Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_530.277.354ON50845124100.0
Kwal_56.246547.354ON50744922120.0
KLLA0D12254g7.354ON51345122030.0
KLTH0H01166g7.354ON50744921940.0
TPHA0F030107.354ON50945121890.0
Smik_12.2577.354ON50845421890.0
Skud_12.2627.354ON50544321880.0
CAGL0A04015g7.354ON50844621840.0
YLR197W (NOP56)7.354ON50444321840.0
Suva_10.2937.354ON50544121800.0
TBLA0E020807.354ON51343921800.0
SAKL0F11462g7.354ON49843521720.0
NCAS0A141707.354ON51043521740.0
ZYRO0F11792g7.354ON51344921670.0
NDAI0A018807.354ON50343521570.0
ACL144C7.354ON54943921380.0
TDEL0C019407.354ON51043621330.0
KAFR0L015107.354ON50044821270.0
KNAG0B025907.354ON49944321230.0
Ecym_47197.354ON51345521170.0
ZYRO0F12518g8.787ON5194198541e-108
KLTH0H15334g8.787ON5114108521e-108
KNAG0J006508.787ON5244138511e-107
KNAG0G031908.787ON5234108501e-107
KAFR0D015808.787ON5014148391e-106
TBLA0B028308.787ON5174108391e-106
KAFR0B035408.787ON4994108321e-105
Smik_15.4918.787ON5164088341e-105
NDAI0E005508.787ON5234508331e-105
YOR310C (NOP58)8.787ON5114088321e-105
Kpol_1010.58.787ON5144108321e-105
TDEL0B011108.787ON5044108311e-105
Skud_15.4788.787ON5124088311e-105
Suva_8.3618.787ON5054108301e-105
TPHA0G011608.787ON5144088261e-104
TPHA0I006508.787ON5404138251e-103
SAKL0B05874g8.787ON5134108221e-103
NCAS0B008708.787ON5154128131e-102
KLLA0F08613g8.787ON5114108101e-102
AFR328C8.787ON5134118041e-101
Ecym_14898.787ON5144137961e-99
Kwal_34.158948.787ON5124107952e-99
CAGL0I09790g8.787ON5134147734e-96
KNAG0B011403.429ON4922121812e-13
TDEL0F031103.429ON4342471793e-13
TBLA0C023203.429ON5112861767e-13
TPHA0D039303.429ON4712341759e-13
ZYRO0C12386g3.429ON4442291741e-12
Kwal_23.39953.429ON4742151732e-12
KAFR0K015303.429ON5062211624e-11
NDAI0G012903.429ON4961991615e-11
Kpol_1018.1383.429ON4932391608e-11
YGR091W (PRP31)3.429ON4942001572e-10
ADR032W3.429ON4392031543e-10
Skud_7.3903.429ON4952231501e-09
NCAS0E011603.429ON4792541473e-09
Suva_7.3743.429ON5131991473e-09
Smik_6.1773.429ON4822091402e-08
Ecym_44493.429ON4622191331e-07
KLLA0D14883g3.429ON4672231214e-06
SAKL0F06050g3.429ON4732211162e-05
KLTH0F12034g3.429ON5242601152e-05
CAGL0G03025g3.429ON479991081e-04
Kpol_1063.57.208ON27654731.8
Smik_2.3198.573ON855130697.2
Suva_4.4308.573ON855130698.1
Kwal_26.87518.668ON84834698.1
Skud_2.3058.573ON855130698.9
YBR179C (FZO1)8.573ON855130698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_530.27
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   932   0.0  
Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   856   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   853   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   849   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   847   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   847   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   847   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   845   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   845   0.0  
Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   844   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   844   0.0  
SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   841   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   842   0.0  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   839   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    835   0.0  
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   828   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   826   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   823   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   822   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   820   0.0  
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   333   e-108
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   332   e-108
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   332   e-107
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   332   e-107
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   327   e-106
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   327   e-106
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   325   e-105
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   325   e-105
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    325   e-105
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   325   e-105
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   325   e-105
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   324   e-105
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   324   e-105
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   324   e-105
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   322   e-104
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   322   e-103
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   321   e-103
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   317   e-102
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   316   e-102
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   314   e-101
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   311   1e-99
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   310   2e-99
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   302   4e-96
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    74   2e-13
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    74   3e-13
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    72   7e-13
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    72   9e-13
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    72   1e-12
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    71   2e-12
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    67   4e-11
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    67   5e-11
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    66   8e-11
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    65   2e-10
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    64   3e-10
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    62   1e-09
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    61   3e-09
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    61   3e-09
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    59   2e-08
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    56   1e-07
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    51   4e-06
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    49   2e-05
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    49   2e-05
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    46   1e-04
Kpol_1063.5 s1063 complement(15045..15875) [831 bp, 276 aa] {ON}...    33   1.8  
Smik_2.319 Chr2 complement(572736..575303) [2568 bp, 855 aa] {ON...    31   7.2  
Suva_4.430 Chr4 complement(756076..758643) [2568 bp, 855 aa] {ON...    31   8.1  
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    31   8.1  
Skud_2.305 Chr2 complement(553986..556553) [2568 bp, 855 aa] {ON...    31   8.9  
YBR179C Chr2 complement(586547..589114) [2568 bp, 855 aa] {ON}  ...    31   8.9  

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP
Sbjct: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSKPS 451
           LKNEVAIHEAMELYNKDKPATEEPVESSKPS
Sbjct: 421 LKNEVAIHEAMELYNKDKPATEEPVESSKPS 451

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/449 (91%), Positives = 433/449 (96%), Gaps = 2/449 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ QINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALENANDISEGLVSD LKAVLD+NLPKGS KK+V +AISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+EDSLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           DNDAG+AERVIDNARISMGQDLSETDMDNVC+FA+RV SLADYR+QLY+YLC KMHTVAP
Sbjct: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPT+VFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSK 449
           LKNE+AI EA+ELYNKDKP  EEPV+ SK
Sbjct: 421 LKNELAIQEAIELYNKDKP--EEPVKESK 447

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/451 (90%), Positives = 436/451 (96%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQQQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALENANDISEGLVS+ LKA+LDLNLPKGS KK+V +AISDKNLGPSIKEVFP+VDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKKTVTLAISDKNLGPSIKEVFPFVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASLNE+SLHDLS IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           DNDAG++ERVIDNARISMGQDLSETDM+NV IFA+RVVSL +YRKQLYDYLCEKMHTVAP
Sbjct: 241 DNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG VLKKQVEQRLEFYA+GTPT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSKPS 451
           LKNE AI EA+ELYNKDKPA EE V++++ S
Sbjct: 421 LKNESAIKEAIELYNKDKPAHEEEVDTTEVS 451

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/449 (90%), Positives = 432/449 (96%), Gaps = 2/449 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALENANDISEGLVS+ LKAVLD+NLPKGS KK+V +AISDKNLGPSIKEVFPY+DC+SN
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNLGPSIKEVFPYIDCMSN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASL EDSLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           D+DAG+AERVIDNARISMGQDLSETDM+NVC+FA+RV SLADYR+QLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI KASAKNKGRISRYLANKCS+ASRIDNYSDEP++VFG VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSK 449
           LKNE+AI EA+ELYNKDKP  EEPV+ SK
Sbjct: 421 LKNELAIQEAIELYNKDKP--EEPVKESK 447

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/451 (88%), Positives = 437/451 (96%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLL+EEPTGYA+FKVKLQQDDIGSRL EVQQQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGLVS++LKA+LDLNLPKGSEKKSVV+ ISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDKNLGPSIKEDFPYVDCMAN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RG+RLHGEKL K LQ+GDL+RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DAG+++RVIDNARISMGQDLSETDMDN+C+FA+RVVSL +YR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KA+AKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFYATG+PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSKPS 451
           LKNE+AI EAM+LYNKD P +E+  E +K S
Sbjct: 421 LKNELAIQEAMKLYNKDAPKSEDAAEETKSS 451

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/454 (90%), Positives = 434/454 (95%), Gaps = 5/454 (1%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRL+EVQ+QIN+FG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEK-KSVVMAISDKNLGPSIKEVFPYVDCIS 119
           EALENANDISEGLVS+SLKA+LDLNLPK S K K+V +AISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN+DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L+ D+G+A+RVIDNARISMGQD+SETDM+NVC+FAQRV SLADYR+QLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG+VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEVAIHEAMELYNKDKPATE----EPVESSK 449
           TLKNE+AI EAMELYNKDKPA +    E  ESSK
Sbjct: 421 TLKNELAIQEAMELYNKDKPAADDKETEEKESSK 454

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/443 (90%), Positives = 431/443 (97%), Gaps = 1/443 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRL+EVQ+QIN+FG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGS-EKKSVVMAISDKNLGPSIKEVFPYVDCIS 119
           EALENANDISEGLVS+SLKA+LDLNLPK S +KK++ +AISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN+DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L+ D+G+A+RVIDNARISMGQD+SETDM+NVC+FAQRV SLADYR+QLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG+VLKKQVEQRLEFY TGTP
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 420 TLKNEVAIHEAMELYNKDKPATE 442
           T+KNE+AI EAMELYNKDKPA +
Sbjct: 421 TMKNELAIQEAMELYNKDKPAAD 443

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/446 (90%), Positives = 430/446 (96%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           IEYLLFEEPTGYAVFKVKL QD+IGS+L+EVQ+QIN+FG FTKLVELVSFAPFKGAAEAL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           ENANDISEGLVS+SLK VL+LNLPKGS K +V +AISDKNLGPSIKE FPYVDCI+NELA
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLGPSIKEAFPYVDCIANELA 122

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
           QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL
Sbjct: 123 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 182

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLNE+SLHDL+A+++ D
Sbjct: 183 DKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNED 242

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
           AG+AER+IDNARISMGQDLSETDM+NVC+FAQRVVSL DYRKQLYDYLCEKMHTVAPNLS
Sbjct: 243 AGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLS 302

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
            LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI
Sbjct: 303 GLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 362

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPTLKN 423
           +KASAKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFYATG PTLKN
Sbjct: 363 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLKN 422

Query: 424 EVAIHEAMELYNKDKPATEEPVESSK 449
           E+AIHEAMEL+NKDKP +EEP   SK
Sbjct: 423 ELAIHEAMELFNKDKPVSEEPKADSK 448

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/443 (90%), Positives = 431/443 (97%), Gaps = 1/443 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRL+EVQ+QIN+FG+FTKL+ELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGS-EKKSVVMAISDKNLGPSIKEVFPYVDCIS 119
           EALENANDISEGLVS+SLKA+LDLNLPK S +KK++ +AISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN+DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L+ D+G+A+RVIDNARISMGQD+SETDM+NVC+FAQRV SLADYR+QLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYS+EP++VFG+VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEVAIHEAMELYNKDKPATE 442
           TLKNE+AI EAMELYNKDKPA E
Sbjct: 421 TLKNELAIQEAMELYNKDKPAAE 443

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/441 (91%), Positives = 428/441 (97%), Gaps = 1/441 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRL+EVQ+QIN+FG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGS-EKKSVVMAISDKNLGPSIKEVFPYVDCIS 119
           EALENANDISEGLVS+ LKA+LDLNLPK S +KK++ +AISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLNEDSLHDL+A+
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L++D+G+A+RVIDNARISMGQDLSETDM+NVCIFAQRV SLADYR+QLYDYLCEKMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEVAIHEAMELYNKDKPA 440
           TLKNE+AI EAMELYNKDKPA
Sbjct: 421 TLKNELAIQEAMELYNKDKPA 441

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/439 (91%), Positives = 429/439 (97%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           M+ I+YLLFEEPTGYAVF+VKLQQD+IGS+L EVQ+QIN+F SFTKLVELVSFAPFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGLVS++LK++L+LNLPKGSEKK+V++ ISDKNLGPSIKE FPYVDCISN
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGSEKKTVILGISDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QDL+RG+R HGEKL KGLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNE+SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DAG+AERVIDNARISMGQDLSETDM+NVC+FA+RVVS+ADYRKQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSDEP+SVFGAV+KKQVEQRLEFY+TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKPT 420

Query: 421 LKNEVAIHEAMELYNKDKP 439
           LKNEVAIHEAMELYNKDKP
Sbjct: 421 LKNEVAIHEAMELYNKDKP 439

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/435 (92%), Positives = 426/435 (97%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQQQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALENANDISEGLVS+ LKA+LDLNLPKGS K +V +AISDKNLGPSIKE FPYVDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KLLK LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+E+SLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DAG+AERVIDNARISMGQDLSETDM+NVCIFA+RVVSLADYR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNEVAIHEAMELYN 435
           LKNE+AI EA+ELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/435 (92%), Positives = 427/435 (98%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQDDIGSRL+EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGLVS+SLKAVLDLNLPK S+ K++ +AISDKNLGPSIKE FPYVDCI+N
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKASKSKTITLAISDKNLGPSIKEDFPYVDCIAN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLN++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DAG+AERVIDNARISMGQD+SETDM+NV +FAQRVVSL +YRKQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFY+TGTPT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTPT 420

Query: 421 LKNEVAIHEAMELYN 435
           LKNE+AI EAM+LYN
Sbjct: 421 LKNELAIKEAMDLYN 435

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/449 (88%), Positives = 432/449 (96%), Gaps = 1/449 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QIN+FGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGL+S+SLKAVLDLNLPKGS+K+SV + ISDKNLGPSIKEVFPYVDC SN
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL+EDSLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAALL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DA +AERV+DNARISMGQDLS  DM+NVCIFAQRVV+LADYR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFISKA+AKNKGRISRYLANKC+MASRIDNYSDEPT++FG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESSK 449
           LKNE+AI EA+ELYN++KP  EEP + SK
Sbjct: 421 LKNELAIQEAIELYNENKP-EEEPKQESK 448

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/435 (91%), Positives = 425/435 (97%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQDDIGSRL+EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENAND+SEGLVS+SLKA+LDLNLPKGS+ K+V +AISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGSKGKTVTLAISDKNLGPSIKEEFPYVDCLAN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLN++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
            +DAG+A+RVIDNARISMGQD+SETDM+NV IFAQRVVSL +YRKQL+DYLCEKMHTVAP
Sbjct: 241 GDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFY TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKPT 420

Query: 421 LKNEVAIHEAMELYN 435
           LKNE+AI EAM+LYN
Sbjct: 421 LKNELAIQEAMDLYN 435

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/439 (89%), Positives = 422/439 (96%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
            ALENANDISEGL+S+ LKAVLDLNLPKGS KKSVV+A+SDKNLGPSIKE FPYVDCISN
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLN++SLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
             DAG+AERVI NARISMGQDLSE DM+NV +FA+RVV+L +YR+QLY+YLCEKMHTVAP
Sbjct: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSD+PT+VFG VLKKQVEQRLEFYATG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNEVAIHEAMELYNKDKP 439
           LKNE+AI EA+ L+NKDKP
Sbjct: 421 LKNEIAIQEAIALFNKDKP 439

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/436 (89%), Positives = 424/436 (97%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPI+YLLFEEPTGYA+FKVKLQQD+IGSRL EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENANDISEGLVS+SLKA+LDLNLPKGS+K++V + ISD+NLGPSIKE FPYVD +SN
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDRNLGPSIKEEFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF+KDKASLN++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DA +A+RVIDNARISMGQDLSETDM+NVC+FA+RV SLADYR+QLY+YLCEKMHTVAP
Sbjct: 241 NDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KA+ KNKGRISRYLANKCSMASRIDNYSDEPT+VFG VL+KQVEQRLEFY+TG PT
Sbjct: 361 GFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQPT 420

Query: 421 LKNEVAIHEAMELYNK 436
           LKNE+AI EAM+LYN+
Sbjct: 421 LKNELAIKEAMDLYNE 436

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/448 (87%), Positives = 422/448 (94%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDI SRL EVQQQINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALENANDISEGL+SDSLK++L+LNLPK S+ K+V + ISDKNLGPSIKE FPYVDCISN
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKASKSKTVTLGISDKNLGPSIKEQFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVR HGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN++SLH+L+  L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGHL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           + DAG+A+RVIDNARISMGQDLSE DM NVC+FA+RVVSL DYR+ LYDYLCEKMHTVAP
Sbjct: 241 NEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KASAKNKGRISRYLANKCS+ASRIDNYSDEP++VFG+VLKKQVEQRLEFY  G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEEPVESS 448
           LKNE+AI EAMELYNKDKP  E+  E S
Sbjct: 421 LKNELAIQEAMELYNKDKPEEEQKEEIS 448

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/443 (87%), Positives = 424/443 (95%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MA IEYLLFEEPTGYAVFKVKLQQDDIGSRL EVQ+QIN+FGSFTK+VELVSFAPFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           EALENAN+ISEGLVS+SLK+VLDLNLPK S+KKS+ + ISDKNLGPSIKE FPYVD +SN
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPKPSKKKSIALGISDKNLGPSIKETFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QD++RG+RLHGEKL KGLQSGDL+RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLN++SLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAALL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           ++DAG+A+RVIDNARISMGQDLSETDM+NV +FAQRVVSL +YR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFI+KA+AKNKGRISRYLANKCS+ASRIDNYSDEP++VFG VLKKQVEQRLEFYATG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKPT 420

Query: 421 LKNEVAIHEAMELYNKDKPATEE 443
           LKNE+AIHEAMELY  + P  E+
Sbjct: 421 LKNELAIHEAMELYKSENPDAEK 443

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/455 (86%), Positives = 423/455 (92%), Gaps = 6/455 (1%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ+QIN+FGSFTKLVEL SF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
           +ALEN NDISEGL+S+ LKAVLDLNLPKGS KK+VV+AISDKNLGPSIKE FPYVDCI++
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKAVVLAISDKNLGPSIKEEFPYVDCIAS 120

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVL I+DK SL +DSLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAIL 240

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
           D+DAG+AERVI NARISMGQDLSE DMDNVC+FA+RV +L DYRKQLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420
           GFISKASAKNKGRISRYLANKCS+ASRIDNY+D+PT+ FG VLKKQVEQRLEFYATGTPT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNEVAIHEAMELYNKDKPA------TEEPVESSK 449
           LKNEVAI EA++L+NK++P        E P E SK
Sbjct: 421 LKNEVAIQEAIDLFNKNRPQEEVEEHQESPKEKSK 455

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  333 bits (854), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/419 (43%), Positives = 270/419 (64%), Gaps = 32/419 (7%)

Query: 4   IEYLLFEEPTGYAVFKV---------KLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFA 54
           + Y+L E   GYA+ K          KL QD     L   ++ ++EF       ++ +F+
Sbjct: 1   MSYVLTETSAGYALLKASDKKIHKSPKLIQD-----LDSSEKVLDEF-------KIAAFS 48

Query: 55  PFKGAAEALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPY 114
            F  AA ALE AN I+EG V+  L+++LD       +KKS ++ +S+  L  SI ++   
Sbjct: 49  KFNSAANALEEANSITEGKVTPQLQSLLD---EVKKDKKSTLI-VSETKLANSINKLGLN 104

Query: 115 VDCISNELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHII 174
            + +S+ +  D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  II
Sbjct: 105 FNVVSDAVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMII 164

Query: 175 QAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLH 234
           QAIALLD LDK+INT++MR KEWYGWHFPELAK+V D   +A+++L +  ++   E    
Sbjct: 165 QAIALLDDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAE---T 221

Query: 235 DLSAILDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEK 294
           D+SAIL  +  + ERV   A +SMG ++++TD+DN+   AQ++V  A YR+QL +YL  +
Sbjct: 222 DMSAILPEE--IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTAR 279

Query: 295 MHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY 354
           M  +APNL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKY
Sbjct: 280 MKAIAPNLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKY 339

Query: 355 GLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           GL+YH+  + +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 340 GLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/410 (43%), Positives = 260/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q +N      K  ++ +F+ F  AAEAL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLNTSDKVLKQFKVAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS  L+ +LD    +    K   + +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANSIVEGKVSSQLQKLLD----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A ISMG +++ TD++N+   A ++   A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  332 bits (851), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/413 (43%), Positives = 268/413 (64%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GYA+ K          +L +    I +  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
            ALE AN + EG VS  L+ +LD ++ K    K   + +S+  L  SI ++    + +S+
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHE---IDMSEIL 227

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
             +  + ERV   A +SMG ++++TD+DN+   A ++V  A YR+QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D +++  + +   G  ++ +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 266/410 (64%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + + +N      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSPSLIEDLNTSEKLLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN + EG VS  L+ +L+ ++ K    K   + +S+  L  SI ++    + +S+ + 
Sbjct: 58  EEANSVIEGKVSPQLEKLLE-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHET---DMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG ++++TD+DN+   A ++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D +S+  + +   G  ++ +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  327 bits (839), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/414 (42%), Positives = 268/414 (64%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVK----LQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGA 59
           + Y+L E   GYA+ K       +   + S L   ++ + EF       ++ +F+ F  A
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSTTLLSDLDSSEKVLKEF-------KIAAFSKFSSA 53

Query: 60  AEALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCIS 119
           A ALE AN I EG VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S
Sbjct: 54  ANALEEANSIIEGKVSSQLEKILE-QIKK--DKKSTLI-VSETKLANAINKLGLNFNVVS 109

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ H  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D+S I
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAET---DMSEI 226

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L  +  V ERV   A +SMG +++++D+DN+   A+++V  A YR+QL +YL  +M  +A
Sbjct: 227 LPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  327 bits (839), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 261/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E P GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETPAGYALLKA---SDKKIYKSSSLLQDLDTTDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E +  I EG VS  L+ +LD    +  + K   + +S+  L  +I ++   ++ +S+ + 
Sbjct: 58  EESTAIIEGKVSPQLEKLLD----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +   LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  +E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASE---TDMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG +++ TD+DN+   A+++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSDEPTSV--FGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++       G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/410 (42%), Positives = 265/410 (64%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q ++      +  ++ +F+ F  AA AL
Sbjct: 1   MSYILTETSAGYALLKA---SDKKIYKSSTLLQDLDSSEKVLRQFKIAAFSKFSSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS  L+ +LD  + K  +KKS  + +S+  L  +I ++   +  +S+ + 
Sbjct: 58  EEANSIVEGKVSTQLEKLLD-EIKK--DKKST-LVVSETKLANAINKLGLNLSVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAE---TDMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             V ERV   A +SMG +++++D+DN+   A+++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 266/408 (65%), Gaps = 14/408 (3%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEALEN 65
           Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA ALE 
Sbjct: 3   YVLTETSAGYALLKA---SDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEE 59

Query: 66  ANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELAQD 125
           AN I EG VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S+ +  D
Sbjct: 60  ANSIIEGKVSSQLEKLLE-EIKK--DKKSTLI-VSETKLANAINKLGLNFNVVSDAVTLD 115

Query: 126 LIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDK 185
           + R V+ +  +LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD LDK
Sbjct: 116 IYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDK 175

Query: 186 DINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAG 245
           ++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    DLS IL  +  
Sbjct: 176 ELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEILPEE-- 230

Query: 246 VAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSEL 305
           + ERV   A +SMG ++++TD+DN+   A+++V  A YR+QL +YL  +M  +APNL++L
Sbjct: 231 IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQL 290

Query: 306 IGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISK 365
           +GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  + +
Sbjct: 291 VGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQ 350

Query: 366 ASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 351 ATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  325 bits (833), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/450 (41%), Positives = 279/450 (62%), Gaps = 22/450 (4%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFSSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E +N I EG VS  L+ +L+  + K  +KKS ++ +S+  L  SI ++    + +S+ + 
Sbjct: 58  EESNSIIEGKVSPQLEKLLE-EIKK--DKKSTLI-VSETKLANSINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  +E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASE---TDMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG ++++ D+DN+   A ++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRLEFYA----TG 417
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL          
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRLSQLEGRDLRT 408

Query: 418 TPTLKNE---VAIHEAMELYNKDKPATEEP 444
           TP +  E   V I EA + YN D     EP
Sbjct: 409 TPKVVREAKKVEITEA-QAYNADADTVAEP 437

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 175/408 (42%), Positives = 266/408 (65%), Gaps = 14/408 (3%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEALEN 65
           Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA ALE 
Sbjct: 3   YVLTETSAGYALLKA---SDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEE 59

Query: 66  ANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELAQD 125
           AN I EG VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S+ +  D
Sbjct: 60  ANSIIEGKVSSQLEKLLE-EIKK--DKKSTLI-VSETKLANAINKLGLNFNVVSDAVTLD 115

Query: 126 LIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDK 185
           + R ++ +  +LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD LDK
Sbjct: 116 IYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDK 175

Query: 186 DINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAG 245
           ++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    DLS IL  +  
Sbjct: 176 ELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEILPEE-- 230

Query: 246 VAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSEL 305
           + ERV   A +SMG ++++TD+DN+   A+++V  A YR+QL +YL  +M  +APNL++L
Sbjct: 231 IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQL 290

Query: 306 IGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISK 365
           +GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  + +
Sbjct: 291 VGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQ 350

Query: 366 ASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 351 ATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 175/410 (42%), Positives = 260/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS  L+ +L+    +  + K   + +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANSIIEGKVSPQLQKLLE----EAKKDKKSTLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +   LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   +    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCAD---TDLSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             V ERV   A +SMG +++ETD+DN+   A ++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/410 (43%), Positives = 269/410 (65%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +  ++ Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSTKLIQDLDSSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E A+ I EG VS  L+ +L+ ++ K  +KKS ++ +S+  L  +I ++    + IS+ + 
Sbjct: 58  EEASAIIEGKVSPQLQNLLE-DIKK--DKKSTLI-VSETKLANAINKLGLNFNVISDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +   LL GL  GDL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L I  ++  +E    D+S+IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASE---TDMSSILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG ++++ D+DN+   A+++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 266/408 (65%), Gaps = 14/408 (3%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEALEN 65
           Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA ALE 
Sbjct: 3   YVLTETSAGYALLKA---SDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEE 59

Query: 66  ANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELAQD 125
           AN I EG VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S+ +  D
Sbjct: 60  ANSIIEGKVSSQLEKLLE-EIKK--DKKSTLI-VSETKLANAINKLGLNFNVVSDAVTLD 115

Query: 126 LIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDK 185
           + R V+ +  +LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD LDK
Sbjct: 116 IYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDK 175

Query: 186 DINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAG 245
           ++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    DLS IL  +  
Sbjct: 176 ELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEILPEE-- 230

Query: 246 VAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSEL 305
           + ERV   A +SMG ++++TD+DN+   A+++V  A YR+QL +YL  +M  +APNL++L
Sbjct: 231 IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPNLTQL 290

Query: 306 IGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISK 365
           +GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  + +
Sbjct: 291 VGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQ 350

Query: 366 ASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 351 ATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  324 bits (830), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 175/410 (42%), Positives = 267/410 (65%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I +G VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANSIIDGKVSSQLEKLLE-EIKK--DKKSTLI-VSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG ++++TD+DN+   A+++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  322 bits (826), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 265/408 (64%), Gaps = 14/408 (3%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEALEN 65
           Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA ALE 
Sbjct: 3   YVLTETSAGYALLKA---SDKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAANALEE 59

Query: 66  ANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELAQD 125
           +N I EG VS  L+ +L+ ++ K  +KKS ++ +S+  L  SI ++    + +S+ +  D
Sbjct: 60  SNAIIEGKVSSQLQKLLE-DIKK--DKKSTLV-VSETKLANSINKLGLNFNVVSDAVTLD 115

Query: 126 LIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDK 185
           + R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD LDK
Sbjct: 116 IYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDK 175

Query: 186 DINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAG 245
           ++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S IL  +  
Sbjct: 176 ELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASE---TDMSEILPEE-- 230

Query: 246 VAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSEL 305
           + ERV   A +SMG +++  D+DN+   A ++V  A YR+QL +YL  +M  +APNL++L
Sbjct: 231 IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAPNLTQL 290

Query: 306 IGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISK 365
           +GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  + +
Sbjct: 291 VGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQ 350

Query: 366 ASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 351 ATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 266/413 (64%), Gaps = 14/413 (3%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60
           +  + Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA
Sbjct: 30  LCKMAYVLTETSAGYALLKA---SDKKIYKSSTLIQDLDTSDKVLKEFKIAAFSKFSSAA 86

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
            ALE +N I EG VS  L+ +L+ ++ K  +KKS  + +S+  L  SI ++    + +S+
Sbjct: 87  NALEESNAIIEGKVSSQLQKLLE-DIKK--DKKST-LVVSETKLANSINKLGLNFNVVSD 142

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 143 AVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 202

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           D LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S IL
Sbjct: 203 DDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASET---DMSEIL 259

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
             +  + ERV   A +SMG +++  D+DN+   A ++V  A YR+QL +YL  +M  +AP
Sbjct: 260 PEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAP 317

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 318 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 377

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 378 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/410 (41%), Positives = 260/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + + +N      K  ++ +F+ F  AA+AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSTLIKDLNSSEKVLKEFKIAAFSKFSSAADAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS  L+ +L     +    K   + +S+  L  +I ++    + IS+ + 
Sbjct: 58  EEANSIIEGKVSTQLENLL----KEAKADKKATLVVSETKLANAINKLNLNFNVISDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  +++  +    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAAD---TDMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   + +SMG ++++ D+DN+   A ++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/412 (42%), Positives = 266/412 (64%), Gaps = 18/412 (4%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS  L+ +L+  + K  +KKS ++ +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANSIIEGKVSPQLEKLLE-EIKK--DKKSTLI-VSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF--IKDKASLNEDSLHDLSAILD 241
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   I+ KA+   D+  D+S IL 
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAA---DT--DMSEILP 228

Query: 242 NDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPN 301
            +  + ERV   A +SMG ++++ D++N+   A ++V  A YR+QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKAIAPN 286

Query: 302 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 361
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 362 FISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSV--FGAVLKKQVEQRL 411
            + +A+ KNKG+I+R LA K +++ R D  +++       G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 170/410 (41%), Positives = 257/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q +N         ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLNSSDKVLNQFKIAAFSKFSSAANAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN + +G VS  L+ +L+    +    K   + +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANSVIDGKVSSQLEKLLE----ECKTDKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  + +  E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAET---DMSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A +SMG +++  D+ N+   A+++V  A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +AS KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 267/411 (64%), Gaps = 16/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRL-QEVQQQINEFGSFTKLVELVSFAPFKGAAEA 62
           + Y+L E   GYA+ K   ++    S L Q+++   N    F    ++ +F+ F  AA A
Sbjct: 1   MAYVLTETAAGYALLKASDKKIYKSSSLVQDLKSSENVLKQF----KVAAFSKFASAANA 56

Query: 63  LENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNEL 122
           LE AN + EG VS  L+ +L       S+KKS ++ +S+  L  +I ++    + + + +
Sbjct: 57  LEEANSVIEGKVSSQLEKLL---AEAKSDKKSTLV-VSETKLANAINKLGLNFNVVCDAV 112

Query: 123 AQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +  +LL G+  GDL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDN 242
           LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    D+S IL  
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DMSEILPE 229

Query: 243 DAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNL 302
           +  + ERV   A +SMG ++++ D+DN+   A+++V  A YR+QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 ISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           + +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  311 bits (796), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 260/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGS---FTKLVELVSFAPFKGAA 60
           + Y+L E   GYA+ K          ++ +    IN+  S     K  ++ +F+ F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120
            ALE AN + EG VS  L+ +LD    +    K   + +S+  LG +I ++    + + +
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKATLVVSETKLGNAINKLGLNFNVVCD 110

Query: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  +    DLS +L
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAD---TDLSEVL 227

Query: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300
             +  V ERV   A +SMG +++  D+DN+   A+++V  A YR+QL  YL  +M  +AP
Sbjct: 228 PEE--VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++  + +  FG   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  310 bits (795), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/410 (42%), Positives = 259/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + Q +N      K  ++ +F+ F  AAEAL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLNSSDKVLKQFKIAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISNELA 123
           E AN I EG VS+ L+ +L     +    K   + +S+  L  +I ++    + +S+ + 
Sbjct: 58  EEANAIVEGKVSNQLQKLL----SESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLS 303
             + ERV   A ISMG +++  D+DN+   A ++   A YR+QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++  + +   G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  302 bits (773), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 172/414 (41%), Positives = 261/414 (63%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVK----LQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGA 59
           + Y+L E   GYA+ K       +   +   L   ++ + EF       ++ +F+ F  A
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSLIMDLDSSEKVLKEF-------KIAAFSKFNSA 53

Query: 60  AEALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCIS 119
           A ALE A+ I EG VS  L+ +LD    +  ++K   + +S+  L  +I ++    + +S
Sbjct: 54  ANALEEASAIIEGKVSPQLEKLLD----EIKKEKKATLIVSETKLANAINKLGLNFNVVS 109

Query: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ +   LL G+   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239
           LD LDK++NT++MR KEWYGWHFPELAK+V D+  +A+L+L +  ++   E    D+S I
Sbjct: 170 LDDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAET---DMSEI 226

Query: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299
           L  +  + ERV   A +SMG ++++ D+ N+   A ++V  A YR+QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPTSVFGAVLKKQVEQRL 411
           +  + +AS +NKG+I+R LA K ++A R D  ++  + +   G  ++ +VE RL
Sbjct: 345 ASLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRAKVENRL 398

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 108/212 (50%), Gaps = 10/212 (4%)

Query: 185 KDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDA 244
           +DI      +   Y   F EL  L+P+   +A +V  ++   ++ + + ++L+ I +++ 
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLE---TMQDRNSNELATIFESEL 188

Query: 245 GVAER----VIDNARISMGQDLSETDMDNVCIFAQRVV--SLADYRKQLYDYLCEKMHTV 298
            + +     +  + + S+ QD++   +  + +F  R +   L+D+R+++   +  K+H +
Sbjct: 189 LLKKEQTLVLTLSIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHII 248

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLI 357
           APNL+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G I
Sbjct: 249 APNLTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAI 308

Query: 358 YHSGFISKASAKNKGRISRYLANKCSMASRID 389
           YH   + +    ++ ++ R +  K S+A+R+D
Sbjct: 309 YHCALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 115/247 (46%), Gaps = 17/247 (6%)

Query: 175 QAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLH 234
           Q  AL   L  +I       K  Y   F EL  LVPD  K+ +++  I++    +     
Sbjct: 73  QLNALSSILQGEIRLLHDYTKILYRQRFAELESLVPDPVKYVEVISIIEEDEQAS----- 127

Query: 235 DLSAILDNDAGVAER----VIDNARISMGQDLSETDMDNVCIFAQR--VVSLADYRKQLY 288
             S   + DA +++     ++ + + S+ Q+   TD +   +   R  ++++   R ++ 
Sbjct: 128 --SERFERDAKLSKEQILVLMMSMKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVN 185

Query: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK 348
            Y+ +++  +APNL  LIG  I + L+SH G +  LS+  +  +  +G  K L   L T 
Sbjct: 186 GYVVQRVSHIAPNLCALIGPEITSLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTS 245

Query: 349 -GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID---NYSDEPTSVFGAVLK 404
                + G IY S  +     +   ++ R +  K S+A+R+D   N S E  S+ G   +
Sbjct: 246 LTGVRQEGYIYRSQLVQDQPPQYHKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWR 305

Query: 405 KQVEQRL 411
           +++ +++
Sbjct: 306 REIMEKV 312

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 125/286 (43%), Gaps = 46/286 (16%)

Query: 111 VFPYVDCISNELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKND 170
           + PY+D IS      LI+G  +  E+LL                  YS  ++ F++    
Sbjct: 100 ILPYIDAIS----HILIQGNSIADEQLL------------------YSLNELSFNI---- 133

Query: 171 NHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNE 230
                        ++DI      VK  Y   FPEL  L+ +  +F  ++  ++   + N+
Sbjct: 134 -------------NEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNK 180

Query: 231 DSLHDLSAILDNDAGVAER----VIDNARISMGQD--LSETDMDNVCIFAQRVVSLADYR 284
           +    L   L+ +  + +     +I + + S  ++   S T  +N+   +  +  L  ++
Sbjct: 181 NEESQLEIRLEKETTLQKEQILVIIMSVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFK 240

Query: 285 KQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344
           +++  ++ +K+  +APNL  LIG  I + L++++G L NL    +  +  +G  K L   
Sbjct: 241 EEINSFVTKKISDIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHE 300

Query: 345 LKTK-GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
           L +      + G +Y+S  I    A    ++ R L  K ++ASR+D
Sbjct: 301 LHSNLSGVRQNGYLYNSELIQSQPANLHKQLLRILCAKVALASRVD 346

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 114/234 (48%), Gaps = 17/234 (7%)

Query: 170 DNHIIQAIALLDQLDKDI-----NTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKD 224
           +N I++  ++L++  K I     N FA  +K  Y   FPEL  L+ +   F +++  +++
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 225 KASLNEDSLHD-LSAILDNDAGVAER----VIDNARISMGQDL--SETDMDNVCIFAQRV 277
             ++ E S  D ++ +L+N++ ++      VI + +         +E     +    + +
Sbjct: 149 --NITEISNDDYIATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLELL 206

Query: 278 VSLADYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGA 337
             L + + +   YL  K+ T+APNLS LIG  I + LISH GS+  LSK  +  +  +G 
Sbjct: 207 NILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIGK 266

Query: 338 EKALFRA--LKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
           +K    A  + +     + G IY+S  I         ++ R L  K S+A+R+D
Sbjct: 267 KKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVD 320

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 104/229 (45%), Gaps = 19/229 (8%)

Query: 169 NDNHIIQAIALLDQL----DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKD 224
           ND  + Q + +L+ L      +I      +K  YG  F EL  LVP   +FA ++  I+ 
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIET 132

Query: 225 KASLNEDSLHDLSAILDNDAGVAERVIDNARISMGQDLS---ETDMDNVCIFAQRVVSLA 281
               NE +        + DA +++  +    +SM          D D V      +++++
Sbjct: 133 ----NEGNF-------ETDAQLSKEQVLVLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVS 181

Query: 282 DYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKAL 341
             R ++  ++  K   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L
Sbjct: 182 RIRNEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHL 241

Query: 342 FRALKTK-GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
              L T      + G IY S  + +   + + ++ R +  K ++A+R+D
Sbjct: 242 SHELHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 97/215 (45%), Gaps = 2/215 (0%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARIS 257
           Y   FPEL  L+     +AQ+V  + + + +NE +L  L  I+  +  +   +  +    
Sbjct: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169

Query: 258 MGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 317
               L+  D   V   A  ++ L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229

Query: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKASAKNKGRISR 376
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R
Sbjct: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289

Query: 377 YLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRL 411
            +  K S+ +R D     P+   GA  K+QV ++L
Sbjct: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 107/221 (48%), Gaps = 14/221 (6%)

Query: 180 LDQLDKDINTFAMRVKEW----YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHD 235
           L+Q+  ++ T    + E+    Y   F EL  L+    +++ ++  ++      E SL  
Sbjct: 110 LNQISLNLRTETANLHEYLKLSYSARFSELESLIATATQYSNVIYVLETSEKDTEGSL-- 167

Query: 236 LSAILDNDAGVAERVIDNARISMGQDLSET-----DMDNVCIFAQR-VVSLADYRKQLYD 289
               L+  A +++  I    +SM    +E+     ++    + A+  +++L + R  +  
Sbjct: 168 -VTSLEQVAQLSKEQILVLMMSMKTSFNESTPLPLEIKQRLLRAREMIITLDELRHTIAS 226

Query: 290 YLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKG 349
           Y+  K++ +APNL  L+G  I A L+SHAG +  LS+     +  +G +K L   L T  
Sbjct: 227 YISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIGKKKHLSHELHTTA 286

Query: 350 N-TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
           +   + G IY+S  + +    ++ ++ R L  K ++A+R+D
Sbjct: 287 SGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 10/199 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARIS 257
           Y   F EL  +     ++A++V   +    L+   L++L    +N+A + +  I    IS
Sbjct: 131 YSKKFNELDTITSSQLQYARIVKIFESHQDLSSGELNNL---FENEAKLTKEQIIVLNIS 187

Query: 258 MGQD------LSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M         L       +      + +L+  ++ +  Y+   +  +APNL  LIG  I 
Sbjct: 188 MKSSFDISFKLDHQKQKEILKSTDMITTLSALQELITHYITSNISHIAPNLCALIGSQIA 247

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKN 370
           A LISHAGS+ +LS+  +  +  +G  K     L T      + G IY    I    ++N
Sbjct: 248 ALLISHAGSILDLSQIPSCNLASIGKSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSEN 307

Query: 371 KGRISRYLANKCSMASRID 389
             ++ R +  K S+A+R+D
Sbjct: 308 HKQMLRMVCAKASLAARVD 326

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 111/239 (46%), Gaps = 17/239 (7%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDL-SAILD 241
           + ++I+ F    K  Y + F EL  L P   +FA+ +  I+   ++++ S HDL S+ L+
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIE---TMDDFSQHDLLSSKLE 180

Query: 242 NDAGVAERVIDNARISMGQDLS-----ETDM-DNVCIFAQRVVSLADYRKQLYDYLCEKM 295
            +  + +  +    I+M   L+     E  M  ++  F   ++     +K++  ++   +
Sbjct: 181 TEILLTKEQVLVLIIAMKTSLNKEYSFEGSMKTSLKQFTDIIIQHDLLKKEITTFIESNI 240

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
            T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      + 
Sbjct: 241 ITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVRQE 300

Query: 355 GLIYHSGFISKASAKNKGRISRYLANKCSMASRID------NYSDEPTSVFGAVLKKQV 407
           G IY+S  I         ++ R L  K S+A+R+D        S EP +  G   ++++
Sbjct: 301 GYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREEI 359

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 95/200 (47%), Gaps = 10/200 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKA-SLNEDSLHDLSAILDNDAGVAERVIDNARI 256
           Y   FPEL+ L+P   ++++++  ++++  S NE    +L   L+N A +    I    +
Sbjct: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNESD--ELFFHLENKAKLTREQILVLTM 177

Query: 257 SMGQDLSETDMDNVCIFAQRVVS------LADYRKQLYDYLCEKMHTVAPNLSELIGEVI 310
           SM       +  ++    Q + +      L   ++ +  Y+  K+  +APN+  L+G  I
Sbjct: 178 SMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEI 237

Query: 311 GARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAK 369
            A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K    
Sbjct: 238 AAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVS 297

Query: 370 NKGRISRYLANKCSMASRID 389
              ++ R L  K S+A+R+D
Sbjct: 298 VHKQMLRMLCAKVSLAARVD 317

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 95/203 (46%), Gaps = 26/203 (12%)

Query: 202 FPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARISMGQD 261
           FPELA+LVP    + +++  ++  A L+E    + + ++      A R  D AR      
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRA-DPAR------ 145

Query: 262 LSETDMDNVCIFAQRVVSLADYRKQLYD-------YLCEKMHTVAPNLSELIGEVIGARL 314
                      + + +   AD  +QL+        ++  + H +AP ++ L+G V+ A L
Sbjct: 146 -----------WPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAAL 194

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFISKASAKNKGR 373
           +SHAGS+  L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +
Sbjct: 195 LSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQ 254

Query: 374 ISRYLANKCSMASRIDNYSDEPT 396
             R L  + ++A+R+D  + +P 
Sbjct: 255 ALRMLCARLALAARVDASAPDPA 277

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 109/223 (48%), Gaps = 16/223 (7%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIK-DKASLNEDSLHDL 236
           A++  +  DI +    +   YG  FPEL+ L+P + +++++   ++ +  S NE     L
Sbjct: 101 AIIPLIKSDIKSLHNFLILLYGKRFPELSSLIPSSLQYSKVASILESEHWSKNESD--KL 158

Query: 237 SAILDNDAGVA-ERVIDNARISMGQDLSETDMDNVCIFAQRVVSLAD-YRKQLY------ 288
           S +L+N+A +  E+V+    ++M    S  + + + I  ++ +S A    K L+      
Sbjct: 159 SPLLENEANLTKEQVL---VLTMSMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDV 215

Query: 289 -DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT 347
             Y+  K+  +APN+  L+G  + A+L+++AG +   S+  +  +  +G  K L   L T
Sbjct: 216 GRYVASKISVIAPNMCLLVGPEVAAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHT 275

Query: 348 -KGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
                 + G I+ +  I         ++ R +  K ++A+R+D
Sbjct: 276 LASGVRQEGYIFSTDLIQNFPLAIHKQMLRMICAKVTLAARVD 318

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 114/254 (44%), Gaps = 13/254 (5%)

Query: 179 LLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSA 238
           L  Q+ ++I+      K  Y   F EL  +    Y++A++   I+  +   +D    L  
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTS---DDKAGQLPI 174

Query: 239 ILDNDAGVAERVIDNARISMGQDLS-----ETDMDNVCIFA-QRVVSLADYRKQLYDYLC 292
            ++ +A +++  +   R+SM          E  + ++ + A   ++ L D +  +  Y+ 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYIS 234

Query: 293 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNT 351
             +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T     
Sbjct: 235 SNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGV 294

Query: 352 PKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID--NYSDEPTSVFGAVLKKQVEQ 409
            + G IY S  +     +N  ++ R +  K ++A+R+D          + G   ++++E 
Sbjct: 295 RQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWREELET 354

Query: 410 RLEFYATGTPTLKN 423
           +++   T +P + N
Sbjct: 355 KIQ-KVTESPNISN 367

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 97/199 (48%), Gaps = 8/199 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARIS 257
           Y   FPEL+ L+P   +++++V  ++++     +S   LS  L+N A + +  +    +S
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENENWSGNES-DKLSIHLENKANLTKEQLLVLTMS 197

Query: 258 MGQDLSET-----DMDNVCIFAQRVVS-LADYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311
           +    +       D   +   A  +++ L + +K +  Y+  K+  +APN+  L+G  + 
Sbjct: 198 LKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSEVT 257

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370
           A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I       
Sbjct: 258 AQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPIAI 317

Query: 371 KGRISRYLANKCSMASRID 389
             ++ R L  K ++A+R+D
Sbjct: 318 HRQMLRILCAKVTLAARVD 336

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 96/209 (45%), Gaps = 11/209 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARIS 257
           Y   FPEL+ L+P   +++++++ ++ +    +  +  L   L+N A +++  +    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGE-DWQKSEIDKLFPQLENIAHLSKEQVLVLTMS 178

Query: 258 MGQDLSETDMDNVCIFAQRVVS------LADYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M       +  N     Q + +      L   +  L  Y+  K+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 371 KGRISRYLANKCSMASRID---NYSDEPT 396
             ++ R L  K ++A+R+D    Y D+ T
Sbjct: 299 HKQMLRMLCAKVTLAARVDAGQRYDDKNT 327

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 100/219 (45%), Gaps = 15/219 (6%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDNARIS 257
           Y   FPEL  +V +  K+  +V  ++ +  + E     L  +L+ +    + ++ +  + 
Sbjct: 101 YNKRFPELPNVVSEQEKYVSVVKELEARPDVPE-----LGKLLNKE----QMLLVSMTMQ 151

Query: 258 MG-QDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLIS 316
            G     + D   +     +   L   +  +  Y+ +KMHT+APN+  L+G+ + A L++
Sbjct: 152 TGFHKEYKVDSPVIAELIDQYEVLHALKSDITTYISKKMHTIAPNVCALVGQEVAAALLT 211

Query: 317 HAGSLTNLSKQAASTVQILGAEKAL--FRALKTKGNTPKYGLIYHSGFISKASAKNKGRI 374
           + G +  LS+  +  +  +G  K L   + L T G   K G I+    +       + + 
Sbjct: 212 YTGGMKELSEIPSCNLASIGKTKHLSHVQQLDTSGVRQK-GYIFDCELVQSQPEALQKQA 270

Query: 375 SRYLANKCSMASRID--NYSDEPTSVFGAVLKKQVEQRL 411
            R +  K ++ASR+D  ++ +      GA  K+++  +L
Sbjct: 271 LRMICAKLALASRVDYLHHQENTHGSLGATWKEEILDKL 309

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 100/223 (44%), Gaps = 18/223 (8%)

Query: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNED 231
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++        
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-------- 139

Query: 232 SLHDLSAI-LDNDAGVAERVIDNARISMGQDLSE---TDMDNVCIFAQRVVSLADYRKQL 287
              D+  + LD      E ++    +S+  D  E    D D +         L + R  +
Sbjct: 140 --QDIPNVQLDQVLSKEETLV--VSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNV 195

Query: 288 YDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALK 346
             Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L 
Sbjct: 196 SHYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLD 255

Query: 347 TKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
             G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 256 ISGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 100/221 (45%), Gaps = 9/221 (4%)

Query: 194 VKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAILDNDAGVAERVIDN 253
           +K  Y   F EL  LV     +++L+ F++   + +   L  L  IL  +  +   V  +
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARD---LSTLEGILSKEQILI--VSMS 167

Query: 254 ARISMGQDLS-ETDMDNVCIFA-QRVVSLADYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311
            +    +DL+  +D     + A   ++ L D + ++  ++  ++  +APN+  ++G  + 
Sbjct: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKN 370
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287

Query: 371 KGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRL 411
             +  R +  K S+A+R+D  S+   +  G     ++ ++L
Sbjct: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 108/260 (41%), Gaps = 21/260 (8%)

Query: 173 IIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDS 232
           I Q ++LL +L          +   Y   FPEL  L+     +A++V  ++ K    +  
Sbjct: 139 IQQEVSLLRKL----------IASIYDQKFPELESLIASANSYAKVVRLLETKGG-GKLE 187

Query: 233 LHDLSAILDNDAGVAERVIDNARISMGQDLSETD----MDNVCIFAQRVVSLADYRKQLY 288
           L +L   +  +  +   +  +       +L+  D    MD++ +     + L D +  + 
Sbjct: 188 LQELQDTISREQLLVLSMAMHTGFRQETNLAPKDSELLMDSINVL----LELCDLQDSIA 243

Query: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-T 347
            Y+   +  VAPNL  L+G    A LI+ AG L  LS+  +  +  +G  K +   L   
Sbjct: 244 QYVASLISQVAPNLCALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFH 303

Query: 348 KGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQV 407
           +    + G IYHS  +S      + +  R +  K S+  R+D   + P    G   ++ V
Sbjct: 304 ESGVRQRGHIYHSSLVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDV 363

Query: 408 EQRLEFYATGTPTLKNEVAI 427
            +RL       P L N  A+
Sbjct: 364 LKRLRGL-LDPPNLSNTKAL 382

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 291 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGN 350
           +  ++  +APNL  L+G    + L+SH G L  LSK  +  +  +G +      +    N
Sbjct: 229 IANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN 288

Query: 351 TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
               G I+ +  +     +N  ++ R L++K S+A+R+D
Sbjct: 289 PG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVD 325

>Kpol_1063.5 s1063 complement(15045..15875) [831 bp, 276 aa] {ON}
           complement(15045..15875) [831 nt, 277 aa]
          Length = 276

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIK-DKASLNEDSLHDLSAILDNDAGVAERV 250
           Y W   E ++       FA +VLF K D++S N DS+H L  I +ND     RV
Sbjct: 127 YLWDLEEESR------DFAGVVLFKKSDQSSSNWDSIHVLEVIFENDVEATYRV 174

>Smik_2.319 Chr2 complement(572736..575303) [2568 bp, 855 aa] {ON}
           YBR179C (REAL)
          Length = 855

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 183 LDKDINTFAMRVKEWYGWH-FPELAKLVPDNYKFAQLVLFIKD-----KASLNEDSLHDL 236
           L + I+ ++++  + Y  H   EL  LVP N K+A L ++IKD       SL  +   D+
Sbjct: 250 LKEAIDMYSIQNPKTYEIHTLKELPDLVPQNEKYALLKIYIKDDKRPASTSLLRNGTVDI 309

Query: 237 SAILDNDAGVAERVIDNARISMGQDLSETDM--------DNVCIFAQRVVSLADYRKQLY 288
           S I  +  G+    +  A +   Q+  E D+        + + + A+  +SLA   K+L 
Sbjct: 310 SLI--DSPGLNMDSLQTAEVMSRQE--EIDLVIFVVNAENQLTLSAKEFISLASREKKLM 365

Query: 289 DYLCEKMHTV 298
            ++ +K   +
Sbjct: 366 FFVVKKFDKI 375

>Suva_4.430 Chr4 complement(756076..758643) [2568 bp, 855 aa] {ON}
           YBR179C (REAL)
          Length = 855

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 18/130 (13%)

Query: 183 LDKDINTFAMRVKEWYGWH-FPELAKLVPDNYKFAQLVLFIKD-----KASLNEDSLHDL 236
           L + ++ ++++  + Y  H   EL+ LVP N K+A L ++IKD       SL  +   D+
Sbjct: 250 LKEAVDMYSIQNPKTYEIHSLKELSDLVPQNEKYALLKVYIKDDKRPASTSLLRNGTVDI 309

Query: 237 SAILDNDAGVAERVIDNARISMGQDLSETDM--------DNVCIFAQRVVSLADYRKQLY 288
           S I  +  G+    +  A +   Q+  E D+        + + + A+  +SLA   K+L 
Sbjct: 310 SLI--DSPGLNMDSLQTAEVMSRQE--EIDLVIFVVNAENQLTLSAKEFISLASREKKLM 365

Query: 289 DYLCEKMHTV 298
            ++ +K   +
Sbjct: 366 FFVVKKFDKI 375

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 285 KQLYDYLCEKMHTVAPNLSELIGEVIGARLISHA 318
           K+LY+YL  K H      SEL  +++GA   +H+
Sbjct: 113 KELYEYLLAKKHIPLEECSELFSQIVGAVYYAHS 146

>Skud_2.305 Chr2 complement(553986..556553) [2568 bp, 855 aa] {ON}
           YBR179C (REAL)
          Length = 855

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 183 LDKDINTFAMRVKEWYGWH-FPELAKLVPDNYKFAQLVLFIKD-----KASLNEDSLHDL 236
           L + I+ ++++  + Y  H   EL  LVP N K+A L ++I+D       SL  +   D+
Sbjct: 250 LKEAIDMYSIQNPKTYEIHSLKELPNLVPQNEKYALLKIYIRDDKRPASTSLLRNGTVDI 309

Query: 237 SAILDNDAGVAERVIDNARISMGQDLSETDM--------DNVCIFAQRVVSLADYRKQLY 288
           S I  +  G+    +  A +   Q+  E D+        + + + A+  +SLA   K+L 
Sbjct: 310 SLI--DSPGLNMDSLQTAEVMSRQE--EIDLVIFVVNAENQLTLSAKEFISLASREKKLM 365

Query: 289 DYLCEKMHTV 298
            ++ +K   +
Sbjct: 366 FFVVKKFDKI 375

>YBR179C Chr2 complement(586547..589114) [2568 bp, 855 aa] {ON}
           FZO1Mitofusin; integral membrane protein involved in
           mitochondrial outer membrane tethering and fusion; role
           in mitochondrial genome maintenance; efficient tethering
           and degradation of Fzo1p requires an intact N-terminal
           GTPase domain; targeted for destruction by the ubiquitin
           ligase SCF-Mdm30p and the cytosolic ubiquitin-proteasome
           system
          Length = 855

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 183 LDKDINTFAMRVKEWYGWH-FPELAKLVPDNYKFAQLVLFIKD-----KASLNEDSLHDL 236
           L + I+ ++++  + Y  H   EL  LVP N K+A L ++IKD       SL  +   D+
Sbjct: 250 LKEAIDMYSIQNPKTYEIHTLKELPDLVPQNGKYALLKIYIKDDKRPASTSLLRNGTVDI 309

Query: 237 SAILDNDAGVAERVIDNARISMGQDLSETDM--------DNVCIFAQRVVSLADYRKQLY 288
           S I  +  G+    +  A +   Q+  E D+        + + + A+  +SLA   K+L 
Sbjct: 310 SLI--DSPGLNMDSLQTAEVMSRQE--EIDLVIFVVNAENQLTLSAKEFISLASREKKLM 365

Query: 289 DYLCEKMHTV 298
            ++ +K   +
Sbjct: 366 FFVVKKFDKI 375

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,558,481
Number of extensions: 1897602
Number of successful extensions: 6143
Number of sequences better than 10.0: 78
Number of HSP's gapped: 6302
Number of HSP's successfully gapped: 78
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)