Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.297.352ON1071075374e-72
TPHA0F029907.352ON1071064151e-53
KAFR0L014907.352ON1071063916e-50
Suva_10.2957.352ON1141073786e-48
TDEL0C019607.352ON1071063733e-47
YLR200W (YKE2)7.352ON1141073717e-47
Smik_12.2597.352ON1141073701e-46
KLLA0D12298g7.352ON1151013657e-46
ZYRO0F11748g7.352ON1091063631e-45
NCAS0E028607.352ON1051053612e-45
Skud_12.2647.352ON1141023613e-45
KLTH0H01210g7.352ON1131003552e-44
TBLA0E004407.352ON1151003535e-44
Kwal_56.246487.352ON1131053501e-43
KNAG0B026107.352ON1191023483e-43
NDAI0E044607.352ON1061033457e-43
Ecym_47217.352ON1071023412e-42
CAGL0A03971g7.352ON1061003403e-42
ACL146C7.352ON1071023301e-40
SAKL0F11418g7.352ON1151033222e-39
NCAS0B025108.484ON780108670.72
KNAG0M02650singletonON57447660.94
Smik_4.7723.86ON101260660.98
CAGL0M08448g1.184ON92177661.2
KNAG0B060104.237ON111728651.2
TBLA0A097506.74ON78148651.5
ZYRO0F12892g3.325ON103673641.9
KLTH0G13750g8.259ON1399106632.7
Ecym_5271na 1ON30646622.9
CAGL0G02497g5.702ON178059624.0
KLTH0C05346g7.447ON10254585.6
KLLA0C14905g5.582ON35442605.9
KNAG0D035204.113ON103081606.0
NDAI0G044402.653ON170857606.1
KNAG0C050605.414ON1040103598.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.29
         (107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   211   4e-72
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   164   1e-53
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   155   6e-50
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   150   6e-48
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   148   3e-47
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   147   7e-47
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   147   1e-46
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   145   7e-46
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   144   1e-45
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   143   2e-45
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   143   3e-45
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   141   2e-44
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   140   5e-44
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   139   1e-43
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   138   3e-43
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   137   7e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   135   2e-42
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   135   3e-42
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   131   1e-40
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   128   2e-39
NCAS0B02510 Chr2 complement(418829..421171) [2343 bp, 780 aa] {O...    30   0.72 
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...    30   0.94 
Smik_4.772 Chr4 complement(1359469..1362507) [3039 bp, 1012 aa] ...    30   0.98 
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    30   1.2  
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    30   1.2  
TBLA0A09750 Chr1 complement(2395504..2397849) [2346 bp, 781 aa] ...    30   1.5  
ZYRO0F12892g Chr6 complement(1050681..1053791) [3111 bp, 1036 aa...    29   1.9  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    29   2.7  
Ecym_5271 Chr5 complement(556773..557693) [921 bp, 306 aa] {ON} ...    28   2.9  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    28   4.0  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    27   5.6  
KLLA0C14905g Chr3 (1299212..1300276) [1065 bp, 354 aa] {ON} simi...    28   5.9  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    28   6.0  
NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa]...    28   6.1  
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    27   8.6  

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  211 bits (537), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107
           QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  164 bits (415), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (89%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MSD+A KYQ +QGELEE+I+AR++LETQLQENKIVN+EF  L EDT +YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106
           QFEA+SNVEKRLEFIE EIK+CE+NIK+KQ EL+KLR ELMK RG 
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  155 bits (391), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 94/106 (88%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+LA +YQK+Q ELEE+IVAR++LETQLQENKIVN+EF+ LKE+TQVYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106
           Q EAR NV+KRLEFIE EI +CE NIKSKQTE+  +R+EL+K R G
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  150 bits (378), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 78/107 (72%), Positives = 89/107 (83%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+L  KYQ +Q ELEE IVAR++LETQLQENKIVNEEF+ LKEDT VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107
           Q EAR NVEKRLEFIE EIK+CE NI+ KQ EL ++R+EL+K    A
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAA 107

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  148 bits (373), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 88/106 (83%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MSDLA  YQ +Q ELE +++AR++LETQLQENKIV+EEF  LKEDTQVYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106
           Q EA SNV KRLEFI+ EI +CE+N+K+KQ E  KLR EL+K RG 
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  147 bits (371), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+L  KYQ++Q ELEE IVAR++LETQLQENKIVNEEF+ L+EDT VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107
           Q EAR+NV+KRLEFIE EI +CE NI+ KQ EL K+R EL+K    A
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTA 107

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  147 bits (370), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+L  KYQ +QGELEE IVAR++LETQLQENKIVNEEF+ L+E+T VYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107
           Q EAR NV+KRLEFIEAEI +CE NIK KQ +L K+R++L+K    A
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAA 107

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  145 bits (365), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%)

Query: 5   ANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFEA 64
             KY K+QGELEE+IVAR++LETQLQENKIV++EF  LK+D  VYKLTG VLLPVEQFEA
Sbjct: 7   TQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEA 66

Query: 65  RSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105
           + NVEKRLEFIE EIK+CE NIKSKQ EL   R ELMK R 
Sbjct: 67  KGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  144 bits (363), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 90/106 (84%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+LA +YQK+QGELE  IVAR++LETQLQENKIV++EF GLK D++VYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106
           Q +AR+NV KRLEFI+ EI +CE+NIK KQ E  +++ EL+K R G
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  143 bits (361), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 73/105 (69%), Positives = 88/105 (83%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           M+DL  +YQ +Q ELE  I+AR++LETQLQENKIV +EFE L ++T+VYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105
           Q EARSNVEKRLEFI++EI KCE NIK KQ EL K+R E++K RG
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG 105

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  143 bits (361), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 87/102 (85%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+L  +YQ +Q ELEE IVAR++LETQLQENKIVNEEF+ + +DT VYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102
           Q EAR NV+KRLEFIE EIK+CE NI+ KQ EL K+R+EL+K
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIK 102

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  141 bits (355), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%)

Query: 3   DLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQF 62
           DL   Y   Q ELEE+++AR++LETQLQENKIV +EF+GL+E+TQVYKLTGNVLLPVEQF
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102
           EA+SNV KRLEFI AEI +CE+NIK+KQ  L KLR EL++
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  140 bits (353), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%)

Query: 2   SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQ 61
           ++LA KYQ  Q ELE  IV R++LETQLQENKIVN+EFE LKE+T+V+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  FEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELM 101
            EARSN++KRLEFI+ EI +CE NIK+KQ E+ K+R ELM
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 85/105 (80%)

Query: 3   DLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQF 62
           +L   Y   Q ELEE++ AR++LETQLQENKIV +EF+ LKE+TQVYKLTG VLLPVEQF
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107
           EA+SNV KRLEFI  EIK+CEDNIK+KQ+ L KLR EL++ +  +
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 85/102 (83%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
           MS+ A KYQK Q  LEE+IVAR++LETQLQENKIV EEF+ LKED++VYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102
           Q EAR+NV+KRLEFI  EI +CE+NIK KQ  L  LR ELMK
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMK 102

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  137 bits (345), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%)

Query: 2   SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQ 61
           S+L +KYQ +QGELE++I+AR++LETQLQENKIV EEF  L  ++QVYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  FEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGR 104
            EA SNV+KRLEFI+ EI +CE+NIK+KQ EL+ +R E++K R
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  135 bits (341), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 83/102 (81%)

Query: 4   LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63
           +A KY ++QGELE++IV R++LETQLQENKIVNEE + LKED QVYKLTG VLLPVE  E
Sbjct: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65

Query: 64  ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105
           A SNV KRLEFI+ EI +CE NIK+KQ EL + RDEL+K R 
Sbjct: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  135 bits (340), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 84/100 (84%)

Query: 2   SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQ 61
           ++L  KYQ +Q ELEE++ AR++LETQLQENKIVNEEF  LKEDT VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  FEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELM 101
            +A++NV+KRLEFI  EIK+CEDNI+SKQ EL  +R +L+
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  131 bits (330), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 81/102 (79%)

Query: 4   LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63
           +A KY ++QGELEE++V R++LETQLQENKIVNEE + L+ +TQVYKLTG VLLPVEQ E
Sbjct: 6   VATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEE 65

Query: 64  ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105
           A  NV KRLEFIE EI++CE NIK KQ E+   R  L+K RG
Sbjct: 66  AEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  128 bits (322), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 87/103 (84%)

Query: 4   LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63
           L+ +Y  +Q ELE++++AR++LETQLQENKIV +EF+ L++++QVYKLTG VLLPVEQ E
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106
           A+ NVEKRL+FI+ EI +CE+NIK KQT+L +LR+EL++ R  
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>NCAS0B02510 Chr2 complement(418829..421171) [2343 bp, 780 aa] {ON}
           Anc_8.484 YDR251W
          Length = 780

 Score = 30.4 bits (67), Expect = 0.72,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDT--QVYKLTGNVLLP 58
           +  L NK  ++Q  LE  I     L  Q+++N   + + EG+ + +      +   + LP
Sbjct: 414 LRQLTNKISQLQNNLETQIQMNSNLRNQIRDNDDNSRDIEGIADTSLLSTSSMEQPLNLP 473

Query: 59  VEQFEARS---NVEKR-LEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102
                  S   NV+ R L+  E E+++ E  +K K+ EL +   + +K
Sbjct: 474 NTTINGNSSTDNVKDRYLDDREQELQRKELQLKQKEAELQRTLQQQVK 521

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa]
          {ON} 
          Length = 574

 Score = 30.0 bits (66), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 27 TQLQENKIVNEEFEGLKEDTQ-----VYKLTGNVLLPVEQFEARSNV 68
          T L+ NK V+ E+   K DT        +LTG +  PVE  + RSN+
Sbjct: 2  TDLEVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNL 48

>Smik_4.772 Chr4 complement(1359469..1362507) [3039 bp, 1012 aa]
           {ON} YDR495C (REAL)
          Length = 1012

 Score = 30.0 bits (66), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 22  RRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFEARSNVEKRLEFIEAEIKK 81
           R   +  ++E  +  ++F G K   ++YK+ G  L P+   +   N E  + FIE  IKK
Sbjct: 646 RESYDEIIKEIHLHGDDFPGNKLLIEIYKVKGEYLEPLSLLKKAKNYESLVSFIEENIKK 705

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 16/77 (20%)

Query: 26  ETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFEARSNVEKRLEFIEAEIKKCEDN 85
           + +++EN+++N +F        VYK+         +F  +S  E  L+ I+  IKK E+ 
Sbjct: 378 QYRVKENEVINSQF--------VYKI-------YPKFAEKSPTE-YLKEIKELIKKIENG 421

Query: 86  IKSKQTELNKLRDELMK 102
            +S + E  +L +ELMK
Sbjct: 422 EESLEPEAIRLTEELMK 438

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1117

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 79  IKKCEDNIKSKQTELNKLRDELMKGRGG 106
           IKKCE+NI++    + +L DEL +  GG
Sbjct: 407 IKKCEENIRNLDVSIKRLEDELQREMGG 434

>TBLA0A09750 Chr1 complement(2395504..2397849) [2346 bp, 781 aa]
           {ON} Anc_6.74 YOR179C
          Length = 781

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 59  VEQFEARSNVEKRLEF----IEAEIKKCEDNIKSKQTELNKLRDELMK 102
           V  +  R+ VE  LEF    I   I    D IK+K+ E+ K++DE +K
Sbjct: 464 VHVYNPRNGVEVTLEFKGTHIAKAIGSIVDQIKNKEAEIQKIKDEKLK 511

>ZYRO0F12892g Chr6 complement(1050681..1053791) [3111 bp, 1036 aa]
           {ON} similar to uniprot|P38065 Saccharomyces cerevisiae
           YBL037W APL3 clathrin Associated Protein complex Large
           subunit Large subunit of clathrin associated protein
           complex
          Length = 1036

 Score = 29.3 bits (64), Expect = 1.9,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 7   KYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNV------LLPVE 60
           K  KI+  +E V++   QLE    + ++    FE L    Q+ KL GNV      L P+ 
Sbjct: 607 KLYKIEPRIETVVIKFFQLELNSLDIELQTRSFEYLNL-VQLSKLNGNVELLEAILAPMP 665

Query: 61  QFEARSN-VEKRL 72
            F  +SN + KRL
Sbjct: 666 PFNTKSNPLLKRL 678

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
           {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
           YLR086W SMC4 Subunit of the condensin complex which
           reorganizes chromosomes during cell division forms a
           stable complex with Smc2p that has ATP-hydrolyzing and
           DNA- binding activity and promotes knotting of circular
           DNA potential Cdc28p substrate
          Length = 1399

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 1   MSDLANKYQKIQGELEEVIVARR-QLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPV 59
           M D     +  + E+E  I  RR ++++ L E K+  +    LK++ ++ + + + L+  
Sbjct: 846 MEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLI-- 903

Query: 60  EQFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105
              EA S    RL+ ++AE K  E  +KSK+ ++ +L++++MK  G
Sbjct: 904 ---EANS----RLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGG 942

>Ecym_5271 Chr5 complement(556773..557693) [921 bp, 306 aa] {ON}
           similar to Ashbya gossypii AER204WA
          Length = 306

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 3   DLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQV 48
           DL    + I+ +L+  I A+R LE +L+E   +N E E  K D ++
Sbjct: 155 DLTKTVKDIETKLQACINAKRSLEKRLKETSDINSELEREKMDLEI 200

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 2    SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60
            SDL N YQ I+G+LE++ + R    T   E K   +E + + +D Q+ +   N LLP++
Sbjct: 1219 SDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICR---NELLPLQ 1274

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 26.9 bits (58), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 1  MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGN 54
          M +    YQK++ EL+E +V R  LE Q   ++I  E F     D +   LTGN
Sbjct: 1  MDEAHQHYQKLKQELQEALVDRETLEKQW--DQIQQEIF-----DKESAYLTGN 47

>KLLA0C14905g Chr3 (1299212..1300276) [1065 bp, 354 aa] {ON} similar
           to uniprot|Q03703 Saccharomyces cerevisiae YML037C
           Hypothetical ORF
          Length = 354

 Score = 27.7 bits (60), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 58  PVEQFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDE 99
           P +  E  SN +   E + ++  K    ++SKQ  LNKLRD+
Sbjct: 178 PKKPLEPHSNKKSTNEILRSKAMKSAHELRSKQILLNKLRDK 219

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 27.7 bits (60), Expect = 6.0,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 26  ETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFEARSNVEKRLEFIEAEIKKCEDN 85
           + Q++E +++    + L   +QVYK    +L PV+Q     +V K L+ +    ++CE+N
Sbjct: 855 QLQVKEPQLIACTRDILDTKSQVYKY---LLTPVQQSGFHISVRKLLKDLGVVGQQCEEN 911

Query: 86  IKSKQTELNKLRDEL-MKGRG 105
              K T + K+ D   MK  G
Sbjct: 912 --EKGTPMAKMMDGCGMKNEG 930

>NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa] {ON}
            Anc_2.653 YKL014C
          Length = 1708

 Score = 27.7 bits (60), Expect = 6.1,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 34   IVNEEFEGLKEDTQVYKLTGNVLLPVEQFEARSNVEKRLEFIEAEIKKCEDNIKSKQ 90
            +++E  E LKE+    K+   +L   +Q   + N++   EF+E  +K+C +N+++ Q
Sbjct: 1019 VISENLETLKENKYAKKIAIGILEKNQQ--EQENIK---EFVELCVKQCYENLRTPQ 1070

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
           Anc_5.414 YDR356W
          Length = 1040

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 52/103 (50%), Gaps = 18/103 (17%)

Query: 7   KYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDT-QVYKLTGNVLLPVEQFE-- 63
           +Y  IQ E +E      Q++T  + N I N +   L E + ++ ++  + LL + Q E  
Sbjct: 421 QYSDIQKEFKEY-----QIDTDRRLNNIDNSDKRHLVEHSKEIERVKADHLLEMTQLEKN 475

Query: 64  ----------ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKL 96
                     +++ + ++LE  E+E+ KC++ + SK+ E  +L
Sbjct: 476 YDSLLTELNSSKAELSEKLEGAESELAKCKEELNSKKIEHERL 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,761,670
Number of extensions: 433111
Number of successful extensions: 2910
Number of sequences better than 10.0: 375
Number of HSP's gapped: 2880
Number of HSP's successfully gapped: 439
Length of query: 107
Length of database: 53,481,399
Length adjustment: 77
Effective length of query: 30
Effective length of database: 44,652,117
Effective search space: 1339563510
Effective search space used: 1339563510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)