Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_529.285.698ON61061031820.0
TPHA0O02000singletonON62060623050.0
TPHA0N01960singletonON59156622610.0
Suva_11.3295.698ON60160721520.0
Smik_11.3565.698ON60260321440.0
YKR093W (PTR2)5.698ON60154721360.0
KNAG0C065705.698ON59056521120.0
KLLA0E12915g5.698ON65460221130.0
SAKL0E14828g5.698ON59254721030.0
CAGL0G02453g5.698ON59756820800.0
TBLA0A091205.698ON63353420750.0
ZYRO0G06688g5.698ON61353320570.0
NDAI0E050205.698ON61956720300.0
NCAS0A032205.698ON61155220110.0
TDEL0B022305.698ON57456720010.0
TBLA0E01140singletonON61155320020.0
KAFR0H00230singletonON59660619510.0
KAFR0H002405.698ON59157018970.0
TBLA0B04710singletonON61550518880.0
Skud_11.3315.698ON39940015280.0
Kwal_47.16930na 1ON6115586402e-74
KLTH0D16544gna 1ON6265325931e-67
Ecym_2823na 2ON6135655581e-62
AGL365Cna 2ON5995745501e-61
AFR228WsingletonON5765074931e-53
TBLA0F01600singletonON567102820.27
TPHA0N01950singletonON601200780.89
NDAI0F01930singletonON564114770.98
TBLA0F021307.309ON88087715.4
ADL156Cna 3ON483131706.1
NDAI0F029202.138ON40477706.8
KNAG0D00130na 4ON56549698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_529.28
         (610 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...  1230   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   892   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   875   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   833   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   830   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   827   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   818   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   818   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   814   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   805   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   803   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   796   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   786   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   779   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   775   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   775   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      756   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   735   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            731   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   593   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   251   2e-74
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   233   1e-67
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   219   1e-62
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   216   1e-61
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   194   1e-53
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    36   0.27 
TPHA0N01950 Chr14 complement(415055..416860) [1806 bp, 601 aa] {...    35   0.89 
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               34   0.98 
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    32   5.4  
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    32   6.1  
NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.1...    32   6.8  
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...    31   8.1  

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/610 (97%), Positives = 596/610 (97%)

Query: 1   MSDSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYD 60
           MSDSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYD
Sbjct: 1   MSDSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYD 60

Query: 61  DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP 120
           DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP
Sbjct: 61  DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP 120

Query: 121 KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT 180
           KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT
Sbjct: 121 KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT 180

Query: 181 SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED 240
           SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED
Sbjct: 181 SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED 240

Query: 241 PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY 300
           PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY
Sbjct: 241 PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY 300

Query: 301 IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF 360
           IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF
Sbjct: 301 IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF 360

Query: 361 VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF 420
           VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF
Sbjct: 361 VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF 420

Query: 421 TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV 480
           TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV
Sbjct: 421 TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV 480

Query: 481 PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY 540
           PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY
Sbjct: 481 PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY 540

Query: 541 TWTFTGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTSIEVMEP 600
           TWTFTGLAVACFIAGCLFWICFRSYNNTE              KIMPTAGEKTSIEVMEP
Sbjct: 541 TWTFTGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTSIEVMEP 600

Query: 601 ITSFRSIKSL 610
           ITSFRSIKSL
Sbjct: 601 ITSFRSIKSL 610

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/606 (70%), Positives = 498/606 (82%), Gaps = 17/606 (2%)

Query: 10  SGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPT 69
           SGE E       +DS  D    I  K ++ +  N ++L+   V D+   Y+D   +VEPT
Sbjct: 27  SGEKE-------LDSSHDVTFNIDDKVENDT--NEEELDEFAVDDEADPYNDEWGYVEPT 77

Query: 70  EEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQ 129
           EEEM TLKHV+G IP RCWLIAVVELSERFSYYGL+APFQNYMANGPNDTPKG+L L+T 
Sbjct: 78  EEEMATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTN 137

Query: 130 GASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRE 189
           GA+ LSYFFQFWCYITPIFGGYMADTYW KYNTI  GT IY++GIF+LFIT++PSI T+E
Sbjct: 138 GATGLSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKE 197

Query: 190 TALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVF 249
           TA GG+VTAIILIGI TGMIKAN+SVL+AEQIP+ K RVIT K G+RVIEDP+IT QNVF
Sbjct: 198 TATGGFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVF 257

Query: 250 MFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKM 309
           MFFY+MIN+G+LS++ATTELESHKGFWAAYLLPFCFFWIAVV+LV+GRN YI+ PVGDK+
Sbjct: 258 MFFYLMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKV 317

Query: 310 ISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCV 369
           ISK FKV +I+ KNK NFD+AKPS+NPE  YPW+DKFV+EI R+++ACKVF+FYPIYWCV
Sbjct: 318 ISKCFKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCV 377

Query: 370 YGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKI 429
           YGQMINNF+TQAGTMELHN+PNDFLQ FDSI IIVFIPIFERF+YP +RRFTP +PITKI
Sbjct: 378 YGQMINNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKI 437

Query: 430 FWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAIS 489
           F GFM GS AM+WAAVLQSFIYKAGPCY+ PM C PEY N PN+VHVAWQ+PAYV+IA S
Sbjct: 438 FLGFMCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWS 497

Query: 490 EILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAV 549
           EI ASVTGLE+AYSNAP SMK+FIMSIFL TNA G+A+G+AISPT+ DPKYTW FTGLAV
Sbjct: 498 EIFASVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAV 557

Query: 550 ACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAG--EKTS---IEVMEPITSF 604
           +CF+AGCLFWICF  YN+ +               ++  +G  EKT+      +EPI S 
Sbjct: 558 SCFVAGCLFWICFHHYNDID---ADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISM 614

Query: 605 RSIKSL 610
           RS KSL
Sbjct: 615 RSAKSL 620

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/566 (73%), Positives = 489/566 (86%), Gaps = 9/566 (1%)

Query: 4   SLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQ 63
           SLT+  +    D S +S +D+K   EV +VS          +Q+++  + D+D E +D  
Sbjct: 2   SLTKLETHSNSDLSLSSQLDNKDKIEVHVVS--------TENQIDVHSLDDEDYEEEDED 53

Query: 64  DFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGV 123
             V PTEEE+KTL+HVSG IP+RCWLIA+VEL+ERFSYYGL+APFQNYMANGPNDTPKG+
Sbjct: 54  Y-VAPTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGL 112

Query: 124 LMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLP 183
           L L++ GA+A+SYFFQFWCY+TPIFGGYMADT+WGKYNTIC GTGIYV GIF+LF+TS+ 
Sbjct: 113 LQLNSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIE 172

Query: 184 SIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNI 243
           SI T+  A GGY+ AIILIGIATGMIK+NISVLIAEQ+P+ K RVIT   G+RVIEDP +
Sbjct: 173 SITTQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKL 232

Query: 244 TTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMV 303
           T QN+FMFFY+MIN+GSLS++ATTELE+HKGFWAAYLLPFCFFWIAVVVL++G+ QY+  
Sbjct: 233 TVQNIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRK 292

Query: 304 PVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFY 363
           PVGDK+ISK F + WI  KNKL+FD+AKPS +PE NYPW DKFVEE+RRA+RACKVF+FY
Sbjct: 293 PVGDKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFY 352

Query: 364 PIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPF 423
           PIYWCVYGQM+NNFVTQAGTMELH LPNDFLQA DSIAIIVFIPI E+F+YPF+R+FTPF
Sbjct: 353 PIYWCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPF 412

Query: 424 RPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAY 483
           R ITKIFWGFMFGS AMIWAAVLQSFIYKAGPC++ P+ CA +YA+TPNQVH+AWQVPAY
Sbjct: 413 RSITKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAY 472

Query: 484 VLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWT 543
           VLIA SEI AS+TGLEYAYSNAP SMKSFIMSIFL+T AFGSA+GIAISPT+ DPK+TW 
Sbjct: 473 VLIAFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWA 532

Query: 544 FTGLAVACFIAGCLFWICFRSYNNTE 569
           FTGLAV+CFIAGCLFWICFR YNNTE
Sbjct: 533 FTGLAVSCFIAGCLFWICFRKYNNTE 558

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/607 (64%), Positives = 482/607 (79%), Gaps = 20/607 (3%)

Query: 2   SDSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNS-DQLEITKVGDDDIEYD 60
           SD +     GE         ++ +++  V +   + S    NS ++  ++   +D+    
Sbjct: 9   SDDIQDEKQGEF------PVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDN---- 58

Query: 61  DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP 120
              +F  PT+EE+++L+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPNDTP
Sbjct: 59  ---EFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTP 115

Query: 121 KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT 180
           KG+L L++ GA+ LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFIT
Sbjct: 116 KGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFIT 175

Query: 181 SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED 240
           S+PS+  R++ALGG++ +IILIGIATGMIKAN+SVLIA+Q+P+ KP +   K G+RVIED
Sbjct: 176 SIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIED 235

Query: 241 PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY 300
            NIT QNVFMFFY MINVGSLSLMATTELE HKGFWAAYLLPFCFFW+AVV LV G+ QY
Sbjct: 236 GNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQY 295

Query: 301 IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF 360
           I  P+GDK+I+KSFKV WIL KNK +F+AAKPS++PEK+YPWNDKFV+EI+RAL ACKVF
Sbjct: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVF 355

Query: 361 VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF 420
           VFYPIYW  YG MI++F+TQA  MELH +PNDFLQAFDSIA+I+FIPIFE+F YPF+RR+
Sbjct: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRY 415

Query: 421 TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV 480
           TPF+PITKIF+GFMFGS AM WAAVLQSF+YKAGP Y+ P+       NTPN VHV WQ+
Sbjct: 416 TPFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQI 470

Query: 481 PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY 540
           PAYVLI+ SEI AS+TGLEYAYS APA+MKSFIMSIFL+TNAFGSAIG A+SP   DPK+
Sbjct: 471 PAYVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKF 530

Query: 541 TWTFTGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTS-IEVME 599
           TW FTGLAVACFI+GCLFW+CFR YN+TE               + P +  K + IE++E
Sbjct: 531 TWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILE 590

Query: 600 PITSFRS 606
           P+ S +S
Sbjct: 591 PMGSLKS 597

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/603 (66%), Positives = 483/603 (80%), Gaps = 16/603 (2%)

Query: 8   RTSGELEDDSFASH--IDSKQDHEVKIVSKFDSTSLQNS-DQLEITKVGDDDIEYDDNQD 64
           R+S E++D+       I+ ++ H V +   + S  + NS +Q  ++   +D       +D
Sbjct: 7   RSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPED-------ED 59

Query: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124
           F  PTEEE KTL+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPND+PKGVL
Sbjct: 60  FEAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119

Query: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184
            L++QGA+ LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFITS+PS
Sbjct: 120 GLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244
           +  R++A+GG++ AIILIGIATGMIKANISVLIA+Q+P+ KP +   K G+RVI D NIT
Sbjct: 180 VGNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNIT 239

Query: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304
            QNVFMFFY MINVGSLSLMATTELE HKGFWAAYLLPFCFFWIAVV L+ G+ QYI  P
Sbjct: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299

Query: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364
           +GDK+++KSF+V WIL KNK +F+AAKPS++PE+NYPWNDKFV+EI+RAL ACKVFVFYP
Sbjct: 300 IGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYP 359

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424
           IYW  YG MI++F+TQA  MELH +PNDFLQAFDSIA+IVFIPIFE+F+YPF+RR+TP +
Sbjct: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLK 419

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484
           PITKIF+GFMFGS AM WAAVLQSF+YKAGP YN P+       NTPN +HV WQ+PAYV
Sbjct: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYV 474

Query: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544
           LI+ SEI AS+TGLEYAYS APASMKSFIMSIFL+TNAFGSAIG A+SP   DPK+TW F
Sbjct: 475 LISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLF 534

Query: 545 TGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTS-IEVMEPITS 603
           TGLAVACFI+GCLFW+CFR YN+TE               +   +  K + IE++EP  S
Sbjct: 535 TGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTES 594

Query: 604 FRS 606
            RS
Sbjct: 595 LRS 597

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/547 (71%), Positives = 462/547 (84%), Gaps = 6/547 (1%)

Query: 61  DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP 120
           +++DF  PTEEEM+TL+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPND+P
Sbjct: 56  EDEDFEGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSP 115

Query: 121 KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT 180
           KGVL L++QGA+ LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFIT
Sbjct: 116 KGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175

Query: 181 SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED 240
           S+PS+  R++A+GG++ AIILIGIATGMIKAN+SVLIA+Q+P+ KP +   K G+RVI D
Sbjct: 176 SIPSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVD 235

Query: 241 PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY 300
            NIT QNVFMFFY MINVGSLSLMATTELE HKGFWAAYLLPFCFFWIAVV L+ G+ QY
Sbjct: 236 SNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQY 295

Query: 301 IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF 360
           I  P+GDK+I+KSFKV WIL KNK +F+AAKPS++PEKNYPWNDKFV+EI+RAL ACKVF
Sbjct: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVF 355

Query: 361 VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF 420
           +FYPIYW  YG MI++F+TQA  MELH +PNDFLQAFDSIA+I+FIPIFE+F+YPF+RR+
Sbjct: 356 IFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRY 415

Query: 421 TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV 480
           TP +PITKIF+GFMFGS AM WAAVLQSF+YKAGP YN P+       NTPN VHV WQ+
Sbjct: 416 TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQI 470

Query: 481 PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY 540
           PAYVLI+ SEI AS+TGLEYAYS APASMKSFIMSIFL+TNAFGSAIG A+SP   DPK+
Sbjct: 471 PAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKF 530

Query: 541 TWTFTGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTS-IEVME 599
           TW FTGLAVACFI+GCLFW+CFR YN+TE               + P +  K + IE++E
Sbjct: 531 TWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILE 590

Query: 600 PITSFRS 606
           P+ S RS
Sbjct: 591 PMESLRS 597

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/565 (67%), Positives = 468/565 (82%), Gaps = 18/565 (3%)

Query: 7   RRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDN--QD 64
           R+ +   EDDS    +D K D    +++K +S +++   ++    V D   +Y+D+  + 
Sbjct: 4   RQVNTFSEDDS----LDKKND---LVLTKENSHTIEEDSRI----VDDLASQYEDDIPEG 52

Query: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124
           +  PTEEE++TLKHV G IPMRCWLIAVVELSERFSYYGL+APFQNYMANGP+D P G+L
Sbjct: 53  YEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLL 112

Query: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184
            L++ GA+ LSYFFQFWCY+TPIFGGYMADT+WGKYNTI  GTGIY+ GIF+LF+TS+PS
Sbjct: 113 QLNSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPS 172

Query: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244
           I T+   LGG++ AIILIGIATGMIK+N+SVLIA+Q+P+ KP V T+K G+RVIED N+T
Sbjct: 173 ITTKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLT 232

Query: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304
            QNVFMFFY+MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVVVLV+G+NQY+  P
Sbjct: 233 LQNVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPP 292

Query: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364
           +GDK+ISK FKV+WIL KN+ NFDA KPS+NP KNYPW+DKFV+EI+RAL ACKVF+FYP
Sbjct: 293 IGDKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYP 352

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424
           IYW  YGQM++ FVTQ   MELH LPNDF Q  DSIAIIVFIP+ E  +YPF+R++TPFR
Sbjct: 353 IYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFR 412

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484
           PITKI++GFMF SG MIWAAVLQS+IYKAGP Y  P++      + PN++HVA QVPAYV
Sbjct: 413 PITKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYV 467

Query: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544
           L+A SEI AS+TGLEYAYS APASMKSFIMSIFLVTNAFGSAIG A+SP ++DP +TW +
Sbjct: 468 LLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLY 527

Query: 545 TGLAVACFIAGCLFWICFRSYNNTE 569
           TGLAVACFI+GCLFW+CFR YN+ E
Sbjct: 528 TGLAVACFISGCLFWVCFRKYNDIE 552

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/602 (63%), Positives = 477/602 (79%), Gaps = 20/602 (3%)

Query: 10  SGELEDDSFASHIDSK----QDHEVKIVSKFDSTSLQNSDQLE-ITKVGDDDIEYDDNQD 64
           +GE +D+ F ++ D K    +DH              +SD+++ I  V +DD   + N++
Sbjct: 49  TGEKKDEKFKNNTDIKVYISKDHHA------------SSDKIDFIGAVDEDD---NQNEN 93

Query: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124
             EPTEEE+ TL+HVS +IP  CWLIA+VEL+ERFSYYGL+APFQNYM NGPNDTPKGVL
Sbjct: 94  GREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVL 153

Query: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184
            L +QGA+ALSYFFQFWCY+TP+ GGY+ADT+WGKYNTIC G   YVVGI +LF+T++PS
Sbjct: 154 QLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPS 213

Query: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244
           I+ + ++LGG++ ++I+IGI TG IKAN+SVLIA+QIP+T+PR+   K G++VIEDPN+T
Sbjct: 214 INDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVT 273

Query: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304
            QNVFMFFY+MIN+GSLS+MATT LE+  GFWAAYLL FCFFW+ +VVLV GR +Y+  P
Sbjct: 274 MQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRP 333

Query: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364
           +GD +I++ FK+ WI + N  N + A PS+NPEK YPWND F++EIRRA +ACKVF FYP
Sbjct: 334 IGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYP 393

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424
           IYW VYGQM+NNFVTQAGTMELH LPNDFLQA +SIA+IVFIPI E+FIYPF+RRFTPFR
Sbjct: 394 IYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFR 453

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484
           P+TKIF GF FGS AM++AAVLQ FIYKAGPCY+ PM CAPEYANTPN+VH+ WQVPAYV
Sbjct: 454 PVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYV 513

Query: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544
           LI++SEI AS+TGLEYAYS APA+MK+FIMSIFLVTNA GSA+GIA+SPTA++PKY WTF
Sbjct: 514 LISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTF 573

Query: 545 TGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTSIEVMEPITSF 604
           +GLAVACFIAGCLFW+CF  YN  E              +++   G       +  ++S 
Sbjct: 574 SGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAALYSVSSV 633

Query: 605 RS 606
           RS
Sbjct: 634 RS 635

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/547 (69%), Positives = 467/547 (85%), Gaps = 1/547 (0%)

Query: 24  SKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQDF-VEPTEEEMKTLKHVSGK 82
           +K + EV + S  +++  + +       V D +   + + D   EPT+EEMKTL+HVS +
Sbjct: 9   NKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQ 68

Query: 83  IPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWC 142
           IP+RCWL+AVVEL+ERFSYYGL+APFQNYM NGPNDTPKG+L L  QGA+ALSYFFQFWC
Sbjct: 69  IPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWC 128

Query: 143 YITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILI 202
           Y++P+ GG++ADTYWGKY TIC GTGIYVVGIF+LFITS+PSI     +LGG++T++ILI
Sbjct: 129 YVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILI 188

Query: 203 GIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLS 262
           G+ATGMIKANISVLIA+QIP+++P V   K G+RVIEDPNIT QN+FMFFY+MIN+GSLS
Sbjct: 189 GLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLS 248

Query: 263 LMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVK 322
           ++ATTE+E+H GFWAAYLLPFCFF++AV VL++GRNQY+ +PVGDK+ISKSFKV WI+++
Sbjct: 249 VIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308

Query: 323 NKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAG 382
           NK  FDAA+PS+NPE  YPW+DKF++EI+RA+ ACKVFVFYPIYW  YGQM++NFV+QAG
Sbjct: 309 NKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAG 368

Query: 383 TMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIW 442
            MELH LPNDFLQA DSIA+IVFIPI ERF+YPF+RRFTPFRPITKIF+GF+FG+ AM W
Sbjct: 369 MMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAW 428

Query: 443 AAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAY 502
           AAVLQ FIYKAGPCY  PM CAPEY NTPN++H+AWQVPAYVLIA SEI AS+TGLEYAY
Sbjct: 429 AAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAY 488

Query: 503 SNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICF 562
           S AP SM+SFIMSIFL+T AFGSA+GIA+S  + +PK+ WTF+GLAV+CFIAGCLFW  F
Sbjct: 489 SKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFF 548

Query: 563 RSYNNTE 569
             YN+TE
Sbjct: 549 HKYNDTE 555

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/568 (67%), Positives = 461/568 (81%), Gaps = 23/568 (4%)

Query: 16  DSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDD-------------- 61
           + F+   D K   EV+     D +S+ ++   E+ ++ D +I + D              
Sbjct: 3   NRFSKRNDEKNAVEVQK----DVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGE 58

Query: 62  NQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPK 121
           + DF  PTEEE+KTL+HV+G IP+RCWLIA+VELSERFSYYGL+APFQNYM NGPND PK
Sbjct: 59  DDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPK 118

Query: 122 GVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITS 181
           G+L L +QGA+ LSYFFQFWCY+TP+FGG+++DTYWGKYNTIC GT IYV GIF+LFITS
Sbjct: 119 GLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITS 178

Query: 182 LPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDP 241
           +P +   + ALGG++ AIILIGIATGMIK+N+SVLIA+Q+P  KPRV+  K G+RVIEDP
Sbjct: 179 IPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDP 238

Query: 242 NITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYI 301
           N+T QNVFMFFY  INVGSLS+MATTELE HKGFWAAYLLPFCFFW+AV VLV GRNQYI
Sbjct: 239 NLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYI 298

Query: 302 MVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFV 361
             PVGDK+ISKSFKV++IL KNK N +AAKPS NP+KN+PW+DKFV+EI+RAL+ACKVFV
Sbjct: 299 KPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFV 358

Query: 362 FYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFT 421
           FYP+YW  YG M+NNFVTQ GTMELHNLPNDFLQAFDSIA+I+FIPIFERF+YPF+RR+T
Sbjct: 359 FYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYT 418

Query: 422 PFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVP 481
           P RPITKIF+GFM GSGAM+WAAVLQ FIY  GP Y+ P+       +TPN +HVAWQ+P
Sbjct: 419 PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIP 473

Query: 482 AYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYT 541
           AYVLIAISEI AS+TGLEYAYS AP SMKSFIMSIFL+TNAFGSAIG A+SP + DPK+ 
Sbjct: 474 AYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFV 533

Query: 542 WTFTGLAVACFIAGCLFWICFRSYNNTE 569
           W +TGLA ACFIAG +FW  +   N+ E
Sbjct: 534 WFYTGLACACFIAGWVFWFIYSGLNDEE 561

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 443/534 (82%), Gaps = 7/534 (1%)

Query: 73  MKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGAS 132
           ++TLKHV GKIP+RCWL+AV+EL+ERFSYYGL+APFQNYM NGPND+P G L LD+ GA+
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 133 ALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETAL 192
            LSYFFQFWCY+TP+F GYMADTYWGK+ TIC GTGIY+VGIF+LFITSLPSI +  TA+
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 193 GGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFF 252
           GG++  +IL+GIATGMIKAN+SV+IAEQIP+ K RVIT+K G RVIEDP+IT QNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 253 YMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISK 312
           Y MIN+GSLS++ATTELE+HKGFWAAYLLPFCFFW+AV+VL++G   YI  PVGDK+ISK
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 313 SFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQ 372
            FKV+ IL++N+ N D+AKP+ NP+KNYPW+DKFV+EI RAL+ACKVFVFYPIYW  YGQ
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 373 MINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWG 432
           M+NNFV+Q GTMELH LPNDF QA DSIA+IVFIPI ERF+YPF+R++TPF+PITKIFWG
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 433 FMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEIL 492
           F FG+ +M WA VLQ FIYKA PCY+ P KC     N PN +HVA QVPAY L+A+SEI 
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIF 503

Query: 493 ASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACF 552
           AS+TGLEYAYS APASMK+FIMSIFLVTNAFG+AIG A+SP ++DPKY W + GLAVACF
Sbjct: 504 ASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACF 563

Query: 553 IAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTSIEVMEPITSFRS 606
           + GCLFWI F+ YN+ E                   AG+   IE+++PI+S RS
Sbjct: 564 VGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGD---IEMIQPISSRRS 614

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/533 (68%), Positives = 445/533 (83%), Gaps = 7/533 (1%)

Query: 37  DSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELS 96
           +  SL+ S   E  ++  D+ E  ++    EPTEEE+++L+HV G IP RCWLIA+VELS
Sbjct: 19  EDKSLEVSGSHERGELDFDEYEVPNDD---EPTEEELRSLRHVGGHIPFRCWLIAIVELS 75

Query: 97  ERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTY 156
           ERFSYYGL+APFQNYM NG +D P GVL L +QGA+ L+YFFQFWCY+TP+FGG++ADTY
Sbjct: 76  ERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTY 135

Query: 157 WGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVL 216
           WGKY TIC GTG+YVVGIF+LFITSLPS+D++ TALGG++TAI+LIGIATGMIKAN+SVL
Sbjct: 136 WGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVL 195

Query: 217 IAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFW 276
           IA+Q P+ KPR+ T K G+RVIEDPNIT QNVFMFFY+MIN+GSLS++ATTELE HKGFW
Sbjct: 196 IADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFW 255

Query: 277 AAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNP 336
           AAYLLPFCFFWIAV+VL +GR  Y+  PVGDK+I+KSF+V+  L+K++ +++A KPS++P
Sbjct: 256 AAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHP 315

Query: 337 EKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQA 396
           E++YPWND FVEEI+RAL+ACKVF+FYPIYW  YGQM + FV+  G M+LH LPNDF QA
Sbjct: 316 ERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQA 375

Query: 397 FDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPC 456
            DSIA+IVFIPI E ++YPF+RR+TPF+PITKIF+GFM+ S +MIWAAVLQ FIYK GPC
Sbjct: 376 IDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPC 435

Query: 457 YNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSI 516
           Y+ PM C     N PN +H+ WQVPAYVLIA SEI AS+TGLEYAYS AP SMKSFIMSI
Sbjct: 436 YDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSI 491

Query: 517 FLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNNTE 569
           FL+TNAFGSAIG A+SP   DPKY W FTGLAVA FI+GCLFW+ F   N+TE
Sbjct: 492 FLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTE 544

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/567 (64%), Positives = 449/567 (79%), Gaps = 16/567 (2%)

Query: 3   DSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDN 62
           + +   T+ + E ++  S  + K  H+V      ++ +L NS         DD++E    
Sbjct: 21  EKIEEITTTKKETNATTSSTEEKL-HDV------ETYNLSNSANDSTNDFDDDEME---- 69

Query: 63  QDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKG 122
           + + EPT+EE+ TLK V GKIP+RCWLI VVEL+ERFSYYGL+APFQNYM NGPND+PKG
Sbjct: 70  EGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKG 129

Query: 123 VLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSL 182
           VLML++ GA+ LSYFFQFWCY+TP+FGG++ADTYWGKYN+I  GTG Y+VGIF+LFIT++
Sbjct: 130 VLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAI 189

Query: 183 PSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPN 242
           PSI ++  +LGG++ +IILIGI TG IKAN+SVLIA+Q+P+ KPRV   K G+RVIEDPN
Sbjct: 190 PSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPN 249

Query: 243 ITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIM 302
           IT QNVFM FY+MIN+GS+S+MATTELESHKGFWAAYLLPFCFFWIAVV+LV GR  Y+ 
Sbjct: 250 ITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVK 309

Query: 303 VPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVF 362
             +GD ++ KSFKV WI+ KNKL+++AAKPS +PE+NYPWND+FV+E++R + ACKVFVF
Sbjct: 310 EKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVF 369

Query: 363 YPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTP 422
           YPIYW  YG MI+ FVTQ  TMELH +PNDFLQ FDSIA+I+FIPIFE F+YPF+RRFTP
Sbjct: 370 YPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTP 429

Query: 423 FRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPA 482
            RPITKI  GF  G  AM WAAVLQ FIY  GPCY+ P+ C     +TPN++HVAWQ+PA
Sbjct: 430 IRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPA 484

Query: 483 YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTW 542
           YVLIA SEI AS+TGLEYAYS AP SMKSF+MSIFL+TNAFGS +GIA+S    DPK+ W
Sbjct: 485 YVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVW 544

Query: 543 TFTGLAVACFIAGCLFWICFRSYNNTE 569
            F GLAV+C + G LFW+CFR  N TE
Sbjct: 545 LFGGLAVSCGVTGILFWLCFRGLNATE 571

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/552 (67%), Positives = 446/552 (80%), Gaps = 8/552 (1%)

Query: 39  TSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSER 98
           +S +  D+LE   +  D+   +    +  PTEE+M+TL+HVSGKIP+RCWLIA+VEL+ER
Sbjct: 42  SSEEVHDELETYHIHHDE---ECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAER 98

Query: 99  FSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWG 158
           FSYYGL+APFQNYM NGPNDTP GVL L++ GA+ LSYFFQFWCY+TP+FGG+MADTYWG
Sbjct: 99  FSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWG 158

Query: 159 KYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIA 218
           KYNTIC GTGIY+ GIF+LFITS+PSI +++T+LGG++ AIILIGIATGMIKAN+SVLIA
Sbjct: 159 KYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIATGMIKANLSVLIA 218

Query: 219 EQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAA 278
           +Q+P+ KPRV T K G+RV+EDPNIT QNVFM+FY+M+NVGSLS++ATTELE HK FWAA
Sbjct: 219 DQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAA 278

Query: 279 YLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEK 338
           +LLPFCFFWIAVVVLV GRNQY+     +K I KSFK++WI+ KNK +  +AKPS +PEK
Sbjct: 279 FLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEK 338

Query: 339 NYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFD 398
           NYPW DKFV+E  RAL ACKVF+FYPIYW +YG MI+ FVTQ   MELH LPND  QA D
Sbjct: 339 NYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAID 398

Query: 399 SIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYN 458
           S A+I+FIPI ERFIYPF+RRFTPF+PITKIF+GFMF +GAM+W+ VLQSFIYKAGP Y+
Sbjct: 399 SFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYD 458

Query: 459 MPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFL 518
            P+         PN++HV WQVPAYVLIA SEILAS+TGLEYAYS AP SMKSFIMS+FL
Sbjct: 459 HPLN-----GGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFL 513

Query: 519 VTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXX 578
            +NA GS +GIA+SP + DPK+TW F GL VACFI GC+FWI FR YN+TE         
Sbjct: 514 FSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEEEMNAMDYE 573

Query: 579 XXXXXKIMPTAG 590
                + M +AG
Sbjct: 574 DEEDLREMESAG 585

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/567 (65%), Positives = 446/567 (78%), Gaps = 36/567 (6%)

Query: 3   DSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDN 62
           DS+ ++ + E+ DD     I S    EV+                           YDD 
Sbjct: 13  DSVEKQKAVEVVDDKLVEVISSHNGLEVE--------------------------SYDD- 45

Query: 63  QDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKG 122
               EPTEEEMKTLKHV+G IP RCWLIAVVELSERF+YYGL+ PFQNYM NGP+DTP G
Sbjct: 46  ----EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAG 101

Query: 123 VLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSL 182
           +L L +QGA+ LSYFFQFWCY+TPIFGG+++DTY GKYNTIC GTG+YV+GI +LF+TS+
Sbjct: 102 LLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSI 161

Query: 183 PSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPN 242
           PSI T+  A GG++ AIILIGIATGMIK+NISVLIA+Q P+ + RVIT+K G RVIEDPN
Sbjct: 162 PSITTQNAATGGFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPN 221

Query: 243 ITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIM 302
           IT QNVFM FY+MIN+GSLS++ATTELE+H GFWAAYLLPFCFFWIAV+VL +G+N Y+ 
Sbjct: 222 ITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVK 281

Query: 303 VPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVF 362
            PVGDK+ISK FKV+ I +KNK NF+AAKPS++P++ +PW DKFV+EI R+L ACKVF+F
Sbjct: 282 PPVGDKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLF 341

Query: 363 YPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTP 422
           YP+YW  YGQM+N FV+  GTMELH LPNDF QA DSIA+IVFIPI E F+YP++R+FTP
Sbjct: 342 YPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTP 401

Query: 423 FRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPA 482
           FRPITKIFWGFMFG+ AM+WAAVLQ FIYK+GP Y  PM       NTPN +H+AWQVPA
Sbjct: 402 FRPITKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPA 456

Query: 483 YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTW 542
           YVLIA SEI AS+TGLEYAYS AP +MKSFIM+IFL+TNAFGSAIG A+SP  +DP Y W
Sbjct: 457 YVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVW 516

Query: 543 TFTGLAVACFIAGCLFWICFRSYNNTE 569
            + GL VACF AG LFW CF+ YN+TE
Sbjct: 517 LYVGLGVACFAAGWLFWFCFKHYNDTE 543

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/553 (66%), Positives = 440/553 (79%), Gaps = 14/553 (2%)

Query: 23  DSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQD------FVEPTEEEMKTL 76
           D+K D     +++ +  S+ ++    I +   ++  Y+ + D      F+EPTEEEM+TL
Sbjct: 24  DNKDDKNYNFITEDEPNSIAST----IIEGNSNEENYNRSTDDDDDEDFIEPTEEEMRTL 79

Query: 77  KHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSY 136
           K V G IP RCWL+AV+ELSERFSYYGL+APFQNYM NGP DTP G L L+TQGA+ LSY
Sbjct: 80  KRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGLSY 139

Query: 137 FFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYV 196
           FFQFWCYITPIFGGYMADTYWGKYNTI  G   Y+ GIF+LF+TSLP + +   A+GG++
Sbjct: 140 FFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGGFI 199

Query: 197 TAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMI 256
            +II+IG+ TGMIKAN+SV+IAEQ+P+ K R+IT+K G RVIEDP+IT QNVFM FY MI
Sbjct: 200 VSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFMI 259

Query: 257 NVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKV 316
           NVGSLS+MATTELE+ KGFWAAYLLPFCFFW+AVVVL+IG  ++I VP+GDK ISKSFKV
Sbjct: 260 NVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFKV 319

Query: 317 MWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINN 376
           + IL+KNK N+++AKPS++PE NYPW DKFVEEIRRA++AC VF FYPIYW  YGQM+NN
Sbjct: 320 VGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLNN 379

Query: 377 FVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFG 436
           FVTQ G MELH+LPNDFLQ  DSIA+IVFIPI ER IYPFVRRFTP RPITKI  GF FG
Sbjct: 380 FVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFFG 439

Query: 437 SGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVT 496
           S +M+WAAVLQ F+Y+  PCY  P  C     N PN +HV WQVPAY LIA+SEI AS+T
Sbjct: 440 SFSMVWAAVLQWFVYQKPPCYYHPTNC----PNGPNHIHVCWQVPAYCLIALSEIFASIT 495

Query: 497 GLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGC 556
           GLEYAYS APASMKSFIMSIFL T A GSA+G A+SP + DPK+TW + GLAV+CFIAG 
Sbjct: 496 GLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGI 555

Query: 557 LFWICFRSYNNTE 569
            FW+CF  YN+ E
Sbjct: 556 AFWLCFSRYNDEE 568

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/606 (60%), Positives = 448/606 (73%), Gaps = 25/606 (4%)

Query: 19  ASHIDSKQDHEVKIVSK------FDSTSLQNSDQL---EITKVGDD---DIEYDDNQD-- 64
           +SH +S++  ++ +++          T++ + DQ+   E  K+ +D   D E+ D Q+  
Sbjct: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61

Query: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124
           +  PTEEE++TL+HVSG+IP RC+LIAVVELSERFSYYGL+APFQNYMAN P+D+P GVL
Sbjct: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121

Query: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184
            L++ GA+ LSYFFQFWCYITP+ GGY+ADT WG+YNTI  GTGIY+VGIF+LFITS  S
Sbjct: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181

Query: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244
           I  +  ALGG++ A+ILIGI TG IKAN+SVLIA+QIP  +PRV T K G+RVIED +IT
Sbjct: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241

Query: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304
            QNVFMFFY+MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+VLV+GR  Y + P
Sbjct: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301

Query: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364
             D++I KSFK  W L KNK N+ A  P+ NPE  + W+DKFVEEIR AL ACKVF+FYP
Sbjct: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424
           IYW  YGQM NNFVT    ++LH LPND  QA DSIA+IVFIPI E+F YPF+RRFTPFR
Sbjct: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484
           PITKI +GF   S +M+WA VLQ FIYK GP Y  P+      A+ PN VHVAWQVPAYV
Sbjct: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYV 475

Query: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544
           LIA SEI AS+TGLEYAYS APASMKSFIM++FL  NAFGSAIG A+SP ++DP YTW +
Sbjct: 476 LIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY 535

Query: 545 TGLAVACFIAGCLFWICFRSYNNTEXXXXXXXXXXXXXXKIMPTAGEKTSIEVMEPITSF 604
            GLAV  FI GC FW CFR YN+ E                         IE++ P++++
Sbjct: 536 CGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDI-----ITENNQDIEMVHPLSAY 590

Query: 605 RSIKSL 610
            S KSL
Sbjct: 591 TSPKSL 596

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/570 (60%), Positives = 437/570 (76%), Gaps = 30/570 (5%)

Query: 19  ASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDD--------------NQD 64
           ++HI +  D      S  +++  +N  +L+ TKV   D E+ D              ++D
Sbjct: 2   STHIATNDDP-----SSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHED 56

Query: 65  FVE-----PTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDT 119
           + E     PT++EMKTL+ V G+IP RC+L+A+VEL+ERFSYYGL+APFQNYM NGP D+
Sbjct: 57  YQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDS 116

Query: 120 PKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFI 179
           P GVL L++ GA+ LSYFFQFWCYITPIFGGY+ADT WG+YNTI  GT IY++GIF+LFI
Sbjct: 117 PPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFI 176

Query: 180 TSLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIE 239
           TS  ++  R+ AL G++ A+ILIG ATG+IK+N+SVLIA+QIP  +PRV T K G+RVIE
Sbjct: 177 TSFKTVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIE 236

Query: 240 DPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQ 299
           D ++T QNVFMFFY+MIN+GSLS++ATTELE + GFWAAYLLPFCFFWIAV+V+V G+ Q
Sbjct: 237 DHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQ 296

Query: 300 YIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKV 359
           YI+ P GD++I+KSFKV WIL KNK +  +AKPS +PE  +PW DKFV+EI+RAL ACKV
Sbjct: 297 YIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKV 356

Query: 360 FVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRR 419
           F+FYPIYW  YGQM+NNF+T    M+LH LPND  QA +SI++I+FIPI E+F+YPF+RR
Sbjct: 357 FLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRR 416

Query: 420 FTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQ 479
           FTP RP+T+IF GF+F + AM+W+ VLQ FIY  GP YN P++         N +HV WQ
Sbjct: 417 FTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIHVGWQ 470

Query: 480 VPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPK 539
           VPAYV IA SEI AS+TGLEYAYS APA+MKSFIM++FL  NAFGSAIG A+SP ++DP 
Sbjct: 471 VPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPD 530

Query: 540 YTWTFTGLAVACFIAGCLFWICFRSYNNTE 569
           YTW +  LAVACF++G +FW+CFR YN  E
Sbjct: 531 YTWLYGSLAVACFLSGLIFWLCFRKYNKIE 560

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/505 (68%), Positives = 421/505 (83%), Gaps = 5/505 (0%)

Query: 66  VEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLM 125
           +EPTEEE+KTL   +G IP  CWL+A++EL+ERFSYYGL+APFQNYM N P+D P G L 
Sbjct: 65  IEPTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALS 124

Query: 126 LDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSI 185
           L++ GA+ LSYFFQFWCY+TPIF G+MADTYWGK+NT+C GT IY++GIF+LFITSLP+I
Sbjct: 125 LNSTGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAI 184

Query: 186 DTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQK-GGKRVIEDPNIT 244
            +  TALGG++ AIILIGIATGMIKAN+SV+IA+Q+P+ K RV+T+K  GKRVIEDP +T
Sbjct: 185 TSYNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLT 244

Query: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304
            QNVFM FY MINVGSLS++ATTELE H GFWAAYLLPFCFFWIAV+VL  G  +++  P
Sbjct: 245 IQNVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKP 304

Query: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364
           +GD++ISK F ++ IL+KN  NF  AKP+ NPEKNYPW+DKFV+EI+R+L+ACKVF+FYP
Sbjct: 305 IGDRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYP 364

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424
           IYW  YGQM+NNFVTQ  TM+LH LPNDF QA +SIA+IVFIPI E+F+YPF+R+FTP +
Sbjct: 365 IYWVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLK 424

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484
           PITK+  GF+FGS AM+WAAVLQ FIY+AGPCY+ P+KC     N PN VHVAWQVPAY 
Sbjct: 425 PITKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKC----PNGPNHVHVAWQVPAYC 480

Query: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544
           LI++SEI AS+TGLE AYS AP SMKSFIMS+FLVTNAFG+AIG A+S  ++DPKY W +
Sbjct: 481 LISLSEIFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLY 540

Query: 545 TGLAVACFIAGCLFWICFRSYNNTE 569
           TGLAV CF AG  FW  F+ YN+ E
Sbjct: 541 TGLAVTCFCAGIAFWFTFKHYNDEE 565

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/400 (69%), Positives = 330/400 (82%), Gaps = 6/400 (1%)

Query: 208 MIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATT 267
           MIKAN+SVLIA+Q+P+ KP +   K G+RV+ DPNIT QNVFMFFY MINVGSLSLMATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 268 ELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNF 327
           ELE HKGFWAAYLLPFCFFWIAVV L++G+ QYI  P+GDK+I+KSF+V WIL KNK +F
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 328 DAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELH 387
           +AAKPS++PE++YPWNDKFV+EI+RAL ACKVF+FYPIYW  YG MI++F+TQA  MELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 388 NLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQ 447
            +PNDFLQAFDSIA+I+FIPIFE+FIYPF+RR+TPF+PITKIF+GFMFGS AM WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 448 SFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPA 507
           SFIYKAGP Y+ P+       NTPN+VHV WQ+PAYVLI+ SEI AS+TGLEYAYS APA
Sbjct: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295

Query: 508 SMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNN 567
           SMKSFIMSIFL+T AFGSAIG A+SP   DPK+TW FTGLAVACFI+GCLFW CFR YN+
Sbjct: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355

Query: 568 TEXXXXXXXXXXXXXXKIMPTAGEKTS-IEVMEPITSFRS 606
           TE               + P +  K + IE++EP+ S RS
Sbjct: 356 TEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 395

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  251 bits (640), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 172/558 (30%), Positives = 266/558 (47%), Gaps = 44/558 (7%)

Query: 40  SLQNSDQLEITKVGDDDIEYD--DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSE 97
           S +  +Q  + ++     ++D  D Q F EPTE E   L+ V G      + I ++E SE
Sbjct: 2   SSEKKNQYAVAEIDGHSEDFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSE 61

Query: 98  RFSYYGLAAPFQNYMAN-------------GPNDTPKGVLMLDTQGASALSYFFQFWCYI 144
           R SYYG      N++                 ++   G L +  Q A+AL+    F  Y 
Sbjct: 62  RASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYC 121

Query: 145 TPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSI-DTRETALGGYVTAIILIG 203
            P+  GY+AD YWG+   +  G  + +V   +  I SLP +      AL   +  II + 
Sbjct: 122 FPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLA 181

Query: 204 IATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSL 263
           IAT  +K  +   +  Q P     V T   G+RVI D + + Q + M FY  INVGS   
Sbjct: 182 IATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLS 241

Query: 264 MATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIM--VPVGDKMISKSFKVM---- 317
           +AT+      G+W A+L+P   F I   VL++ R +YI    P G  +I+   KV+    
Sbjct: 242 VATSYSARDVGYWLAFLIPLALFMIMPAVLLVLR-RYIKDEPPSGRSLIADCLKVLKVCF 300

Query: 318 ----WILVKNKLNFDAAKPS-------MNPEKNYP--WNDKFVEEIRRALRACKVFVFYP 364
               W   +    +D AKPS           K+ P  + +  V++ R  + AC +F++Y 
Sbjct: 301 ERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVTISACTIFLYYV 360

Query: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFT-PF 423
           IY    G + +   +Q  ++    +PND +  F+ + IIVF+PI +R +YP +R+    F
Sbjct: 361 IYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNF 420

Query: 424 RPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVP-A 482
           RP+ +IF GFM  + A    A++Q  IY+  PC N   +C  E   +P  +   W V   
Sbjct: 421 RPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATEC--EKGVSPISM---WVVAIE 475

Query: 483 YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTW 542
           Y L   SE LA  TG E A+  +P  MK+F+M++FL  +A  +A+G  ++P+  DP    
Sbjct: 476 YALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVI 535

Query: 543 TFTGLA-VACFIAGCLFW 559
            F  LA +   +A    W
Sbjct: 536 PFGVLAGLGAAVAFAFLW 553

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 158/532 (29%), Positives = 252/532 (47%), Gaps = 44/532 (8%)

Query: 67  EPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMAN------------ 114
           EPTE E  TL+ V        + I ++E SER SYYG      N++              
Sbjct: 36  EPTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAP 95

Query: 115 ----GPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIY 170
                 +    G L +  Q A+AL+    F  Y  P+  GY+AD YW +   +  G  + 
Sbjct: 96  AHGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVG 155

Query: 171 VVGIFLLFITSLPSI-DTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVI 229
           ++   +  I +LP +    + AL   V  II + IAT  +K  +   +  Q P     V 
Sbjct: 156 IISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVR 215

Query: 230 TQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWI- 288
           T   G+RV+ D + + Q + M FY  IN+GS   +AT+      G+W A+L+P   + I 
Sbjct: 216 TLASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIM 275

Query: 289 AVVVLVIGRNQYIMVPVGDKMISKSFKVM--------WILVKNKLNFDAAKPS-MNPEKN 339
             V+LV+GR      P G  M++   KV+        W   ++   ++ A+PS +     
Sbjct: 276 PAVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGR 335

Query: 340 YPWNDK---------FVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLP 390
             W  K          V++ R  L A  +F++Y IY    G + +   +Q  ++  + +P
Sbjct: 336 AGWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVP 395

Query: 391 NDFLQAFDSIAIIVFIPIFERFIYPFVRRFT-PFRPITKIFWGFMFGSGAMIWAAVLQSF 449
           ND +  F+ + IIVF+P+ +  +YP +R+    F+P+ +IF GFM  + A    A++Q+ 
Sbjct: 396 NDLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTV 455

Query: 450 IYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPA-YVLIAISEILASVTGLEYAYSNAPAS 508
           IY   PC     +C  +   +P  +   W V   Y L  +SE LA  TG E A+  +PA 
Sbjct: 456 IYNTSPCGRYATEC--DKGVSPVSM---WVVAVEYALTGLSECLAMTTGYEIAFERSPAH 510

Query: 509 MKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLA-VACFIAGCLFW 559
           MKSF+M++FL T+A  +A+G  ++P+  DP     F  LA +  F+A    W
Sbjct: 511 MKSFVMALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLW 562

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  219 bits (558), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/565 (27%), Positives = 262/565 (46%), Gaps = 37/565 (6%)

Query: 37  DSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELS 96
           D ++L +       +    +++   + +   PTEEE +TL+ +        +LI  +EL+
Sbjct: 13  DVSTLGSGSNAATVQEAPQEVKERSDIEIGLPTEEEERTLRRIVVHPSWYVYLICFIELA 72

Query: 97  ERFSYYGLAAPFQNYM-------ANGPNDTPKG------VLMLDTQGASALSYFFQFWCY 143
           ER SYYG      NY         NG   T  G       L      A++L    +F  Y
Sbjct: 73  ERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSLGLLLKFTSY 132

Query: 144 ITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTR-ETALGGYVTAIILI 202
             P+  GY+ D Y G   T+  G    V    +  +++LP +    + A+   +  +I +
Sbjct: 133 FFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMALSLIGLITL 192

Query: 203 GIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLS 262
            + T  +K  +  L+ +Q P     V T + G+RVI D + + Q + M FY  IN+G+  
Sbjct: 193 SVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGAFM 252

Query: 263 LMATTELESHKGFWAAYLLPFCFFW-IAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILV 321
            +AT+      GFW A+L+P   +  + VV  ++  +     P G  +++   KV+++  
Sbjct: 253 SLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAF 312

Query: 322 KNKLN--------FDAAKPSMNPE-------KNYP-WNDKFVEEIRRALRACKVFVFYPI 365
               N        +D A PS   +       K  P + +  V++ +  L AC +F +Y I
Sbjct: 313 GKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSACFIFCYYII 372

Query: 366 YWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFT-PFR 424
           Y     Q+     +Q G+M  + +PND +  F+ ++IIV IPI +  +YP +RR    F+
Sbjct: 373 YNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRINFK 432

Query: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPE-YANTPNQVHVAWQVPA- 482
           P+ +IF GFM    + +  A++Q  IY+   C      C+ +    +P     +W V   
Sbjct: 433 PVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPLS---SWIVAVE 489

Query: 483 YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTW 542
           Y L   SE LA  T  E AY  +P  MKSF++++FL T+A  +AI   ++P  +DP    
Sbjct: 490 YTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIV 549

Query: 543 TFTGLAVACFIAGCLFWICFRSYNN 567
            F   A   FI+GC F   FR+ + 
Sbjct: 550 PFALFAGIGFISGCHFLWKFRNLDK 574

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  216 bits (550), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 174/574 (30%), Positives = 264/574 (45%), Gaps = 50/574 (8%)

Query: 22  IDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSG 81
           ++S +     I  K DS+S QN    EI  V     +Y +       TEEE K L+HV  
Sbjct: 1   MNSAEPEPKNIEKKPDSSSFQN----EIVTVCT---QYPEELLEP--TEEEEKRLRHVVA 51

Query: 82  KIPMRCWLIAVVELSERFSYYGLAAPFQNYM-----------ANGPNDTPKGVLMLDTQG 130
                 ++I ++EL+ER SYYG      N+              GP+D   G L    Q 
Sbjct: 52  APKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGALGRGLQV 111

Query: 131 ASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS-IDTRE 189
           A++L+   +F  Y  P+  GY+AD Y G+   +  G    VV   +  I +LP+ I    
Sbjct: 112 ATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAALPAVIKHNN 171

Query: 190 TALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVF 249
             +   V  ++ + + T  +K  +  ++  Q P     V T   G+RVI + + + Q + 
Sbjct: 172 LCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDASLQRMS 231

Query: 250 MFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKM 309
           M FY  INVGS   +AT       G+W ++L+P   F I   +L+  +N  +  P+G+ +
Sbjct: 232 MTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTPPLGESL 291

Query: 310 ISKSFKVM-------WILVKNKLNF-DAAKPSM---------NPEKNYPWNDKFVEEIRR 352
            ++  KV+       W       +F   AKPS             K   + +  VE+ R 
Sbjct: 292 FAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKESLVEDTRI 351

Query: 353 ALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERF 412
            L AC +F++Y IY     Q+ +    QAG+M    +PND +  F+ +AII+ +PI +  
Sbjct: 352 TLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIIITMPIIDYG 411

Query: 413 IYPFVRRFT-PFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTP 471
           + P +RR    F+P+ +IF+GFM    A +  A++Q+ IY   PC      C    + T 
Sbjct: 412 LNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC----SETI 467

Query: 472 NQVH--VAWQVPA-YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIG 528
            QV     W V   YVL  +SE  A  TG E A+  +P  MK+F+MS+FLVT A  S + 
Sbjct: 468 RQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALSSILT 527

Query: 529 IAISPTAQDPKYTWTFTGLAVACFIAGCLFWICF 562
              +    DP     F   AV     G LF I F
Sbjct: 528 QIFNGIMTDPYLVIPFILFAV----LGTLFAILF 557

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  194 bits (493), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 148/507 (29%), Positives = 241/507 (47%), Gaps = 41/507 (8%)

Query: 68  PTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNY------------MANG 115
           PTE E  TL+ +     +  + I ++E +ER S+YG      N+             A G
Sbjct: 31  PTEHEELTLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPG 90

Query: 116 PNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIF 175
           P +   G L      A+A+    +F  Y   I  GY++D Y G+   +  G  + V    
Sbjct: 91  PGEQDPGALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHI 150

Query: 176 LLFITSLPSIDTR-ETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGG 234
           L  I +LPS+      A    V A++ + + T  +K  +  L+ +Q P     V T   G
Sbjct: 151 LFIIAALPSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSG 210

Query: 235 KRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVL- 293
           +RVI D + + Q + M FY  INVG+   +AT       G+W A+ +P   + +  +VL 
Sbjct: 211 ERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLW 270

Query: 294 VIGRNQYIMVPVGDKMISKSFKVM-----WILVKNKLN---FDAAKPS---------MNP 336
            +  +     P  + ++++S KV+     W  +K   +   +D AKP+            
Sbjct: 271 KLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRK 330

Query: 337 EKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNF----VTQAGTMELHNLPND 392
           +K   +++K+V + +  + AC +F++Y IY     QM +N      +QAG+ME   +PND
Sbjct: 331 KKAGFYDEKYVYDTKLTISACTIFLYYVIY-----QMHSNLDEPMRSQAGSMEGEGVPND 385

Query: 393 FLQAFDSIAIIVFIPIFERFIYPFVRRFT-PFRPITKIFWGFMFGSGAMIWAAVLQSFIY 451
               F+ I+IIV +PI +  +YP +RR+   F+P+ +IF GFM G       A++Q  +Y
Sbjct: 386 LFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVY 445

Query: 452 KAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKS 511
              PC  M     PE  +  + +        Y L   SE LA  TG E A+  +P  MK 
Sbjct: 446 NTSPCGYMGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKG 505

Query: 512 FIMSIFLVTNAFGSAIGIAISPTAQDP 538
           F++++F+ T A  SAI + I+P  +DP
Sbjct: 506 FVLALFMFTVAISSAIILPITPFFKDP 532

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 122 GVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITS 181
           GVL L T     L   F   C I  +F G + D Y  ++  I  GT I+VVG+    I  
Sbjct: 114 GVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLI-FGTSIFVVGV----IIQ 168

Query: 182 LPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPR 223
           + S+         Y    I+ GI  G+I     +LI+E  P+
Sbjct: 169 IASVSKWFQ----YFIGRIIAGIGMGVIAVLSPMLISEVAPK 206

>TPHA0N01950 Chr14 complement(415055..416860) [1806 bp, 601 aa] {ON}
           
          Length = 601

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 81/200 (40%), Gaps = 24/200 (12%)

Query: 12  ELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEE 71
           E+ DD  A+ I +K++ E+  V++ D  +       E+     D I   +N       E+
Sbjct: 56  EMSDDESATSIITKKNKEITEVNEIDCDN-------EVENKSSDAIRSVNN-------EK 101

Query: 72  EMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGA 131
               LK    ++  R W I        FS   +++ F N   N       G    +++  
Sbjct: 102 NHSFLKRFIPELDHRHWTIFTAG-GGVFSDSYISSAFSN--VNVCLKRIYGTAYYESKAI 158

Query: 132 SALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETA 191
           S +S           +F GY+ADTY G+   +  GT   +  +F++       I+T +T 
Sbjct: 159 SVVSSINFAGTVFGMLFYGYLADTY-GRKRAMLLGTSTLI--LFVILCAGAWGINTTDTH 215

Query: 192 LGGYVTAI----ILIGIATG 207
            GG   A+      IGI+ G
Sbjct: 216 PGGLFEALAVYRFFIGISIG 235

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 9/114 (7%)

Query: 110 NYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGI 169
           +Y+    +  P G   +       L   F   C I  +F G + D+  G+   I  G  I
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 170 YVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPR 223
           Y+VGI    +  + SID        Y    I+ G+ +G I     +LI+E  P+
Sbjct: 147 YIVGI----VIQIASIDKWFQ----YFIGRIIGGLGSGAIAVLSPMLISEVSPK 192

>TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {ON}
           Anc_7.309 YDL194W
          Length = 880

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 9/87 (10%)

Query: 137 FFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYV 196
           F     ++  +   ++AD Y  K   I + T I+ +G          S+      +G +V
Sbjct: 179 FLSLGTFLGALIAPFIADRYGRKITIILSSTLIFFLG---------NSLQVGSHGIGLFV 229

Query: 197 TAIILIGIATGMIKANISVLIAEQIPR 223
               + G+A GM+ A + +  AE  P+
Sbjct: 230 AGRFISGVAIGMVSAVVPLYQAEAAPK 256

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 54/131 (41%), Gaps = 18/131 (13%)

Query: 53  GDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLA---APFQ 109
           G +++   D +   E T E     ++  G    R WL  +      F  +G A     ++
Sbjct: 46  GAEEVLAADEKAATEATNELDVEEEYPDGG--YRAWLTVLGSFVGIFPIWGTANALGAYE 103

Query: 110 NYMANGPNDTPKGVLMLDTQGASALSYFFQFW---CYITPIFGGYMADTYWGKYNTICAG 166
            Y++N           L + GA  +S+ F      C++  +F G   D   G+   I  G
Sbjct: 104 GYISNH---------QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVG 153

Query: 167 TGIYVVGIFLL 177
           + +YV GIF++
Sbjct: 154 SVLYVFGIFMM 164

>NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.138
           YHR123W
          Length = 404

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 9/77 (11%)

Query: 268 ELESHKGFWAAY--LLPFCFFWIAVVVLVIGRNQYIMVPVGDKM-ISKSFKVMWILVKNK 324
           ELES K    A   LLPF F++I+V+VL+     +I +P+   + ++ +F V  I+V + 
Sbjct: 263 ELESQKELDIAIKGLLPFLFYFISVIVLITVNENFINLPLVLSIGLTMAFVVGRIIVAHL 322

Query: 325 LNFDAAKPSMNPEKNYP 341
            N D       P  N+P
Sbjct: 323 TNQDF------PMINFP 333

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 506 PASMKSFIMSIFLVTNAFGSAIGIAISPT-AQDPKYTWTFTGLAVACFI 553
           P   K+FI S F    +FG  +G+  S    Q   ++W +  +A+AC +
Sbjct: 203 PCKRKNFIFSFFGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVV 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,622,958
Number of extensions: 2702651
Number of successful extensions: 11563
Number of sequences better than 10.0: 63
Number of HSP's gapped: 11926
Number of HSP's successfully gapped: 63
Length of query: 610
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 494
Effective length of database: 40,180,143
Effective search space: 19848990642
Effective search space used: 19848990642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)