Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.93.500ON1411417321e-101
TPHA0A057103.500ON1411414775e-62
TBLA0C045203.500ON1401394532e-58
NCAS0F035903.500ON1401354412e-56
TDEL0D056803.500ON1401414377e-56
YPR153W3.500ON1401414377e-56
Suva_16.4813.500ON1391384332e-55
Smik_16.4053.500ON1391384323e-55
Skud_16.4473.500ON1401384323e-55
SAKL0F02508g3.500ON1401394193e-53
CAGL0L08382g3.500ON1401394194e-53
ZYRO0D09724g3.500ON1391304133e-52
KLTH0G02354g3.500ON1401393984e-50
KNAG0A079803.500ON1471383856e-48
KLLA0E03895g3.500ON1401343585e-44
KAFR0G037303.500ON1441443422e-41
AFR319W3.500ON1411232841e-32
Kwal_47.189033.500ON113501254e-09
Kpol_1048.608.543ON94991730.29
Smik_1.97.9ON87450720.33
Skud_1.67.9ON88055720.34
YAL056W (GPB2)7.9ON88050690.83
TBLA0B045908.543ON151845690.93
TBLA0A00300singletonON75139662.1
NDAI0E050205.698ON61989626.0
KNAG0E035607.134ON69830626.4
Smik_4.1854.229ON48632617.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.9
         (141 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   286   e-101
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   188   5e-62
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   179   2e-58
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   174   2e-56
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   172   7e-56
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   172   7e-56
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   171   2e-55
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   171   3e-55
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   171   3e-55
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   166   3e-53
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   166   4e-53
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   163   3e-52
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   157   4e-50
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   152   6e-48
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   142   5e-44
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   136   2e-41
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   114   1e-32
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    53   4e-09
Kpol_1048.60 s1048 (172720..175569) [2850 bp, 949 aa] {ON} (1727...    33   0.29 
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     32   0.33 
Skud_1.6 Chr1 (15260..17902) [2643 bp, 880 aa] {ON} YAL056W (REAL)     32   0.34 
YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multiste...    31   0.83 
TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_...    31   0.93 
TBLA0A00300 Chr1 complement(48459..50714) [2256 bp, 751 aa] {ON}       30   2.1  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...    28   6.0  
KNAG0E03560 Chr5 (712334..714430) [2097 bp, 698 aa] {ON} Anc_7.1...    28   6.4  
Smik_4.185 Chr4 complement(341070..342530) [1461 bp, 486 aa] {ON...    28   7.6  

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  286 bits (732), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60
           MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60

Query: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120
           ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC
Sbjct: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120

Query: 121 CAITQVLFDLCSSFSLGGMVM 141
           CAITQVLFDLCSSFSLGGMVM
Sbjct: 121 CAITQVLFDLCSSFSLGGMVM 141

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  188 bits (477), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 112/141 (79%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60
           M  +FLTS D+PVGY  P FPSLYWPI++ KY+ +YLYD+ TIW FTVYWS+ILNG FY 
Sbjct: 1   MVGNFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYG 60

Query: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120
           ++G +A +THRK+ GG WI+ IYL +G  QG+V GT+ GY++S  Y+S LF+MSTWIPLC
Sbjct: 61  VAGALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLC 120

Query: 121 CAITQVLFDLCSSFSLGGMVM 141
           CA+ QVLF++ +S+SL G +M
Sbjct: 121 CAVAQVLFEVTTSYSLVGNLM 141

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  179 bits (453), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 105/139 (75%)

Query: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62
            SF+T+ DIPVGY  PPFPSLYWPI+++KY+ S+LYDT  IW+F++YW VILN  FY ++
Sbjct: 2   KSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVT 61

Query: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122
           G +A  +HR + G +WI+ IYLF G  QG+V GT+ GY++S IY SGLF MSTWIP CCA
Sbjct: 62  GTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCA 121

Query: 123 ITQVLFDLCSSFSLGGMVM 141
           + Q+LFD+  SF +  + M
Sbjct: 122 VVQILFDVVQSFPISNLTM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  174 bits (441), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 105/135 (77%), Gaps = 1/135 (0%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60
           MRS F+T+ DIP+GY  P FPSLYWPI++KKY +++LY+   IW+FT+YW++I N  FY 
Sbjct: 1   MRS-FITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYG 59

Query: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120
            +GL+AS++HR+  GG+WIMVIYL     QG+  GT+ G+L+  IY +GLFAMSTWIPLC
Sbjct: 60  AAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLC 119

Query: 121 CAITQVLFDLCSSFS 135
           CA+ Q+LFD+  ++S
Sbjct: 120 CAVAQILFDVIMAYS 134

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  172 bits (437), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (73%), Gaps = 1/141 (0%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60
           MRS F+T+ D+P+GY  P FPSL+WPIS+ K+ ++ LYD   IW+FT+YWS+I NG FY 
Sbjct: 1   MRS-FITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYG 59

Query: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120
           I+GL ASY+HR+RAGGLWIM IYL  G  Q V  GTV G+L+  IY +GLF+MSTWIP C
Sbjct: 60  IAGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPC 119

Query: 121 CAITQVLFDLCSSFSLGGMVM 141
           C I Q+LFD   S+   G +M
Sbjct: 120 CVIVQILFDFSVSYLSSGTIM 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  172 bits (437), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (76%), Gaps = 1/141 (0%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60
           MRS F+T+ DIPVGY  P FPSLYWPI++ KY+ ++LY    IW+F++YW++I NG FY+
Sbjct: 1   MRS-FVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYV 59

Query: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120
            +G+ AS THRK+AG +WI V+Y+  G  QG+  GTV G+L+  IY SGLF+MSTW+PLC
Sbjct: 60  TAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLC 119

Query: 121 CAITQVLFDLCSSFSLGGMVM 141
           CA+ Q+LFD+  S+S+ G VM
Sbjct: 120 CAVVQILFDVVLSYSMVGSVM 140

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  171 bits (433), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%)

Query: 4   SFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISG 63
           SF+T+ DIPVGY  P FPSLYWPI+S +Y+ ++LY    IW+F++YW++I NG FY+ +G
Sbjct: 2   SFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAG 61

Query: 64  LMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAI 123
           L AS THRK+AG +WI V+Y+  G  QG+  GT+ G+L+  IY SGLF+MSTWIPLCCA+
Sbjct: 62  LYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAV 121

Query: 124 TQVLFDLCSSFSLGGMVM 141
            Q+LFD+   +S+ G +M
Sbjct: 122 VQILFDVVLGYSMIGSIM 139

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  171 bits (432), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 105/138 (76%)

Query: 4   SFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISG 63
           SF+T+ DIPVGY  P FPSLYWPI++ +Y+ ++LY    IW+F++YW++I NG FY+++G
Sbjct: 2   SFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVTG 61

Query: 64  LMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAI 123
           L AS THRK+AG LWI  +Y+  G  QG+  GTV G+L+  IY SGLF+MSTWIPLCCA+
Sbjct: 62  LYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAV 121

Query: 124 TQVLFDLCSSFSLGGMVM 141
            Q+LFD+   +S+ G VM
Sbjct: 122 VQILFDVVLGYSMVGSVM 139

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  171 bits (432), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 105/138 (76%)

Query: 4   SFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISG 63
           SF+T+ DIPVGY  P FPSLYWPI+S +Y++++LY    IW+F++YW++I NG FY+ +G
Sbjct: 3   SFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVTTG 62

Query: 64  LMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAI 123
           L AS THRK+ G +WI V+Y+  G  QG+  GTV G+L+  IY SGLF+MSTWIPLCCA+
Sbjct: 63  LYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAV 122

Query: 124 TQVLFDLCSSFSLGGMVM 141
            Q+LFD+   +S+ G VM
Sbjct: 123 VQILFDVILGYSMIGSVM 140

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  166 bits (419), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 106/139 (76%)

Query: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62
            SF+T+ D+P+GY  P FPSLYWP++++K+ +SYLY T  IW FTVYW++IL  GFY  +
Sbjct: 2   KSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSA 61

Query: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122
           GL+ASY+HRK AGG+WIM  YL  G  Q +  GTV G L++ IY +GLFAMSTW+PL CA
Sbjct: 62  GLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCA 121

Query: 123 ITQVLFDLCSSFSLGGMVM 141
           + Q+LF++ +S+ + G+++
Sbjct: 122 LMQILFNVSTSYLMAGVII 140

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  166 bits (419), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (72%)

Query: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62
            SF+TS D+P+GY  P FPSLYWPI+ ++Y  ++LY  + IW+FT+YW+ I NG FY  +
Sbjct: 2   KSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGGA 61

Query: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122
           GL AS TH KR GGLWI  IY+     QG++ GTV G+L+  IY SGLF+MSTW+P+CCA
Sbjct: 62  GLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCCA 121

Query: 123 ITQVLFDLCSSFSLGGMVM 141
           + Q+L D+  S+S+ G +M
Sbjct: 122 VVQILLDVTMSYSMVGSIM 140

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  163 bits (413), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 4/130 (3%)

Query: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSK-KYHVSYLYDTKTIWEFTVYWSVILNGGFY 59
           MRS F+T+ D+PVGY  P FPSLYWP  S+   HV  +YD   IW+FT+YWS+I N GFY
Sbjct: 1   MRS-FITTNDVPVGYETPSFPSLYWPTESRTSLHV--IYDVSAIWKFTLYWSLIFNFGFY 57

Query: 60  LISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPL 119
            ++GL AS++HRK+AGGLWIM +Y   G  QGV  GT+TG+L+  IY SGLF+MSTWIP 
Sbjct: 58  ALTGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPF 117

Query: 120 CCAITQVLFD 129
           CCA+ QVL+D
Sbjct: 118 CCAVAQVLYD 127

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  157 bits (398), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 103/139 (74%)

Query: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62
            SF+T  D+P+GY  P FPSL+WPI++K+Y +SYLY T  IW+FTV+W++IL  GFY  +
Sbjct: 2   KSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAA 61

Query: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122
           GL AS +HRK+A GLWIM  Y+ +G  Q +  GTVTG +++  Y +GLF MSTWIPLC A
Sbjct: 62  GLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121

Query: 123 ITQVLFDLCSSFSLGGMVM 141
           +  +LF + +++S+ G+++
Sbjct: 122 VVLILFHVSTTYSMAGIII 140

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  152 bits (385), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 99/138 (71%)

Query: 4   SFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISG 63
           +F+ + +IPVGYH P FPSLYWPIS++ Y +++LY+ + IW+FT+YW +ILNG FY  SG
Sbjct: 10  TFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGTSG 69

Query: 64  LMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAI 123
           L+A+ +H K    + I+ +YL     QGVV G + G L+  IY +GLF MSTWIPLCCA+
Sbjct: 70  LVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCCAV 129

Query: 124 TQVLFDLCSSFSLGGMVM 141
            Q+LFD+  S+S  G ++
Sbjct: 130 AQILFDVVMSYSHVGSLL 147

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  142 bits (358), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 95/134 (70%)

Query: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62
            +F  + D+PVGY  P FPSLYWP+++ K+ V+YLY    IW FT++W++IL    Y  +
Sbjct: 2   KTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGTT 61

Query: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122
           G +A  TH+K   G W++ +Y+ IG AQ  V GTV G L++ IY +GLFAMSTWIPLCCA
Sbjct: 62  GAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCCA 121

Query: 123 ITQVLFDLCSSFSL 136
           + Q+LF++ +S+S+
Sbjct: 122 VVQILFNVSTSYSM 135

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  136 bits (342), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 94/144 (65%), Gaps = 3/144 (2%)

Query: 1   MRSSFLTSED--IPVGYHKPPFPSLYWPIS-SKKYHVSYLYDTKTIWEFTVYWSVILNGG 57
           MR  F  +++  +P+GY  P FPSLYWPI   + +  ++LY    IW+FT+YWS+I NG 
Sbjct: 1   MRYVFFDTKEQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGA 60

Query: 58  FYLISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWI 117
           FY+ +G +A  T +K++  L I   Y   G  QGV+ GTV G+LV  IY +GLF MS WI
Sbjct: 61  FYVSAGAVACLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWI 120

Query: 118 PLCCAITQVLFDLCSSFSLGGMVM 141
           P+CCA+ Q+L+D+  S+S  G +M
Sbjct: 121 PMCCAVAQILYDVLVSYSTVGRIM 144

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  114 bits (284), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 79/123 (64%), Gaps = 1/123 (0%)

Query: 12  PVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHR 71
           P GY  P FPSL W  +  + + + LY TK I  FT++W++IL GG Y   GL+A Y+HR
Sbjct: 13  PAGYISPSFPSLLWT-ADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 72  KRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAITQVLFDLC 131
           +  GG+ I+ IYL +G    ++ GT +G + + IY + L AMSTWIPL  A+ Q L+ LC
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131

Query: 132 SSF 134
           ++F
Sbjct: 132 AAF 134

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 52.8 bits (125), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 57  GFYLISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIY 106
           GFY  +GL AS +HR+ AGGLWIM  Y+ +G  Q V  GTVTG +  +++
Sbjct: 2   GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMH 51

>Kpol_1048.60 s1048 (172720..175569) [2850 bp, 949 aa] {ON}
           (172720..175569) [2850 nt, 950 aa]
          Length = 949

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 21/91 (23%)

Query: 21  PSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRKRAGGLW-- 78
           P  + P  S KY +S   + KTIW+    W + LNG    I+ L+ +Y +R+     W  
Sbjct: 787 PVKHNPNESIKYKLSR--ENKTIWDLYTEWYIGLNGKPS-ITQLIKNYGYRR-----WKV 838

Query: 79  -----------IMVIYLFIGCAQGVVFGTVT 98
                      I++ Y+   C +GV FG  T
Sbjct: 839 HDDSHFFPTRRIIMDYIETECDRGVKFGRFT 869

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 32.3 bits (72), Expect = 0.33,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 25  WPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRKRA 74
           + ISS    +  L+    +   T + SV LNG  YL  GLM  Y++ + A
Sbjct: 259 YEISSGNMVIPSLFSEDKLPALTYHCSVELNGNIYLFGGLMPCYSYEEDA 308

>Skud_1.6 Chr1 (15260..17902) [2643 bp, 880 aa] {ON} YAL056W (REAL)
          Length = 880

 Score = 32.3 bits (72), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 28/55 (50%)

Query: 20  FPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRKRA 74
           + S  + ISS    +  L+    +   T + SV LNG  Y++ GLM  Y++ + A
Sbjct: 248 YVSKRYEISSGNVIIPSLFSEDKLPALTYHCSVELNGNIYMLGGLMPCYSYEEDA 302

>YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multistep
           regulator of cAMP-PKA signaling; inhibits PKA downstream
           of Gpa2p and Cyr1p, thereby increasing cAMP dependency;
           inhibits Ras activity through direct interactions with
           Ira1p/2p; regulated by G-alpha protein Gpa2p; homolog of
           Gpb1p
          Length = 880

 Score = 31.2 bits (69), Expect = 0.83,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 25  WPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRKRA 74
           + ISS    +  L+    +   T + SV LNG  Y+  GLM  Y++ + A
Sbjct: 259 YDISSGNMIIPSLFSEDKLPALTYHCSVELNGNIYIFGGLMPCYSYEEDA 308

>TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_8.543
            YPL075W
          Length = 1518

 Score = 31.2 bits (69), Expect = 0.93,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 28   SSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRK 72
            S  KY +S   D KT+W+    W + LNG   ++  L+ SY  RK
Sbjct: 1361 SKIKYKLSR--DNKTVWDLYTEWYIGLNGNLPIVE-LIKSYGFRK 1402

>TBLA0A00300 Chr1 complement(48459..50714) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 30.0 bits (66), Expect = 2.1,   Method: Composition-based stats.
 Identities = 10/39 (25%), Positives = 22/39 (56%)

Query: 35  SYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHRKR 73
           ++++ ++++WE    +  I     YL+S +   Y HRK+
Sbjct: 349 NFIHHSESLWELMSQFPRIHQSSVYLVSTIFKKYYHRKK 387

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 44  WEFTVYWSVILNGGFYLISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVS 103
           W+   Y  +  +  F  I+GL  +Y+    +   ++M I+L         FG++ G  +S
Sbjct: 480 WQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNA-----FGSILGIALS 534

Query: 104 QIYISGLFA-MSTWIPLCCAITQVLFDLC 131
            + +   F  +   + + C +T +LF LC
Sbjct: 535 SVTVDPKFVWLFGGLAVSCGVTGILFWLC 563

>KNAG0E03560 Chr5 (712334..714430) [2097 bp, 698 aa] {ON} Anc_7.134
           YIL005W
          Length = 698

 Score = 28.5 bits (62), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 15  YHKPPFPS-LYWPISSKKYHVSYLYDTKTI 43
           Y+K  F S  Y P++S+K H+ + YD KT+
Sbjct: 305 YYKLDFSSEAYIPLNSQKIHLVFSYDPKTV 334

>Smik_4.185 Chr4 complement(341070..342530) [1461 bp, 486 aa] {ON}
           YDL054C (REAL)
          Length = 486

 Score = 28.1 bits (61), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 60  LISGLMASYTHRKRAGGLWIMVIYLFIG-CAQ 90
           L++GL+A +  +KR    WI++ +L +G CAQ
Sbjct: 334 LLTGLVADFFAKKRISIKWILLTFLSLGVCAQ 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.142    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,074,805
Number of extensions: 591625
Number of successful extensions: 1630
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1626
Number of HSP's successfully gapped: 44
Length of query: 141
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 43
Effective length of database: 42,244,131
Effective search space: 1816497633
Effective search space used: 1816497633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)