Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.193.483ON57457430210.0
CAGL0I10648g3.483ON57457226920.0
NCAS0F035103.483ON57557226770.0
NDAI0B058103.483ON57757626750.0
TDEL0D055203.483ON57357126740.0
TPHA0D042003.483ON57457426590.0
KNAG0A079203.483ON57857726540.0
Suva_16.4743.483ON57257126540.0
SAKL0F02970g3.483ON57357126510.0
KAFR0G036703.483ON57257126500.0
Smik_16.3963.483ON57257126420.0
YPR145W (ASN1)3.483ON57257126380.0
Skud_16.4393.483ON57257126370.0
Suva_7.4103.483ON57257226120.0
KLTH0F14630g3.483ON57357126060.0
KLLA0B10868g3.483ON57457426050.0
Kwal_55.211873.483ON57357126040.0
Smik_6.2203.483ON57257226010.0
Skud_7.4353.483ON57257125970.0
YGR124W (ASN2)3.483ON57257125920.0
TBLA0C044303.483ON58057825910.0
AFR303W3.483ON57157125310.0
ZYRO0B04136g3.483ON57257125220.0
Ecym_12443.483ON57357124530.0
KLLA0D10285g8.875ON5154291492e-09
ZYRO0A00528g8.875ON5121031393e-08
Kpol_455.78.875ON5181051351e-07
Skud_13.468.875ON5191131288e-07
TPHA0C049508.875ON525991252e-06
KAFR0L021108.875ON514951242e-06
TBLA0C063008.875ON5184351233e-06
YML096W8.875ON525951206e-06
KNAG0J002008.875ON5151021207e-06
NCAS0C001908.875ON5171051181e-05
NDAI0K001808.875ON522941171e-05
Suva_13.528.875ON5191131162e-05
TDEL0B004408.875ON516941162e-05
ADL350C8.875ON508991152e-05
Smik_13.398.875ON521961153e-05
SAKL0D00352g8.875ON515731144e-05
Skud_7.311singletonON8189981e-04
Ecym_81558.875ON5131121063e-04
Kwal_27.97058.875ON515991045e-04
CAGL0H06963g8.875ON51778990.002
KLTH0E16412g8.875ON51595970.004
SAKL0E13200g2.59ON15283693.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.19
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1168   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1041   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1035   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...  1035   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1034   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...  1028   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1026   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1026   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1025   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1025   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1022   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1020   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1020   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1010   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...  1008   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1008   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...  1007   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1006   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1004   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1003   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...  1002   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   979   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   976   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   949   0.0  
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    62   2e-09
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   3e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    57   1e-07
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    54   8e-07
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    53   2e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    52   2e-06
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    52   3e-06
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    51   6e-06
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    51   7e-06
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    50   1e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    50   1e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   2e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    49   2e-05
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    49   2e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    49   3e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   4e-05
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    42   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    45   3e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    45   5e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.002
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    42   0.004
SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285) ...    31   3.8  

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1168 bits (3021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/574 (97%), Positives = 562/574 (97%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK 574
           AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK 574

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/572 (87%), Positives = 521/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAAYKH++  AFKP+ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  GDY LCVNGEIYNHIQLRE  PDYK+KTLSDCEPIIP YL+HDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAK+DRI+AARDP+GITTLYMGR S SPKTVFFASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF+PDWIDE RIPT PV++K IRESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYD-SEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPD 299
             IASIAARETEKA +E D    D S  K L GID+QG+LHTAGWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHLADCLRANKSTM+WGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDP +KMI+ S GRIEKYILRKAFDTSDEPD KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAERVISD +FS PK  WG DIPTTKEAYWYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AAETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           AA TVMRWIPKADWGCAEDPSGRYAKIHEQH+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/572 (84%), Positives = 532/572 (93%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA++HE+ +A+KP+ALQL+KRIRHRGPDWSGNVVKN+TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQ+RE C DY++KTLSDCEPIIPLYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAK+DRI+AARDPIGITTLYMGR SK+P+TV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYF+PDW+DE RIP+ PV  KAIRE+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSED-KHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPD 299
             IASIAARETEKAM+++D    + E  KHLTG+DD+G+LHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDP +KMI+ + G+IEKYILRKAFDT+D+P+EKPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAERVISD +F  PK HWG D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AAETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           AA+TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/576 (84%), Positives = 524/576 (90%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+  AFKPRALQLSKRIRHRGPDWSGNV+KN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQ+RE  PDY +KTLSDCEPIIPLYLKHDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYD+K+DRIIAARDPIGITTLYMGRNSK+P+TVFFASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF+PDW+DEQRIP   +   AIRESLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDK----HLTGIDDQGNLHTAGWSRLHSFAIGLPN 296
             IASIAARETEKA  +      ++ D+    HLTG+DD+G+LH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTM+WG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILW 476
           LEARVPFLDR+FLQLCMNIDP EKMIN +EGRIEKYILRKAFDTSD+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAERVISD +F  PK+HWG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572
           QKTAA+TVMRWIPKADWGCAEDPSGRYAKIHE+H+ 
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/571 (84%), Positives = 526/571 (92%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+ +A+K +ALQLSKRIRHRGPDWSGNV++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCG+Y LCVNGEIYNHI+LRE   DYK+ TLSDCEPIIPLY K+DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAK+DRIIAARDP+GITTLYMGRNS SPKTVFFASELKCLTDDCD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE RIP+ PV YKAIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETEKA  E+D   YDSEDKHL GIDD GNLH+AGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMIN  EGR+EKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISD++F+ PK  WG D+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/574 (85%), Positives = 522/574 (90%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  YKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  GD++LCVNGEIYNHIQ+RE  PDY++KTLSDCEPIIPLY+K+  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGR+SKSPKTV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRY++PDWIDE RI  +P+    IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETEKAMK   + +  S    LTGIDD GNL ++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP+EKMIN  EGRIEKYILRKAFDT+DEP+EKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISDELF  P+EHWG+DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK 574
           A TVMRWIPKADWGCAEDPSGRYAKIHEQHIG K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGAK 574

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/577 (83%), Positives = 526/577 (91%), Gaps = 4/577 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA ++HE+ +AFKPRALQLSKRIRHRGPDWSGN++KNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCGDY+L VNGEIYNHIQLRE CP+Y+YK+LSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAKKDRI+AARDPIGITTLYMGR+S  PKTVFFASELKCLTDDCD+I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY++P+W+DE +IP+ PV  K IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYD----SEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPN 296
             IA+IAARETEKA KE+D   YD    +E  HL GIDD+GNL +A WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL+AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTM+WG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILW 476
           LEARVPFLD+EFL LCMNIDP +K+IN  EGRIEKYILRKAFDT DEPD KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAE VISDE+F+ PK HWG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIGD 573
           Q TAAETVMRWIPKADWGCAEDPSGR+AKIHEQH+ D
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/571 (84%), Positives = 522/571 (91%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+   +KP+ALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CPDY++KTLSDCEPIIP+YLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARET KA  +++ + YD++ +HL G+DD+GNLHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP+EKMI   EGRIEKYILRKAFDT+DEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAE VISDE+F+ PK  WG DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/571 (85%), Positives = 512/571 (89%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA YKHE+ + FKP+ALQLSKRIRHRGPDWSGNVVKN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  GDY LCVNGEIYNHI+LRE    Y +KTLSDCEPIIPLY K+DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAKKDRIIAARDPIGITTLYMGR+S SP TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY++PDW+DE+RIP  P+ YK IR SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA K++D  AYD EDKHL G+DD+GNLH AGWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDPAEKMIN SEGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F+ PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/571 (84%), Positives = 520/571 (91%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA++HE+  +FK +ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQLRE  PDYK+KTLSDCEPIIPLYL+ DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYD+KKDRI+AARDPIG+TTLYMGR+S SPKTVFFASELKCL DDCDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+P+WIDE +IPT PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETE A +E+D + Y  E  HL GIDD+G+L T+GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP +K+IN  EGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAE+VISDE+F+ PK HWG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           AETVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/571 (83%), Positives = 521/571 (91%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+   +KP+ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CP+Y++KTLSDCEPIIP+YLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARET  A  ++D + YDS+ +HL G+DD G LHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE VISDE+F++PK  WG+DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/571 (83%), Positives = 521/571 (91%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA++HE+   +KP+ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  G+Y+LCVNGEIYNHIQLRE C DY++ TLSDCEPIIP+YLKHDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARET KA  +++ + YDS+ +HL GIDD G LHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE VISDE+F++PK  WG+DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 519/571 (90%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAAYKHE+   +K +ALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CPDY++KTLSDCEPIIP+YLKHDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARET  A  +++ + YDS+ +HL G+DD GNLHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMI A EGRIEKYILRKAFDT+ EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE VISDE+F++PK  WG+DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/572 (83%), Positives = 519/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+ E FKP+ALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  GDY+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           A+CLYD+KKDR+IAARDPIG+ TLYMGR SKSPKTV+FASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+PDW+DE+R+PT PV Y+AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETE A  E +  A  +E   L GIDDQG+LHT+GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANEEA-SAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST++WGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDP +KMIN+ EGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+DTAERVISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+H+ 
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/571 (84%), Positives = 508/571 (88%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  ++H++ E FKP AL+L KRIRHRGPDWSGN++KNST++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           P  S   +Y+L VNGE+YNHIQLRE    Y +KTLSDCEPIIPLY K+ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYDAKKDRI+AARDPIGITTLYMGR+SKSPKTV+FASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRYF+PDWIDE RIP+EP+    IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETEKA  +MD   YDSEDKHL G+DD GNL +AGWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMINA+EGRIEKYILRKAFDTSDEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F  PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/574 (82%), Positives = 515/574 (89%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA++++ + +A+KP+ALQLSKRIRHRGPDWSGN+VKNSTILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHI LRE C  Y +KTLSDCEPIIPLY K+DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYD+KKDRIIAARDPIGITTLYMGR+S SPK+V+F+SELKCLTDDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRYF+PDW+DE RIPT PV +KA+RESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEK   E+D   YDS+   L G+D+QG+LH AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI  +EG+IEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F+ PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK 574
           A TVMRWIPKADWGCAEDPSGRYAKIHEQH+  K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK 574

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 511/571 (89%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  ++HE+ + FKP ALQL+KRIRHRGPDWSGNV++NST+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           P+ S   DY+L VNGEIYNHIQLRE   DY +KTLSDCEPIIPLY K+ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AW LYD KKDR+IAARDPIGITTLYMGR+SKSPKTV+FASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRY++P+W+DE RIP+EP+    IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA  EM+   YDSEDKHL G+DD G LH+AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMIN +EGRIEKYILRKAFDTSDEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISDE F  PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/572 (83%), Positives = 521/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KH++  +FKP+ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           A+C+YDAKKDRI+AARDPIG+ TLYMGR+SKSPKTV+FASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA  +++  +   ++K L GIDDQG+LHT+GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADVNEES-SVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDP +KMI   EG+IEKYILRKAFDT++EPD KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAERVISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572
           A TVMRW+PKADWGCAEDPSGRYAKIHE+H+G
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHVG 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/571 (83%), Positives = 518/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+  +FKP+ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PI S  G+Y+L VNGEIYNHIQLRE C  YK++T SDCEPIIPLYL+HDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           A+CLYDAKKDR++AARDPIG+ TLYMGR+SKSPKTV+FASELKCLTD CDSI++FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+P+W+DE+RIP+ PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA  + D  A    +K L GIDDQG+LHT+GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADGDA-SVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMIN  EGRIEKYILRKAFDT+DEP+ KPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAERVISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/571 (83%), Positives = 518/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+   FKP+ALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           A+CLYD+KKDRI+AARDPIG+ TLYMGR+S+SP+TV+FASELKCLTD CDSI++FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+PDW+DE+RIP+ PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA  + +    + ++K L GIDDQG+LHT+GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANEDN-NVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAER ISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/578 (81%), Positives = 511/578 (88%), Gaps = 7/578 (1%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAAYKH    AFKPRALQL+KRIRHRGPDWSGNVVKN+T+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PITSPCG+Y+L VNGEIYNHIQLRE   DYKYKTL DCEPIIP+YLK+D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           A+ LYD++KDR+IAARDP+GITTLYMGRNSK+PKTV+FASELKCL DDCDSI+AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+I RYF P+WIDE  IPT PV  K +RE+LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSED-------KHLTGIDDQGNLHTAGWSRLHSFAIG 293
             IASIAARETEK M E +T  Y+ +        K LTG+DD GNL T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 SWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEE 473
           +WGLEARVPFLDR+FL LCMNIDP +KMI   EG+IEKY+LRKAFDTSDEPD KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKDTAERVISDE+F+ PK+HWG+DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           LFPQKTAA+TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/571 (80%), Positives = 505/571 (88%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+ ++ E+FKP AL+LSKR+RHRGPDWSGNV+KN TILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PI SP G+YVLCVNGEIYNHI LRE C DY++ +LSDCEPIIPLYLK+D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG++S SP+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDWIDE RIP++PV YKA+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETE+A +E      D   KHL G+DD+G LHT GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTM+WGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPAEKMI   +GRIEKYILRKAFDTSDEP   PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AER ISDE F+ P   WG DIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRW+PKADWGCAEDPSGRYAKIH+QHI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/571 (80%), Positives = 503/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFAA++H + + ++P ALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PI SPCG+Y LCVNGEIYNHIQLRE C DY +++LSDCEPIIPLYLK+ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMG++SKSPKT FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRYF+P W+DE  +P+ P+ YK +R SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IASIAARETE+A +E+D   YDSE+KHL GID QGNLHT GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           LAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDR+FL LCM +DP EKMI   EGRIEKYILRKAFDT+DEP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE+ +TP+  WG D PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGC  DPSGR+AKIHEQHI
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/571 (77%), Positives = 497/571 (87%)

Query: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+ +  E+FKP ALQLSKRIRHRGPDWSGNVVKN TI VHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120
           PI S  G+YVLCVNGEIYNHI LR+ C DY + TLSDCEPIIPL+ K+ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180
           AWCLYDAK DRI+AARDPIG+TTLYMG+ SKSP+T +FASELKCL ++CD I++FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF P W+ +   PT+PV YK +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA KEMD   YDS+ ++L G+DD+ +LH +GWS+LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMNIDP EKMI   EG+IEKYILRKAFDTSDEPD +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISDE F+ PK  WG DIP+TKEAYWYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRW+PKA+WGC+EDPSGR+AKIHE+HI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 103/429 (24%), Positives = 173/429 (40%), Gaps = 62/429 (14%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDID-APKYLDGMFAWCLYDA 127
           Y+L  NGE+YN   + E+C        SD E I  L  KH ++   +   G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KKDRIIAARDPIGITTLYMGRNSKSPKTVFFASEL--KCLTDDCDSIMAFPPG--HVYDS 183
           ++ ++   RD IG          +S   +    EL    ++  CD       G  +++D 
Sbjct: 143 QERKVYFGRDSIG---------KRSLSYILLDDELYITSVSGRCDGFQNCLAGVIYIFDI 193

Query: 184 ETDQITR--------YFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYXXXXX 235
            T Q+T         Y   D ID      E    K + E L ++V +R++   P      
Sbjct: 194 NTKQLTGSVKIHDEPYIVSDQIDNDFQLLEEYKIK-LYECLRRSVYQRIVTIHPMHLENG 252

Query: 236 XXXXXXXIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLP 295
                       +  T    +++     +SE    T I+    L   G+    +  +   
Sbjct: 253 NISILFSGGLDCSVITALLCEQLIKINRNSE----TIIE----LLNVGFENPRTGKMP-S 303

Query: 296 NAPDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLET-----YDVTT---IRAST 347
           ++PD + A K A+ +  ++ +    L E      D + H +T     Y   T   +  + 
Sbjct: 304 DSPDRILAIKSAQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMDLSIAI 363

Query: 348 PMFLLSR---KIKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKR 396
             +  SR   K+   G          ++ SG G+DE++GGY  F+   S  E   E  K+
Sbjct: 364 AFYFASRGRGKVTENGESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SNEELVIELQKQ 422

Query: 397 VKNLHLADCLRANKSTMSWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRI-EKYILR 455
           +  +H  +  R +K   + G+E R PFLD   +Q  +++ P    +N    R+  K ILR
Sbjct: 423 IAQIHDRNLNRDDKVISNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILR 481

Query: 456 KAFDTSDEP 464
             F  S+EP
Sbjct: 482 LDF-ISEEP 489

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 SWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRK 456
           + G+E R PFLDR  ++  M   P    IN       K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIPINWKIN-------KLILRK 471

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 36/175 (20%)

Query: 66  CGD-YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHD----IDAPKYLDGMF 120
            GD Y+L  NGE+YN             + L +    +   L++D     +   +L+G F
Sbjct: 84  VGDRYILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEF 131

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFAS---ELKCLTDDCDSIMAFPP 177
           A+ +YD  + ++   RD IG  +L   R  ++   ++ AS   + +  TD    I+    
Sbjct: 132 AYTIYDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV---- 186

Query: 178 GHVYDSETDQITRYFSPDWIDEQRIPTEPVS--------YKAIRESLEKAVRKRL 224
            ++YD E   + +   P  I  + + +E +           A+ E L+ A+ KR+
Sbjct: 187 -YIYDVEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLQLCMNIDPAEKMINASEGR---IEKYILRKAFDTSDEP 464
           FLD E +Q  ++  P    +N    R   +EK  LR   D + EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 74/168 (44%), Gaps = 20/168 (11%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDAK 128
           YVL  NGE+YN  ++  +   Y    L  C+  +       +   + LDG FA+ +YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLK 143

Query: 129 KDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHVYDSETDQI 188
           +  I   RD IG  +L    +  S + +F +S         D +      + YD++T  +
Sbjct: 144 EGNIYFGRDTIGKRSLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVI--YTYDTKTHTL 200

Query: 189 -------TRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVP 229
                   +Y   D  DE  +  E    + +  +L ++V+KR+++  P
Sbjct: 201 DDTKVIRDKYVVTDMTDE--LENESQYMELLYGTLYESVKKRVLSIHP 246

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 12/113 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA---FDTSDEPDEKP 468
            R PFLD    +  +N+   E  IN    ++ K ILRK    F   DE  E+P
Sbjct: 448 VRYPFLD----EYVINLSTLEIPINY---KVNKLILRKVASLFLKLDEIAEEP 493

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 54/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQPITSPCGD----YVLCVNGEIYN-HI 81
           I  RGP++S   V    I  H+      + S  +P T    +    Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYNKEI 102

Query: 82  QLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDAKKDRIIAARDPIGI 141
              ++   Y    L + E       ++ +D  + L+G +A+ +YD K       RDPIG 
Sbjct: 103 SDWDNDSLYIASLLRNLED-----GRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILR 455
           +E R PFLD    +  +N    E  IN    +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDAK 128
           Y+L  NGE+YN+     S   Y    L        L  K  I+  + L+G FA+ ++D+K
Sbjct: 89  YILQFNGELYNNEIHGISDTTYFVNCLKTA-----LDEKDIINILRTLEGEFAYTIFDSK 143

Query: 129 KDRIIAARDPIGITTL 144
           K  +   RD IG  +L
Sbjct: 144 KKLVYFGRDTIGKRSL 159

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   S G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA 457
           FLD   +Q      P    +N       K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINYKVN-------KLILRKV 474

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKY--KTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYD 126
           YVL  NGE+YN  ++++   D ++    LS    +I     H +     LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI-----HTLTQ---LDGEFAYTIYD 138

Query: 127 AKKDRIIAARDPIGITTL 144
            ++ +I   RD IG  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 97/435 (22%), Positives = 168/435 (38%), Gaps = 94/435 (21%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHD------IDAPKYLDGMFAW 122
           YVL  NGE+YN   +            +D + I+ L L  +      I   K LDG FA+
Sbjct: 90  YVLQFNGELYNDEIIH-----------NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAF 138

Query: 123 CLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFF----ASELKCLTDDCDSIMAFP-- 176
            +YD K  R            LY GR+    +++ +    A+EL  ++    SI  F   
Sbjct: 139 SIYDLKNKR------------LYFGRDPIGKRSLCYYLTDANEL-YVSSVSGSIKGFKNC 185

Query: 177 -PGHVYD---SETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEK-------AVRKRLM 225
             G +Y+   +  +     F+  + D        + +K++++ +E+       AVRKR++
Sbjct: 186 DAGVIYEYDATNKNSPLTIFNNIFEDFTINDKSDLEFKSLQKHIEELYKVLYNAVRKRVL 245

Query: 226 A-----------EVPYXXXXXXXXXXXXIASIAARETEKAMKEMDTTAYDSEDKHLTGID 274
           +            V +            I  +   E +KA+ E+    +++    L   D
Sbjct: 246 SIHPTHIENSPIAVLFSGGLDCSVIVALICEVIRNEKKKAIIELLNVGFENPRTGLMPKD 305

Query: 275 DQGNLHTAGWSRLHSFAIGLPNAPDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYH 334
                     S  +      PN P  L    V       + E+     E    + D++Y 
Sbjct: 306 TPD--RKLAISSSYILQKLYPNVPIKLIEVDVP------YDEYL----EKRPIVIDLMYP 353

Query: 335 LETYDVTTIRASTPMFLLSR-------------KIKAQGVKMVLSGEGSDEIFGGYLYFA 381
            ET     +  +   +  SR             + + +G+ ++ SG G+DE++GGY  F 
Sbjct: 354 KETE--MDLSIAIAFYFASRGKGYIQTGSDKRIEYRRKGI-VLFSGLGADELYGGYHKFV 410

Query: 382 QAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVPFLDREFLQLCMNIDPAEKM 441
              +  E   E  +++ N+H  +  R +K   + G+E R PFLD   ++   +  P    
Sbjct: 411 NK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYPFLDEHVIKYSTHDIPINYK 469

Query: 442 INASEGRIEKYILRK 456
           IN       K ILRK
Sbjct: 470 IN-------KLILRK 477

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA 457
           FLD   ++L      AE  IN    ++ K ILRK 
Sbjct: 452 FLDEYVIKLST----AEIPINF---KVNKLILRKV 479

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 69  YVLCVNGEIYN-HIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDA 127
           Y L  NGE+YN  I   ++   Y    L + +  + +     ID  K L+G +A+ +YD 
Sbjct: 89  YFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDV 143

Query: 128 KKDRIIAARDPIGITTL 144
              ++   RDPIG  +L
Sbjct: 144 NSSKLYFGRDPIGRRSL 160

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 SWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILR 455
           S G+E R PFLD   ++      P    IN       K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTEDLPINYKIN-------KLILR 473

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 60  QPITSPC----GDYVLCVNGEIYN-HIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPK 114
           QP T       G YVL  NGE+YN  I+  ++   Y    L+  E  IP       D   
Sbjct: 76  QPFTKQSLVVDGRYVLQFNGELYNDEIEFNDT--QYIADMLARGEASIP-------DIIA 126

Query: 115 YLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
            LDG FA+ +YD +  +    RD IG  +L
Sbjct: 127 RLDGEFAYTIYDTEDQKYYFGRDAIGKRSL 156

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMSWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRK 456
             + G+E R PFLD E ++      P    +N       K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINYKVN-------KMILRK 475

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 25/171 (14%)

Query: 69  YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDAK 128
           YVL  NGE+YNH ++  +   Y    L +  P IP  +K        L+G FA+ +YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAIIKK-------LNGEFAYSIYDIQ 141

Query: 129 KDRIIAARDPIGITTL--YMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHVYDSETD 186
                  RD +G  +L  ++  N+      F+   L  +T    + +    G +Y   T 
Sbjct: 142 NGTFYFGRDTVGKRSLSYFLDENTGE----FY---LASVTGSQPNFIDCTAGIIYQYSTR 194

Query: 187 --------QITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVP 229
                    I+  +      +Q++   P     + E L KAV +R+++  P
Sbjct: 195 SKKLNSDLSISSPYEIATTMDQQLTKLPNCIDGLFEHLNKAVHRRIVSIHP 245

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLQLCMNIDPAEKMINASEGRIEKYILRK 456
           FLD + ++      P    IN       K ILRK
Sbjct: 455 FLDIDVIKFSTEELPINYKIN-------KLILRK 481

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 69/151 (45%), Gaps = 24/151 (15%)

Query: 27  IRHRGPDWSG-NVVKNSTILVHERLAIVGLDSGAQPITSPCGD----YVLCVNGEIYN-H 80
           I  RGP++S   V K  +I     +      S  +P T  C +    YV+  NGE+YN  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFSSVL-----SLREPFTKQCVEIKDRYVVQFNGELYNDE 103

Query: 81  IQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMFAWCLYDAKKDRIIAARDPIG 140
           IQ  ++   Y  + L + + II        D  + LDG FA+ +YD +       RDPIG
Sbjct: 104 IQYNDT--QYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIG 153

Query: 141 ITTLYMGRNSKSPKTVFFASELKCLT--DDC 169
              L    ++++ + ++ +S   C T   DC
Sbjct: 154 RRCLSFSIDNETGE-LYISSVTGCKTGFQDC 183

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 12/113 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA---FDTSDEPDEKP 468
            R PFLD   ++      P    IN       K ILR     +   DE  E+P
Sbjct: 448 VRYPFLDEHVIKFSAVDIPINFKIN-------KLILRNVASHYLKLDEIAEEP 493

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 56/127 (44%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQPIT----SPCGDYVLCVNGEIYNHIQ 82
           I  RGP++S   V  +    ++      + S  QP T    S    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LRESCPDYKYKTLSDCEPIIPLY--LKHD---IDAPKYLDGMFAWCLYDAKKDRIIAARD 137
            +E   D      +D + I  L   L  D   ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 -KEISDDD-----NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTL 144
           PIG  +L
Sbjct: 154 PIGRRSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLQLCMNIDPAEKMINASEGRIEKYILRK 456
           FLD + ++      P    +N       K ILR+
Sbjct: 449 FLDHDVIKFSTEEIPINYKVN-------KMILRR 475

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 29/216 (13%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQPITSPC----GDYVLCVNGEIYNH-I 81
           I+ RGPD+S   V +     H       + S  +P TS        ++L  NGE+YN  I
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQEI 102

Query: 82  QLRESCPDYKYKTLSDCEPIIPLYLKHDI-DAPKYLDGMFAWCLYDAKKDRIIAARDPIG 140
              ++   +    L +          HD+    + L G FA+ LYD ++ +    RD +G
Sbjct: 103 TAHDNDTQFIVSKLQEG--------YHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVG 154

Query: 141 ITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHVYDSETDQI-------TRYFS 193
             +L    ++ + + ++ +S    +    D I      +VYD+E+  +       ++YF 
Sbjct: 155 KRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFI 211

Query: 194 PDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVP 229
              +DE+    +  + + +   L  AVRKR+++  P
Sbjct: 212 TKKLDEELTCLDS-TVEQLYGMLSLAVRKRVLSIHP 246

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 19/99 (19%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLQLCMNIDPAEKMINASEG-----RIEKYILRK 456
           FLD             EK+I AS       + +K ILRK
Sbjct: 441 FLD-------------EKVIKASVALPISYKNDKMILRK 466

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA 457
           PFLD    +  +     E  IN    ++ K ILRK 
Sbjct: 451 PFLD----EYVIKFSTVEIPINY---KVNKLILRKV 479

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 16/122 (13%)

Query: 110 IDAPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVF-FASELKCLTDD 168
           ID  K L+G +A+ +YD K  +    RDPIG  +L     + +   V      ++C  D 
Sbjct: 126 IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGRRSLSYSVTANNELYVASVTGAVECFHDC 185

Query: 169 CDSIMAFPPGHVYDSETDQI--TRYFSPDWIDEQRIPTEPVS--------YKAIRESLEK 218
               +     + YD++T  +   +   P +    ++  E VS        Y  +RES++K
Sbjct: 186 IGGTV-----YEYDTQTKSLHDNQRLRPPYEVTPKLDMEFVSLSIVSKNLYSVLRESVKK 240

Query: 219 AV 220
            +
Sbjct: 241 RI 242

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   S G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLQL 431
            R PFLD + +Q 
Sbjct: 445 VRYPFLDEKVVQF 457

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 25/127 (19%)

Query: 69  YVLCVNGEIYNH-IQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKY---LDGMFAWCL 124
           +VL  NGE+YN  IQ             +D   I  L  ++  D PK    ++G FA+ +
Sbjct: 91  FVLQYNGELYNSSIQH------------NDTLFIASLIERYQDDIPKAIREMEGEFAYTI 138

Query: 125 YDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLT---DDCDSIMAFPPGHVY 181
           +D + +++   RD IG  +L    +S++ K   F S +   +   +DC+    +    +Y
Sbjct: 139 FDKQCEKLYFGRDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IY 192

Query: 182 DSETDQI 188
           DS+T  +
Sbjct: 193 DSKTGNL 199

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 102 IPLYLKHDIDAPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASE 161
           +P YL+ DIDAPK+L+ MFA+     +K              ++ G +    +T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDSIMAFPPGHVYDSE 184
             L C    LT  CD+  +F PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MSWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEP 464
              G+E R PFLD E + L  ++ P     N +  R+      +  D  +EP
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL-PINYKTNKNILRLLATNKLQLMDIGEEP 485

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   S G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILR 455
           +E R PFLD   ++    + P    +N       K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL-PINYKVN-------KMILR 472

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 13/89 (14%)

Query: 60  QPITSPCGD----YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKY 115
           +P+T  C D    +VL  NGEIYN   +  +   Y    LS  + +  +  K        
Sbjct: 78  EPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATELSIVQNVPTVIRK-------- 128

Query: 116 LDGMFAWCLYDAKKDRIIAARDPIGITTL 144
           L G FA+ +YD     I   RD +G  +L
Sbjct: 129 LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 SWGLEARVPFLDREFLQL 431
           S G+E R PFL  E ++ 
Sbjct: 442 SNGVEVRYPFLAEEVVEF 459

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 38/174 (21%)

Query: 1   MCGIFAAY----KHENAEAFK------PR------ALQLSKRIRHRGPDW-SGNVVKN-S 42
           MCGI   Y    K EN    +      PR         + K +R RGP++ S   +K+ +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TILVHERLAIVGLDSGAQPITSPC----GDYVLCVNGEIYNHIQLRESCPDYKYKT--LS 96
           +I +   L++       QP T         YVL  NGE+YN  ++ ES  D ++ +  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPLYLKHDI-DAPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRN 149
            C        + DI +    LDG FA+ + D + + I   RD IG  +L    N
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSLSYSLN 161

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   S G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLQLCMNIDPAEKMINASEGRIEKYILRKA 457
           FLD + +     + P    +N       K ILRK 
Sbjct: 448 FLDDQVVAFSTQL-PINYKVN-------KMILRKV 474

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 40/92 (43%), Gaps = 19/92 (20%)

Query: 60  QPITSPCGD----YVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAP-- 113
           +P T  C +    +VL  NGEIYN      S  D +Y         I   L +  D P  
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS---SISHNDTQY---------IAEMLLNAKDIPSV 125

Query: 114 -KYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
            + L G FA+ +YD     +   RDPIG  +L
Sbjct: 126 IRTLSGEFAYTIYDKLTGEVFFGRDPIGRRSL 157

>SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285)
           [459 bp, 152 aa] {ON} highly similar to uniprot|Q07648
           Saccharomyces cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr)
           deacylase functions in protein translation may affect
           nonsense suppression via alteration of the protein
           synthesis machinery ubiquitous among eukaryotes
          Length = 152

 Score = 31.2 bits (69), Expect = 3.8,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 32/83 (38%), Gaps = 11/83 (13%)

Query: 452 YILRKAFDTSDEPDEKPYLPEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELF---- 507
           Y+L     T D  ++   L ++I     + F D  GY W   +KD    ++S   F    
Sbjct: 27  YMLLVGISTEDNTEDAEKLSKKI--ASLKVFDDDTGYGWKKSIKDVEGEILSVSQFTLMA 84

Query: 508 -----STPKEHWGADIPTTKEAY 525
                + P  H     PT KE Y
Sbjct: 85  RTKKGTKPDFHMAQKGPTAKELY 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,936,652
Number of extensions: 2633543
Number of successful extensions: 5818
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5877
Number of HSP's successfully gapped: 64
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)