Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.307.351ON26026013690.0
TDEL0C019707.351ON2602598981e-122
ZYRO0F11726g7.351ON2512538561e-116
YLR201C (COQ9)7.351ON2602538391e-113
Suva_10.2967.351ON2602538221e-110
TPHA0F029807.351ON2642497951e-106
Skud_12.2657.351ON2602537861e-105
CAGL0A03949g7.351ON2682447711e-103
KNAG0B026207.351ON2652627631e-101
TBLA0E004507.351ON2792307531e-100
KLLA0D12320g7.351ON2502477383e-98
NDAI0E044707.351ON2642637371e-97
SAKL0F11396g7.351ON2542457272e-96
NCAS0E028707.351ON2612627282e-96
Kwal_56.246447.351ON2582487272e-96
KLTH0H01232g7.351ON2572477239e-96
Smik_12.2607.351ON2602467194e-95
KAFR0L014807.351ON2642536804e-89
Ecym_47227.351ON2532486622e-86
ACL147W7.351ON2462456342e-82
Skud_12.4744.246ON1022118721.2
Ecym_72804.54ON339171711.3
TBLA0B029308.855ON30767711.5
TDEL0B020905.711ON64346675.4
KNAG0C003801.31ON54599675.7
YPR019W (MCM4)8.122ON93357676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.30
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   531   0.0  
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   350   e-122
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   334   e-116
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   327   e-113
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   321   e-110
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   310   e-106
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   307   e-105
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   301   e-103
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   298   e-101
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   294   e-100
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   288   3e-98
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   288   1e-97
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   284   2e-96
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   285   2e-96
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   284   2e-96
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   283   9e-96
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   281   4e-95
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   266   4e-89
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   259   2e-86
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   248   2e-82
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...    32   1.2  
Ecym_7280 Chr7 complement(586183..587152,587239..587288) [1020 b...    32   1.3  
TBLA0B02930 Chr2 complement(674860..675783) [924 bp, 307 aa] {ON...    32   1.5  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...    30   5.4  
KNAG0C00380 Chr3 complement(64496..66133) [1638 bp, 545 aa] {ON}...    30   5.7  
YPR019W Chr16 (596750..599551) [2802 bp, 933 aa] {ON}  MCM4Essen...    30   6.1  

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60
           MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN
Sbjct: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60

Query: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTP 120
           ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTP
Sbjct: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTP 120

Query: 121 VEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSE 180
           VEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSE
Sbjct: 121 VEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSE 180

Query: 181 KDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEE 240
           KDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEE
Sbjct: 181 KDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEE 240

Query: 241 YAWYVLMNSINMAKSKAARG 260
           YAWYVLMNSINMAKSKAARG
Sbjct: 241 YAWYVLMNSINMAKSKAARG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  350 bits (898), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 171/259 (66%), Positives = 210/259 (81%), Gaps = 4/259 (1%)

Query: 6   VPKRTAFG---LTRFYHPNPKEYV-PQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNE 61
           + KR   G     R Y P   EY+ P  +  PL YGKDS QYK+LSH+L  SVP +GFNE
Sbjct: 2   ISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61

Query: 62  RAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPV 121
           RAIVNS+N LGYPS++LSVIGSSN PSF HSS ALMELLKF+LV KR  L+E+I L+TPV
Sbjct: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPV 121

Query: 122 EELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEK 181
           ++LPSLE L+IKRL+M+VP+  HLSQL++QLSIPGPFL D S+PELHRL+DDMIYFS+EK
Sbjct: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181

Query: 182 DHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEY 241
           DH DFAWY+KR+ VS AY+SS+LFMAQDRSP Y +TFEFA++KL R+  LG+YYNN EE+
Sbjct: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241

Query: 242 AWYVLMNSINMAKSKAARG 260
           AWY L+++IN+ KS+ ARG
Sbjct: 242 AWYTLLSTINLVKSQLARG 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  334 bits (856), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/253 (62%), Positives = 203/253 (80%), Gaps = 4/253 (1%)

Query: 8   KRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNS 67
           KR      R YHP+  E++    L PL YG DS QY +LSH+L VSVP  GFNERAIV+S
Sbjct: 3   KRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHS 62

Query: 68  INLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSL 127
           +N L YPS++LSVIG+SN+PS LHSS A+MEL+KF+LV KR QLS+D+      EE PSL
Sbjct: 63  LNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS----SEEKPSL 118

Query: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187
           EDL IKRL+++VPI  HLSQL++ +S+PGPF  DT+LPELHRL+DD+IY+S+EKDH DFA
Sbjct: 119 EDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFA 178

Query: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247
           WY+KR+G+S AY+SS+LFMAQD+S  Y +TF+FA+DKL+R M+LG+YYNN EE+ WY L+
Sbjct: 179 WYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLL 238

Query: 248 NSINMAKSKAARG 260
           NSIN+AKS+ ARG
Sbjct: 239 NSINLAKSQMARG 251

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  327 bits (839), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 200/253 (79%), Gaps = 1/253 (0%)

Query: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68
           RT     R YH NP E+V  + + PL YGK+S QYK+LS +L   VPE GF+ER+IV S+
Sbjct: 8   RTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESL 67

Query: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127
           N LGYPSS++S IG+ N+PSF HSSTA+MEL+KF LV KRY+L+E I  D TP  +LPSL
Sbjct: 68  NELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSL 127

Query: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187
           E LL+KRL+MD PIG HLS+L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D A
Sbjct: 128 EHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187

Query: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247
           WYAKR+ VS+ Y+ SKLFMAQD+S  Y +TF FAKDKL R+M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247

Query: 248 NSINMAKSKAARG 260
           +++N+ KS+  RG
Sbjct: 248 STVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  321 bits (822), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 199/253 (78%), Gaps = 1/253 (0%)

Query: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68
           R A    R YH NP E+V  L + PL YGK S QYK+LS +L   VP+ GF ER+IV S+
Sbjct: 8   RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESL 67

Query: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127
           N LGYPSS++S IG+SN+PSF+HSSTA+MELLKF LV KRY+L+E I  D TP  +LPSL
Sbjct: 68  NKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSL 127

Query: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187
           E LL+KRL+MD P+G  L+ L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D A
Sbjct: 128 EHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187

Query: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247
           WYAKR+ VS+ Y+ S+LFMAQD+S  + +TF FAKDKL R+M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247

Query: 248 NSINMAKSKAARG 260
           +++N+ KS+ ARG
Sbjct: 248 STVNLVKSQLARG 260

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  310 bits (795), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/249 (63%), Positives = 200/249 (80%), Gaps = 3/249 (1%)

Query: 15  TRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYP 74
            RF+HP   EYV    L P  Y KDS Q+KILSH++D +V +FGF+ERAI+ ++  L   
Sbjct: 16  ARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIE 75

Query: 75  --SSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDI-PLDTPVEELPSLEDLL 131
             S++LS IGSSN+PSFLHSS ++MELLKFNLV KRY++ E + PL    EELPSLE LL
Sbjct: 76  NQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLL 135

Query: 132 IKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAK 191
           +KRL+MD+PIG H+S  ++QL IPGPFL D++LPELHRLADDMIYFS+EKDH DFAWY+K
Sbjct: 136 LKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSK 195

Query: 192 RMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSIN 251
           R+GVS+AY+SSKLFMAQD S  Y +T +FAKDKL+++M+LGDYYNN EEYAWYVL+NS+N
Sbjct: 196 RLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVN 255

Query: 252 MAKSKAARG 260
           M KS+ +R 
Sbjct: 256 MVKSRMSRA 264

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 195/253 (77%), Gaps = 1/253 (0%)

Query: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68
           R      R YH NP E+V  L + PL YGK S QYK+LS +L   VP+ GF+ER+IV S+
Sbjct: 8   RNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESL 67

Query: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127
           N LGYPSS++S IG+SN+PSF HSSTA+MEL+KF LV KRY+L+E I  D T   +LPSL
Sbjct: 68  NKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSL 127

Query: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187
           E LL+KRL+MD  IG  L+ L++QL++P   L +T++PELHRL+DDMIYFS+E+DH D A
Sbjct: 128 EHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSA 187

Query: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247
           WYAKR+ VS+ Y+ SKLFMAQD+S  + +TF FAK+KL ++M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLM 247

Query: 248 NSINMAKSKAARG 260
           +++N+ KS+ ARG
Sbjct: 248 STVNLVKSQLARG 260

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 184/244 (75%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           R YHP   EYV      PL Y  +S ++K+LSH+++ SVP+ GF E+AIVNS+N +  PS
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135
            +L+ IG+SN+ +FLHSS A+MEL+KF LV KR+++ E I       +LPSLE LL+KRL
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRL 143

Query: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195
           KMDVPI  HL+Q+ AQL +P  F+T+ SLPEL RLADDMIY+S+EKDH DFAWY KR  +
Sbjct: 144 KMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203

Query: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255
           +T Y++SK FMAQD+S  +++T EFA+DKL ++M LGDYYNN EE+ W+ LM+++N+ KS
Sbjct: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263

Query: 256 KAAR 259
           + AR
Sbjct: 264 QMAR 267

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/262 (55%), Positives = 187/262 (71%), Gaps = 5/262 (1%)

Query: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60
           +LKN V +R     TR YHPNP EY     + PL Y  DS Q +IL+H L   VP +GF 
Sbjct: 5   LLKNSVSRRALLS-TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFT 63

Query: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIP---L 117
           ERA++ SI  +GY SS++SV+G+SN+PS  HSS A+MEL+KFNLV KR+ L+E +    L
Sbjct: 64  ERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGL 123

Query: 118 DTPVEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYF 177
            +P   LPSLE LL+KRL+MDVP+   L  L  QL++P  F+ + ++PEL RL+DDMIYF
Sbjct: 124 GSPAA-LPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYF 182

Query: 178 SSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNN 237
           S+EKDH D AWY+KR+GVS AY +SKLFMAQD S    DT EFA+DKL RIM LG+YYNN
Sbjct: 183 SNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNN 242

Query: 238 AEEYAWYVLMNSINMAKSKAAR 259
            EEYAWY +M ++N AK+  +R
Sbjct: 243 VEEYAWYSIMTTVNRAKAGFSR 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  294 bits (753), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 180/230 (78%), Gaps = 2/230 (0%)

Query: 31  LPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPSSILSVIGSSNTPSFL 90
           L PLLYGKDS QY+IL  ++  SVP FGF ERAI+NSIN LGY SS++SV+GSSNT + L
Sbjct: 52  LEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNSSMISVLGSSNTHNIL 111

Query: 91  HSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRLKMDVPIGPHLSQLIA 150
           HSS A++ELLKFNLV+KR +LSE I  D   ++LPSLE LL+KRL+MD  I   L+++I 
Sbjct: 112 HSSPAVLELLKFNLVSKRLKLSEGI--DPETKDLPSLEYLLLKRLQMDKAIQSRLNEMIT 169

Query: 151 QLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDR 210
           +LSIPG FL +TS+PEL RL+DDMIYFS+EKDH D AWY+KR+ VST Y++S++FMAQD 
Sbjct: 170 KLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVSTTYIASQIFMAQDT 229

Query: 211 SPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKSKAARG 260
           S     T EFA+DKL ++M LG+YYNN EE+ W+ LM S+N+ KS+ AR 
Sbjct: 230 SVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQLARS 279

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  288 bits (738), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 190/247 (76%), Gaps = 1/247 (0%)

Query: 14  LTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGY 73
            TR YHPN  E+     + PL YG DS Q+K+LS++L+  VP++GFNERAIV S+N LG 
Sbjct: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGM 64

Query: 74  PSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIK 133
            SS LSV+GSSN+PSF + S +++EL+KF+LV+KR QL  D+PLD+  + LP L+ L ++
Sbjct: 65  GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSD-KPLPDLKTLFLQ 123

Query: 134 RLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRM 193
           RLK++  + PHLSQL++ +S+PG FL  T+L ELH+L DDMI++S+E+DH DFAWY+KR+
Sbjct: 124 RLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183

Query: 194 GVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMA 253
            +STAY+SS+LFMAQD+S  + +T EFA+ KL ++ +LG  YNN EEY W+ L++SIN+A
Sbjct: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243

Query: 254 KSKAARG 260
           KS+  RG
Sbjct: 244 KSQITRG 250

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  288 bits (737), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 186/263 (70%), Gaps = 3/263 (1%)

Query: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60
           +L   + K     + R +H N  EY    TL PL Y KDS QYKILS++L+  VP+ GF 
Sbjct: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61

Query: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHS-STALMELLKFNLVAKRYQLSEDIP--L 117
           + AI +S+N L   SS+ SV+GSSN+PS   S S A+MELLKF LV+KRYQL+E+I   +
Sbjct: 62  DEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYI 121

Query: 118 DTPVEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYF 177
           +T  ++LPSLE LLI+RLKMD P+   LS L  QL IP P L + +LPEL  L+DD+IYF
Sbjct: 122 ETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYF 181

Query: 178 SSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNN 237
           S+EKDH D AWYAKR+GVS AY+SSKL+M ++    +  T +FAKDKL RIM LG+YYNN
Sbjct: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241

Query: 238 AEEYAWYVLMNSINMAKSKAARG 260
            EEYAWY LM S+N+ K++ ARG
Sbjct: 242 TEEYAWYTLMVSMNLVKARLARG 264

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 194/245 (79%), Gaps = 2/245 (0%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           R YHPN  E+     LPPL+Y KDS Q+KIL+++LD  VP++GFNERA+ +S + LGY S
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135
           S LSV+G+SN+PSF +SS A++ELLKF+LV+KRY L++ +   T   E PSLE+L +KRL
Sbjct: 72  SFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTL--ESPSLENLFLKRL 129

Query: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195
           +M+ PI  HLSQL++ L++PG FL + ++PELHRL+DDM+YFS+E DH DFAWY+KR+ +
Sbjct: 130 EMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAI 189

Query: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255
           STAY+SS+LFMAQD+S  Y DT +FAK+KLK I +LG+ YNN EEYAWY L++SI++AKS
Sbjct: 190 STAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKS 249

Query: 256 KAARG 260
           +  R 
Sbjct: 250 QMTRS 254

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 154/262 (58%), Positives = 194/262 (74%), Gaps = 3/262 (1%)

Query: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60
           ML   + K+  F   R YHP+ KEYV   TL PL Y K+S QYKILS++L   VP+ GF 
Sbjct: 1   MLNRSILKKGLFSY-RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59

Query: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHS-STALMELLKFNLVAKRYQLSEDI-PLD 118
           E+AI +S+N LG+ SS+LSVIG+SN+P+   S S A+MEL+KF LV+KRY+L+E++ P  
Sbjct: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119

Query: 119 TPVEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFS 178
           TP  ELPSLE LL+KRL+MD  IG  +  L A+L+ P  FL D +LPELHRL+DDMIYFS
Sbjct: 120 TPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179

Query: 179 SEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNA 238
           +EKDH D AWY KR+GVS AY+SSKL+MAQD S  + DT  FAKDKL RIMKLG+YYNN 
Sbjct: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239

Query: 239 EEYAWYVLMNSINMAKSKAARG 260
           EEYAWY+ M S N+ +++ AR 
Sbjct: 240 EEYAWYMFMVSTNLVRARLARS 261

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 180/248 (72%), Gaps = 4/248 (1%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           RFY PNP EY     L PL YG  S Q+K+L H+L   VP +GFNERA+V S+N LG  S
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD---TPVEELPSLEDLLI 132
            +LS IG+ N+P  L+SS A++EL+KF+LV KRY L++D+ +    +P E  P+LE L  
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEP-PALETLFH 130

Query: 133 KRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKR 192
           KRL++++PI  H++QL+A L++PG FL  ++LPELHRL+DDMIYFS E D  DFAWY+KR
Sbjct: 131 KRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKR 190

Query: 193 MGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINM 252
             +S A++SS+LFMAQD+SP Y DTFEFA DKL  + KLG YY N EEY WY L+ S+N+
Sbjct: 191 AAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNL 250

Query: 253 AKSKAARG 260
           AKS+  R 
Sbjct: 251 AKSQITRS 258

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  283 bits (723), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 183/247 (74%), Gaps = 2/247 (0%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           R YHP+  E+    +  PL YG  S Q+K+L H+L+  VP +GFNERA+V S+N L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDI-PLDTPV-EELPSLEDLLIK 133
           S+LSVIG+SN+PSFL++S A++EL+KF+LV KRY L++++ P  T    E P+LE L  +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 134 RLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRM 193
           RL+++ PI PHL+QL++ LSIPG FL  T+LPELHRL+DDM+YFS E D  DFAWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 194 GVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMA 253
            +S A++SS+LFMAQDRS  Y DTFEFA +KL  + KLG YYNN EEY WY L+ S+N+A
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 254 KSKAARG 260
           KS+  R 
Sbjct: 251 KSQLTRS 257

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  281 bits (719), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 198/246 (80%), Gaps = 1/246 (0%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           R YHPNP E+V    + PL YGK+S QYK+LS +L+  VP+ GF+ER+IV S+N LGYPS
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSLEDLLIKR 134
           S++S I +SN+PSF HSSTA+MEL+KF LV KRY+L+E I  D TP  +LPSLE LL++R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHLLLRR 134

Query: 135 LKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMG 194
           L+MD PIG  LS+L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D AWYAKR+ 
Sbjct: 135 LEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 195 VSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAK 254
           VS+ Y+ SKLFMAQD+S  Y DTF+FAK KL R+M+LG+YYNN EE+AWY LM+++N+ K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 255 SKAARG 260
           S+  RG
Sbjct: 255 SQLVRG 260

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  266 bits (680), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 143/253 (56%), Positives = 185/253 (73%), Gaps = 5/253 (1%)

Query: 8   KRTAF-GLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVN 66
           + T F  L R YHP   EYV   T+ PL Y  DS Q KILSHSL   VP  GFNE++I+ 
Sbjct: 15  RTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILK 74

Query: 67  SINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPS 126
           SIN LGY SS++SVIG+SN+PSF HSS A++EL+K+NLV+KR +L++D    T      +
Sbjct: 75  SINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKD----TNDNTTTT 130

Query: 127 LEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDF 186
           L++LL+KRL+MD+PI   L  L AQL+ PG F+ D SLPEL +LADDMI+FS+EKDH D 
Sbjct: 131 LKELLLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDM 190

Query: 187 AWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVL 246
           AWY+KR+ VS AY++SK+FM QD S  +  T +FA DK+ R+M LG+YYNN EEYAW+ L
Sbjct: 191 AWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTL 250

Query: 247 MNSINMAKSKAAR 259
           MNSIN+ KS+ +R
Sbjct: 251 MNSINLVKSQFSR 263

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  259 bits (662), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 178/248 (71%), Gaps = 6/248 (2%)

Query: 13  GLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLG 72
           G  RFYH N  EY    TL PL+YG+ S QYK+L+ +L+  VP  GF + AIV++ N LG
Sbjct: 12  GFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELG 71

Query: 73  YPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLI 132
           Y S++L+ IG++N+P+  + ST++ EL+KF+LV KRY L ED       E   +LE+L +
Sbjct: 72  YNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED------QEGTKTLEELFL 125

Query: 133 KRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKR 192
           KRL+ +  +GPHL ++++ L+IPG FL +T LPEL +LADDMIY+S+EKD  D AWY+KR
Sbjct: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185

Query: 193 MGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINM 252
           + VS AY+S++LFMA+D SP +  T EFAK ++ +I ++G  YNN EE+AW+ L+ ++N+
Sbjct: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245

Query: 253 AKSKAARG 260
           A+S+  RG
Sbjct: 246 ARSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  248 bits (634), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 169/245 (68%), Gaps = 5/245 (2%)

Query: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75
           R YHPN  E+     L PL Y +DS QYK+L  +L+  VP  GFNERAIV +   LGY S
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135
           ++LS + + N+P+ L+  +A++EL+KF+LV KR  L+     D   +   S+E L ++R+
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALA-----DAAAQGNVSMEQLFLQRV 121

Query: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195
           + D P+   L+QL++ LS+PG FL +T++PEL RL+DD+IY+S EKDHPD AWY+KR  V
Sbjct: 122 EADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAV 181

Query: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255
           + AY+S+ LFMA+DRSP   +T  FA+ +L+++  LG  YNN EE+AWY L+ ++N+ KS
Sbjct: 182 AMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKS 241

Query: 256 KAARG 260
           +  RG
Sbjct: 242 QLTRG 246

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 25/118 (21%)

Query: 123 ELPS-LEDLLIKRLKMDVPIGPHLSQLIAQLSIP-GPFLTDTSLPELHRLADDMIYFSSE 180
           ELP+ L+ LLI+  K D        +  A L +  G F    SLP L    + +++  SE
Sbjct: 78  ELPNKLKALLIQDPKAD--------KAAASLDVNIGAFEDPESLPGLAHFCEHLLFMGSE 129

Query: 181 K--DHPDFAWY-AKRMGVSTAYMSSK------------LFMAQDRSPGYVDTFEFAKD 223
           K  D  +++ Y +K  G S AY +S+            LF A DR  G+     F KD
Sbjct: 130 KFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEINHQHLFGALDRFAGFFSCPLFNKD 187

>Ecym_7280 Chr7 complement(586183..587152,587239..587288) [1020 bp,
           339 aa] {ON} similar to Ashbya gossypii AGL046C
          Length = 339

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 33/171 (19%)

Query: 104 LVAKRYQLSEDIPLDTPVEELPSLEDLLIKRLKMDVPIGPHLSQL-----------IAQL 152
           L+ K   LSED  LDT  + +    D L+      V +  +L+ +           I Q 
Sbjct: 120 LIHKVDSLSEDFKLDTQRDIMQRTGDELLDLGLEGVQVSFYLTSIFDHSIYEAFSRIVQK 179

Query: 153 SIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSP 212
            +P        LP L  + D+++  S  K    F +           ++SK+++A D SP
Sbjct: 180 LVP-------ELPFLENMLDNLVQHS--KIEKCFLFD----------INSKIYVATDSSP 220

Query: 213 GYVDTFEFAKDKLKRIMKLGDYYNNAEEY---AWYVLMNSINMAKSKAARG 260
             + T+E   + +   + L D Y N EE    +   L+N + +   +  RG
Sbjct: 221 VDIQTYEVCAEFVDVTIDLQDLYKNNEEREMKSVSTLVNGVVIYLRQMIRG 271

>TBLA0B02930 Chr2 complement(674860..675783) [924 bp, 307 aa] {ON}
           Anc_8.855 YML121W
          Length = 307

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 11  AFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINL 70
           A  L + Y P+ K +V    +  +   K S+ ++I+   L ++  EFGF         NL
Sbjct: 107 ALKLLKKYSPDAKIFVLLHKMDLVQLDKRSQLFQIMMEKLQLTSKEFGFP--------NL 158

Query: 71  LGYPSSI 77
           +G+P+SI
Sbjct: 159 VGFPTSI 165

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 97  MELLKFNLVAKRYQLSEDIPL----DTPVEELPSLEDLLIKRLKMD 138
           M  +K+N   ++ +++ D+ L    DTP  +LPS EDLL K  K D
Sbjct: 25  MGAVKYNDSVEQRRIANDVALQSAVDTPNVKLPSREDLLSKLSKTD 70

>KNAG0C00380 Chr3 complement(64496..66133) [1638 bp, 545 aa] {ON}
           Anc_1.31 YDR518W
          Length = 545

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 50/99 (50%), Gaps = 12/99 (12%)

Query: 7   PKRTAFGLTRFYHP---NPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERA 63
           PK+  F   ++Y P   + K+  P       +Y +D    K  + ++ V+  +   N+  
Sbjct: 401 PKKDVF--VKYYAPWCGHCKKLAPIFEEMADIYAQD----KTAAGNVVVAEVDCTLND-- 452

Query: 64  IVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKF 102
            ++ ++++G+P+ IL   G ++TP     S +L ++++F
Sbjct: 453 -ISDVDIVGFPTMILYPAGKNSTPVVYEGSRSLEDMMQF 490

>YPR019W Chr16 (596750..599551) [2802 bp, 933 aa] {ON}
          MCM4Essential helicase component of heterohexameric
          MCM2-7 complexes which bind pre-replication complexes
          on DNA and melt DNA prior to replication; forms an
          Mcm4p-6p-7p subcomplex; shows nuclear accumulation in
          G1; homolog of S. pombe Cdc21p
          Length = 933

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 20 PNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPSS 76
          PNP    PQL+ P L Y   S Q  I   +   ++ +   N RA + S + L +PSS
Sbjct: 21 PNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEGNIRAAIGS-SPLNFPSS 76

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,897,046
Number of extensions: 1291821
Number of successful extensions: 3827
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3913
Number of HSP's successfully gapped: 40
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)