 
Sbjct: 157 ---EPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGRDGG--YA 211

Query: 134 NKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQ 193
                 L H +      E     ++  VA D              V T Y A        
Sbjct: 212 EYIAIDLRHLVKVP--KELVNKPEICAVATD-------------AVLTPYHAIKNIPGFA 256

Query: 194 KGD--TVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPE 251
           K       V G G +GL+ +Q A + G S++I VD  + + + + E GA           
Sbjct: 257 KTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA----------- 304

Query: 252 GQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPF 311
            + +  +L      G+D   D  G+ + +  A+    K  G   ++G++AAG EI     
Sbjct: 305 -EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGYEIRFPAL 362

Query: 312 QLVTGRVWKG--SAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHH 369
             + G+      S +G    + E+  LI      + KV   +T+   F ++    EE+  
Sbjct: 363 SYMLGKEISMIYSFWGTTSDQKEVLDLI-----AAGKVMPQVTSYSLFTDLPSKIEEMRE 417

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 108/292 (36%), Gaps = 35/292 (11%)

Query: 35  HEVRIKIINTAVCHTDAYTLSGVDPEGLFPC----------VLGHEGSGIVESVGDNVTT 84
           H++ I++    +C ++ ++L          C          V+GHE  G V  VG+ VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 85  VKPGDHV-VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHF 143
            K G  V +    + C +C  C S     C      +  G      P  +  +G    H 
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYC-----LKSVGTYCSRYPDGYVSQGGYASHV 152

Query: 144 MGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGA 203
                F  + +  DV    + P         L CG  T Y    +     +   V + G 
Sbjct: 153 RAHEQFC-FPIPDDVPSAFVAP---------LMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 204 GTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMT 263
           G +G   +  AK+ GA ++     +N KK+ + + GA  FV      E ++  S+L +  
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATG---EEENWSSRLAD-- 256

Query: 264 DGGLDFTFDCTGNVNVMR-DALEACHKGWGQSIIIGVAAAGKEISTRPFQLV 314
                   +C  +   +  +A  +  K   Q + +G+   G+     PF  +
Sbjct: 257 --NFHLVLNCASSTTSLDLNAFVSILKVNCQLVSVGLPEKGETFDLSPFTFI 306

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 107/285 (37%), Gaps = 27/285 (9%)

Query: 33  KAHEVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTT-VKPGDHV 91
           K  +V I+I    VC +D +  SG   E     V+GHE  G V  +G    T +K GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 92  -VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFS 150
            V    A C  C+ C       C     T  +   PDG              ++    ++
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYA 136

Query: 151 EYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSV 210
            +  V +  V+ +    P      L CG  T Y   ++           V   G   + +
Sbjct: 137 SHIRVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGI 196

Query: 211 VQGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFT 270
           +  AK+ GA ++     + +K+E S + GA  ++   E  EG        E     LD  
Sbjct: 197 L-FAKAMGA-EVYAFSRHENKREDSMKLGADHYIATLE-EEG------WTEKYFNSLDVM 247

Query: 271 FDCTGNVNVMR-DALEACHKGWGQSIIIGVAAAGKEISTRPFQLV 314
             C  +++ +  D L    K  G+ I I V    + +  +P  L+
Sbjct: 248 ILCASSLSQINLDDLIKVMKVEGKIISICVPENDEMMIVKPLGLL 292

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 34  AHEVRIKIINTAVCHTDAYTLSGVDPEGLFPC----------VLGHEGSGIVESVGDNVT 83
           AH+V I++    +C ++ ++L          C          V+GHE  G V +VGD V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 84  TVKPGDHV-VALYTAECGKCKFCLSGKTNLCG 114
             K GD + +    + C  C  C       C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 220 SKIIVVDINNDKKEWSAEFGATDFVNPSELP--EGQDIVSKLVEMTDG-GLDFTFDCTG 275
           S +I VD+ ++K + + +FGAT   N S+    E Q +  +L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>TDEL0A06330 Chr1 (1108746..1110917) [2172 bp, 723 aa] {ON}
           Anc_8.688 YPL164C
          Length = 723

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 10/71 (14%)

Query: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKA----------HEVRIKIINTAVCHTD 50
           + +VG+P TC A +  +   PLV ++++ DP K           H + +K++ + + H  
Sbjct: 307 VKSVGRPYTCHALIIIDIRCPLVTDDLMQDPSKKILLSSQADVIHPLILKVVESFLSHQG 366

Query: 51  AYTLSGVDPEG 61
               S V  +G
Sbjct: 367 YVPFSHVTADG 377

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 36  EVRIKIINTAVCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVAL- 94
           +V IK+    VC +D +  +G       P V GHE  G +  +G   ++    D  V + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 95  -YTAECGKCKFCLSGKTNLC 113
             T  C KC  C  G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 1/61 (1%)

Query: 46  VCHTDAYTLSGVDPEGLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFC 105
           V  T  +TL G      F         G+++  G  V   K  D +V+LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

Query: 106 L 106
            
Sbjct: 832 F 832

>Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)
          Length = 212

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 193 QKGDTVAVFGAGT-VGLSVVQGAKS-RGASKIIVVDINNDKKEWSAEFGATDFVNPSELP 250
           Q+   V ++G  T VG  V+Q AK   G +KIIVV     +K+   E+GA +  +  +  
Sbjct: 9   QRDHPVLIWGGATAVGQHVIQLAKKLNGFTKIIVVASQKHEKQLK-EYGADELFDYHD-- 65

Query: 251 EGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSII 296
              D+V + ++     + +  DC  NV+ ++   +        +II
Sbjct: 66  --ADVVEQ-IKKKYKNIPYLVDCVANVDTLQQVYKCAADELDATII 108

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
           {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 49/115 (42%), Gaps = 3/115 (2%)

Query: 5   GKPITCQAAVAY-EAAKPLVVEEIVVDPPKAHEVRIKIINTA-VCHTDAYTLSGVDPEGL 62
           GKP+T Q   A+ E  + + V+E + D   +  +  K      V  T  +TL G      
Sbjct: 825 GKPMTKQDTTAFVEGLRSISVKEAIQDADCSGWMSKKGGGAMGVWKTRYFTLHGTR-LSY 883

Query: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVR 117
           F         G+++  G  V   K  D +++LY A  GK ++C      L GS +
Sbjct: 884 FGNTTDTRERGLIDITGHRVVPAKEDDKLISLYAASTGKGRYCFKLIPPLPGSKK 938

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 26/108 (24%)

Query: 73  GIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRF 132
           G+++     V   K  D +VALY A  GK ++C                  ++P   P+ 
Sbjct: 822 GLIDITAHRVVPAKDDDKLVALYAASTGKGRYCFK----------------LLP---PQP 862

Query: 133 HNKKG----EPLYHFMGCSTFSE---YTVVADVSVVAIDPTAPLDSVC 173
            +KKG    +P  H+    T  E   +      + + ID + P+ S C
Sbjct: 863 GSKKGLTFTQPRVHYFAVETKEEMRAWMAALIKATIDIDTSVPIISSC 910

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 26/108 (24%)

Query: 73  GIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRF 132
           G+++     V   K  D +VALY A  GK ++C                  ++P   P+ 
Sbjct: 810 GLIDITAHRVLPAKEDDKLVALYAASTGKGRYCF----------------KLLP---PQP 850

Query: 133 HNKKG----EPLYHFMGCSTFSE---YTVVADVSVVAIDPTAPLDSVC 173
            +KKG    +P  H+    T  E   +      + + ID + P+ S C
Sbjct: 851 GSKKGLTFTQPRVHYFAVDTKEEMRAWMAALIKATIDIDTSVPIISSC 898

>ZYRO0B00748g Chr2 complement(56195..59824) [3630 bp, 1209 aa] {ON}
           weakly similar to uniprot|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase P16.2.f2.1
          Length = 1209

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 72/168 (42%), Gaps = 27/168 (16%)

Query: 171 SVCLLGCGVTTGYGAAIKT--ANVQKGDTVAVF-----GAGTVG-------LSVVQGAKS 216
           +   +G G+   YG  +K   A  Q+G  ++V      G  T G        +++   K 
Sbjct: 806 TALFVGSGLAAKYGILVKGGGAAFQEGSQISVVCFDKTGTLTKGGAPKISDYAIISNPKM 865

Query: 217 RGASKIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGN 276
           R  +  +V D+  + K   A  G T+F++ +  PEG+  V +  E+   G+    D T  
Sbjct: 866 RAVTAHLVRDLEANSKHPLA-LGVTNFISENFAPEGKTRVPETEEVAGKGMKGRVDLTTE 924

Query: 277 VNVMRDALEACHKGWGQSIIIG----VAAAGKEISTRPFQLVTGRVWK 320
            N + + L        + II+G    +++ G  +++   QL+    WK
Sbjct: 925 NNDIWNELSP------EGIILGNERFMSSNGVSLTSHHLQLLHD--WK 964

>AFR625C Chr6 complement(1570346..1571452) [1107 bp, 368 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR035C
           (RRP43)
          Length = 368

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 2/87 (2%)

Query: 221 KIIVVDINNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVM 280
           + IV+D+N +   +++ FG TD  N S L  G+D ++  VE+ +  L    +       +
Sbjct: 262 RSIVLDLNKNNIAYASGFGVTDLDNESRLEPGEDDMA--VEVPEKILLVDLEGEAEEASI 319

Query: 281 RDALEACHKGWGQSIIIGVAAAGKEIS 307
           +  L       GQ   I +   G  I+
Sbjct: 320 KSTLSLVTSPGGQLTTISLIGGGSRIT 346

>YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON}
           Member of the quinone oxidoreductase family,
           up-regulated in response to the fungicide mancozeb;
           possibly up-regulated by iodine
          Length = 376

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 35/173 (20%)

Query: 142 HFMGCSTFSEYTVVADV--------------SVVAIDPTAPLDSVCLLGCGVTTG----- 182
            F     F+EY+ ++ V               V+   P   L+ V  +   +TT      
Sbjct: 99  RFPSNGAFAEYSAISTVVAYKSPNELKFLGEDVLPAGPVRSLEGVATIPVSLTTAGLVLT 158

Query: 183 --YGAAIK---TANVQKGDTVAVFGAGTVGLSVVQGA-KSRGASKIIVVDINNDKKEWSA 236
              G  +K   +   +KG  +   GA  VG S++Q A K  G +KIIVV     +K    
Sbjct: 159 YNLGLDLKWEPSTPQRKGPILLWGGATAVGQSLIQLANKLNGFTKIIVVASRKHEK-LLK 217

Query: 237 EFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHK 289
           E+GA +  +  ++    D+V + ++     + +  DC  N    +D L+  +K
Sbjct: 218 EYGADELFDYHDI----DVVEQ-IKHKYNNISYLVDCVAN----QDTLQQVYK 261

>AFR675W Chr6 (1683945..1685006) [1062 bp, 353 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL274C
          Length = 353

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 195 GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT-DFVNPSELPEGQ 253
           G TV V G G +G +VVQ  +  G  +II     +++   S+E   + ++V+  EL    
Sbjct: 161 GKTVGVLGMGGIGRAVVQRLRPFGFERIIY----HNRNRLSSELECSCEYVSFEELLAQS 216

Query: 254 DIVSKLVEMTDG 265
           DI+S  V ++  
Sbjct: 217 DILSVNVPLSSA 228

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
            YER114C
          Length = 1555

 Score = 31.2 bits (69), Expect = 6.3,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 73   GIVESVGDNVTTVKPGDHVVALYTAECGKCKFCL 106
            G+++     VT  +  D +V+LY A  GK +FC 
Sbjct: 1270 GLIDITAHRVTPAREDDKLVSLYAASTGKGRFCF 1303

>Skud_77.1 Chr77 (2..769) [768 bp, 255 aa] {ON} YCR102C (REAL)
          Length = 255

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 171 SVCLLGCGVTTGYGAAIK--TANVQKGDTVAVFGAGT-VGLSVVQGAKS-RGASKIIVVD 226
           S+   G  +T   G +++   +  Q+   + ++G  T +G  ++Q AK   G +KIIVV 
Sbjct: 28  SLTTAGLVLTNNLGLSLEWEPSTPQRDHPILLWGGATSLGQLIIQLAKKLNGFTKIIVV- 86

Query: 227 INNDKKEWSAEFGATDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEA 286
            +   +E   E+GA +  +  +     D+V + ++     + +  DC  N N ++   + 
Sbjct: 87  ASRKHEEQLKEYGADELFDYHDF----DVVEQ-IKKKYNNIPYLVDCVANQNTLQQVYK- 140

Query: 287 CHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI----KDYQN 342
           C      + I+ +   G+E   +  + +   + K   +         GG+I     + + 
Sbjct: 141 CAADKLDATIVELTNLGEENVEKENRRLNVTIDKTRLYAIGGHEIPFGGVIFPADPEART 200

Query: 343 GSLKVDEFITNRRPFVEINDAFEELHH 369
            ++K  +FI  R     IND   ++HH
Sbjct: 201 AAIKFVKFINPR-----INDG--KIHH 220

>SAKL0D11242g Chr4 complement(934163..934807) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P08067 Saccharomyces
           cerevisiae YEL024W RIP1 oxidizes ubiquinol at center P
           in the protonmotive Q cycle mechanism transferring one
           electron to cytochrome c1 and generating a low-potential
           ubisemiquinone anion which reduces the low-potential
           cytochrome b-566 heme group Rieske iron-sulfur protein
           of the mitochondrial cytochrome bc1 complex
          Length = 214

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 180 TTGYGAAIK-TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238
           T  +G  +K   NV KG + A F  G++GL    GAKS   + I  +  + D        
Sbjct: 35  TPDFGDYVKENNNVDKGRSYAYFMVGSLGLLSSVGAKSTVETFITTMSASADVLAM---- 90

Query: 239 GATDFVNPSELPEGQDIVSK 258
            A   VN + +PEG+++V K
Sbjct: 91  -AKVEVNLAAIPEGKNVVVK 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,544,046
Number of extensions: 1657278
Number of successful extensions: 4293
Number of sequences better than 10.0: 208
Number of HSP's gapped: 4113
Number of HSP's successfully gapped: 230
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)