Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.173.488ON31331315910.0
TDEL0D055603.488ON3113028311e-110
TBLA0C044503.488ON3093128181e-108
TPHA0D042203.488ON3163198151e-108
NCAS0F035303.488ON3133157148e-93
YPR147C3.488ON3043127139e-93
ZYRO0D10076g3.488ON3053117052e-91
CAGL0L08514g3.488ON3123137043e-91
KLTH0F14740g3.488ON3023046782e-87
Suva_16.4763.488ON3043126782e-87
Kwal_55.212193.488ON3023046763e-87
Skud_16.4423.488ON3043126764e-87
Smik_16.4003.488ON3043126687e-86
NDAI0B058303.488ON3293336045e-76
SAKL0F02860g3.488ON3053005973e-75
AFR306C3.488ON3192885114e-62
Ecym_12413.488ON3052934982e-60
NCAS0B022608.524ON363116760.53
TPHA0L016008.524ON372124750.69
Smik_2.3458.524ON375144721.6
YGL197W (MDS3)8.157ON148762694.2
TPHA0K00200na 1ON31433684.4
Skud_7.758.157ON148162694.5
ZYRO0G18942g8.135ON492111677.4
TBLA0E042608.242ON120259669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.17
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   617   0.0  
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   324   e-110
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   319   e-108
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   318   e-108
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   279   8e-93
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   279   9e-93
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   276   2e-91
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   275   3e-91
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   265   2e-87
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   265   2e-87
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   265   3e-87
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   265   4e-87
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   261   7e-86
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   237   5e-76
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   234   3e-75
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   201   4e-62
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   196   2e-60
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    34   0.53 
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    33   0.69 
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    32   1.6  
YGL197W Chr7 (124698..129161) [4464 bp, 1487 aa] {ON}  MDS3Putat...    31   4.2  
TPHA0K00200 Chr11 complement(33601..34545) [945 bp, 314 aa] {ON}...    31   4.4  
Skud_7.75 Chr7 (130412..134857) [4446 bp, 1481 aa] {ON} YGL197W ...    31   4.5  
ZYRO0G18942g Chr7 (1566521..1567999) [1479 bp, 492 aa] {ON} weak...    30   7.4  
TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON} Anc_...    30   9.7  

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/313 (96%), Positives = 301/313 (96%)

Query: 1   MSLVKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPT 60
           MSLVKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPT
Sbjct: 1   MSLVKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPT 60

Query: 61  WEVLGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHS 120
           WEVLGISHAGMSYDGNE            VFDLEEQVQHKVDIINKFSSKNRPLIIMGHS
Sbjct: 61  WEVLGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHS 120

Query: 121 VGAYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQ 180
           VGAYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQ
Sbjct: 121 VGAYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQ 180

Query: 181 FIFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDW 240
           FIFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDW
Sbjct: 181 FIFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDW 240

Query: 241 GFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDTIPHAF 300
           GFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDTIPHAF
Sbjct: 241 GFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDTIPHAF 300

Query: 301 VIKKSKYIVDQYF 313
           VIKKSKYIVDQYF
Sbjct: 301 VIKKSKYIVDQYF 313

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 205/302 (67%), Gaps = 4/302 (1%)

Query: 12  YPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGM 71
           YPTSIVH   ++      + PLFVWIPGNPGL+EYY +FL L+H+++P WEVLGISHAGM
Sbjct: 11  YPTSIVHFKSISIR-GKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGM 69

Query: 72  SYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIM 131
           S                 V+ L++Q+ HK++II  FSS NRPLIIMGHSVGAY+ Q +++
Sbjct: 70  S---TASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVL 126

Query: 132 TNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFF 191
           ++KL GK+ K+G LTPT++DIH S KG+ +TKV  W  +LP   GW S  +F   LP F 
Sbjct: 127 SDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFFLPSFI 186

Query: 192 VKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCN 251
           ++  +S  + C  +S+ VL +  LL N   ++QALGL+ YEME I  DW F ++LI +CN
Sbjct: 187 LRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCN 246

Query: 252 ETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDTIPHAFVIKKSKYIVDQ 311
           E G+ TW LF++ DHWVA +TR+++I FY+ H + + I+I    IPH+FV+  SKY++ +
Sbjct: 247 ERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCKIPHSFVLNHSKYLISE 306

Query: 312 YF 313
           YF
Sbjct: 307 YF 308

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  319 bits (818), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 212/312 (67%), Gaps = 7/312 (2%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           ++++ DS YPTSIVH  P       ED+PLF+WIPGNPGLLEYY   L  +H K PTWE+
Sbjct: 3   IQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEI 62

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           LG+SHAGMS +GN+            V+ L+EQV HKV++IN FSS  R +IIMGHSVGA
Sbjct: 63  LGVSHAGMS-NGNQIKNVLSTK----VYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGA 117

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ QRVIM + L G +IK+G +TPTVVDIH S KGIKMT+ FN    LP  +G +S   F
Sbjct: 118 YMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAF 177

Query: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242
            KL P  F ++ ++ ++ C + D++A  AS   L N + ++Q LGLA++EM+ I DDW F
Sbjct: 178 SKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNF 237

Query: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301
            K+LIDYCN+  V TWFLF+  DHWV+  TR E+I+FY+ + K + + + + + IPH+FV
Sbjct: 238 QKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFV 297

Query: 302 IKKSKYIVDQYF 313
           I  S + V+ YF
Sbjct: 298 INFSDFTVNSYF 309

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  318 bits (815), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 218/319 (68%), Gaps = 14/319 (4%)

Query: 4   VKVFEDSIYPTSIVHL------DPLTKELSPED--SPLFVWIPGNPGLLEYYVDFLALVH 55
           + VF+DS +PTSI+ +      D L+ +L+  D  SPLFVWIPGNPGLLEYY +FL L+H
Sbjct: 3   ITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKLLH 62

Query: 56  KKNPTWEVLGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLI 115
            KNP W++LGISHAGMS  GN             V+ L+EQ+ HK++IINKF++  R LI
Sbjct: 63  VKNPEWDILGISHAGMS-SGNSNLKENECS----VYTLDEQIHHKIEIINKFAAYGRELI 117

Query: 116 IMGHSVGAYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHV 175
           +MGHSVGA++ Q+V+M+NKL GK+ K+G L PTV+DIHLS+KG +++ + NW  NLP   
Sbjct: 118 VMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLA 177

Query: 176 GWISQFIFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEA 235
           GW+S+ IF   LP+  VKF IS  ++ + ++ A  A+ T L+++N +EQ+LGLA YEM+ 
Sbjct: 178 GWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQI 237

Query: 236 IHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-D 294
           I  DW F ++L+  CN   ++ W LFAE DHWV++ TR E+I+ Y+     +     I D
Sbjct: 238 IRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITD 297

Query: 295 TIPHAFVIKKSKYIVDQYF 313
            +PHAFVIK S ++VD YF
Sbjct: 298 QVPHAFVIKNSCHVVDNYF 316

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  279 bits (714), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 203/315 (64%), Gaps = 9/315 (2%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           V+ ++D  +PT +VH+ P+    + E +P+FVWIPGNPG+LEYY + L  +H+K+PTWE+
Sbjct: 3   VEAYDDDEFPTCVVHILPIK---TAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEI 59

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKF-SSKNRPLIIMGHSVG 122
           L ISH GM+                 VF L+EQ+QHK+ IIN F    N P+ I GHSVG
Sbjct: 60  LAISHIGMN-TKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 123 AYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTS-NLPHHVGWISQF 181
           AY+ Q+++ +++L G+++K+G +TPT++DIHLS+KG  MT+   W+   LPH + ++   
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 182 IFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWG 241
           +F  L+P     + I  ++ C  DS A +++   L   N + Q+LGLA  EM+ IHDDW 
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQ 238

Query: 242 FHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPEN--IRIDI-DTIPH 298
           F  +LI+YC +  +K  FLF+  DHWV  +TRKE+I FYQ   K     ++ID+ D  PH
Sbjct: 239 FQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPH 298

Query: 299 AFVIKKSKYIVDQYF 313
           +FV+++SKY+V+ YF
Sbjct: 299 SFVVRRSKYVVEHYF 313

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  279 bits (713), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 198/312 (63%), Gaps = 12/312 (3%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           VK +  S  P SI+++ P T   S ED+PL VWIPGNPGLL YY + L  +H K+P WE+
Sbjct: 3   VKEYTKSKLPCSILNIKP-TVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEI 61

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           LGISHAGM+ + +             +F L++QV H+V++IN FS KNR +IIMGHSVGA
Sbjct: 62  LGISHAGMTLNAHSNTP---------IFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGA 112

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ Q+V ++NKL G + KVG +TPTV+DIH S+ GIKMT    +   L H V   S   F
Sbjct: 113 YIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFF 172

Query: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242
           + +L   F +F I K + C S    AVL++   L +   + Q+LGLA  EME I  +W F
Sbjct: 173 YWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEF 232

Query: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301
             + I+YC E G+  WFLF+ +DHWV+  TR  + D+Y+   K E ++ID+ D IPH+FV
Sbjct: 233 QDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFV 292

Query: 302 IKKSKYIVDQYF 313
           +K ++Y ++ +F
Sbjct: 293 VKHAEYAINAFF 304

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  276 bits (705), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 207/311 (66%), Gaps = 9/311 (2%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           ++    +  PTS++H+     +     SPLFVWIPGNPG+++YY +FL L+H+K  ++E+
Sbjct: 3   IRYLAGARLPTSVLHI---KPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEI 59

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           L ISHAGM+ +  +            ++ L++Q+QHKV+IIN+FS+K+RPLI+MGHSVGA
Sbjct: 60  LAISHAGMATEDPDLQKRKAT-----IYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGA 114

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ Q V++  KL G+++K+G +TPTVVDIH S KG ++T+ F W   LP    W+S  +F
Sbjct: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLF 174

Query: 184 HKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFH 243
           +KL  + F    IS  +   ++S  V  S +L++N  +I QALGLA  EM+ I   W F 
Sbjct: 175 NKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQ 234

Query: 244 KKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAFVI 302
           KKLID+CN   ++T F+F+ +D WV+++TR+ ++ FY+ + +  N+ I +   + H+F++
Sbjct: 235 KKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIV 294

Query: 303 KKSKYIVDQYF 313
           K SKYIVD+YF
Sbjct: 295 KHSKYIVDEYF 305

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  275 bits (704), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 201/313 (64%), Gaps = 6/313 (1%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           V+ + DS  PT I+H+ P T   + E SPLFVWIPGNPGLLEYY +FLA VH KNPTWE+
Sbjct: 3   VQGYHDSALPTCIIHIKP-TVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEI 61

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSK-NRPLIIMGHSVG 122
           LGISHAG   + ++            ++DL++Q QHK+DIINK ++  NR L+IMGHSVG
Sbjct: 62  LGISHAGTVIESSQLKKFRKNPLP--IYDLKQQTQHKIDIINKINNDPNRELVIMGHSVG 119

Query: 123 AYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFI 182
           AY+ Q V+ +  L G++ K+G +TPT+ DIH S  G+  T+VFN+ SN+  ++ +IS  I
Sbjct: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179

Query: 183 FHKLLPLFFVKFFISKMIKCSEDS-NAVLASGTLLRNANLIEQALGLATYEMEAIHDDWG 241
           F+KL+P ++ K  IS  + CS D  + +L +  LL     + Q LGLA +EM  I DDW 
Sbjct: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239

Query: 242 FHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAF 300
           F + L+  C + G K W LF+++DHWV+  T+ E+I F +       +R+D+D  I H+F
Sbjct: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299

Query: 301 VIKKSKYIVDQYF 313
           V+K    +  +YF
Sbjct: 300 VVKDVDLVTRRYF 312

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  265 bits (678), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 190/304 (62%), Gaps = 16/304 (5%)

Query: 13  PTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMS 72
           P+SI+HL      L   D+ LFV+IPGNPGL+EYYV FL  VH+KNP WE+LGISHAGM+
Sbjct: 12  PSSILHLKSGVSSLG-SDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70

Query: 73  YDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMT 132
              +             V+ L+EQ+ HKVD+IN ++  N+ + IMGHSVGA++ Q+V+ +
Sbjct: 71  SCND---------IACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTS 121

Query: 133 NKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFV 192
             LN ++ +VG LTPTV+DIH S+KG+K+T +          V  +    F KL P F  
Sbjct: 122 GLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLT 181

Query: 193 KFFISKMIKCSEDSNAVLASGT--LLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYC 250
            + IS     ++D    L + T  LL N+  ++QALGLAT EM+ I  DW + K  + YC
Sbjct: 182 SWIISHF---ADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYC 238

Query: 251 NETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAFVIKKSKYIV 309
              G K W+LF+++DHWV+  TRK++I FY+ H+ PE + ID+ T I HAFV + ++ +V
Sbjct: 239 ETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVV 298

Query: 310 DQYF 313
             YF
Sbjct: 299 QHYF 302

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  265 bits (678), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 196/312 (62%), Gaps = 12/312 (3%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           ++ +  S  P SI+++ P T     ED+PL VWIPGNPGLL YY + +  +H K+P WE+
Sbjct: 3   IQEYTKSKLPCSILNIKP-TVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEI 61

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           LGISHAGMS +               +F L++QV H+V +IN FS  NR +IIMGHSVGA
Sbjct: 62  LGISHAGMSSNARSNTP---------IFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGA 112

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ Q+V ++N+L G + KVG +TPTV+DIH S+ G+KMT  F++   L H + +IS   F
Sbjct: 113 YIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFF 172

Query: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242
           + +L     K  I K + C +    AVL++   L +   + Q+LGLA+ E++ I  +W F
Sbjct: 173 YWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEF 232

Query: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301
             K I++C E G+ TWFLF+  DHWV   TRK +  +Y    K E++RID+ D +PH+FV
Sbjct: 233 QDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFV 292

Query: 302 IKKSKYIVDQYF 313
           +K ++Y ++ +F
Sbjct: 293 VKHAEYAINAFF 304

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  265 bits (676), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 194/304 (63%), Gaps = 16/304 (5%)

Query: 13  PTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMS 72
           P S+ H +      S  ++PLFV+IPGNPGL+E+Y  FLA +H+KNP WE+LGISHAGM+
Sbjct: 12  PCSLYHRNAGLNS-SGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70

Query: 73  YDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMT 132
               E            V+ LE+Q+ HK++IIN++    +P+IIMGHSVGA++ Q++  +
Sbjct: 71  SCSEEVSP---------VYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTS 121

Query: 133 NKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFV 192
            +L  K+I+VG LTPTV+DIH S+KG+K+T +  W  +  + V  ++  +F KLLP    
Sbjct: 122 RRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKIT 181

Query: 193 KFFISKMIKCSEDSNAVLASGT--LLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYC 250
           K  IS ++   +D  + L + T  L+ N+  ++QALGLA  E+  I  DW + K+ +  C
Sbjct: 182 KSIISLLV---DDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLC 238

Query: 251 NETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFVIKKSKYIV 309
            E   K W+LF+E DHWV+ +TR ++IDFY+ H+ P   +ID+  TI HAFV + +  ++
Sbjct: 239 QENDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVI 298

Query: 310 DQYF 313
            QYF
Sbjct: 299 KQYF 302

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  265 bits (676), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 198/312 (63%), Gaps = 12/312 (3%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           V+ +  S  P SI+++ P +     ED+PL VWIPGNPGLL YY + L  +H K+P WE+
Sbjct: 3   VQEYTKSTLPCSILNIKP-SVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEI 61

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           LG+SHAGM+ + +             +F L++QV H+V++IN FS +NR +IIMGHSVGA
Sbjct: 62  LGVSHAGMTLNAHSNTP---------IFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGA 112

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ Q+V +++KL G + K+G +TPTV+DIH S+ G+KMT V ++   L H V  +S   F
Sbjct: 113 YILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFF 172

Query: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242
           + +L     +F I K + C S    AVL++  LL +   + Q+LGLA+ EM+ I  +W F
Sbjct: 173 YWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEF 232

Query: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301
             + I+YC E  +  WFLF+  DHWVA  TR  +  +Y+   K E ++ID+ D IPH+FV
Sbjct: 233 QDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFV 292

Query: 302 IKKSKYIVDQYF 313
           +K ++Y V+ +F
Sbjct: 293 VKHAEYAVNTFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  261 bits (668), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 194/312 (62%), Gaps = 12/312 (3%)

Query: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63
           ++ +  S +P SI+++ P T   S ED+ L VWIPGNPGLL YY + L  +H K+P WE+
Sbjct: 3   IQEYTKSKFPCSILNIKP-TITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWEI 61

Query: 64  LGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123
           LGISHAGM+ + +             V+ L++QV H+V++IN FS +NR +IIMGHSVGA
Sbjct: 62  LGISHAGMTLNAHSNTP---------VYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGA 112

Query: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183
           Y+ Q+V +++ L G + KVG +TPTV+DIH S+ G+K+T   ++   L H V   S   F
Sbjct: 113 YILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFF 172

Query: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242
           + +L   F +F I K + C S    AVL++   L +   + Q+LGLA+ EME I  +W F
Sbjct: 173 YWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEF 232

Query: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301
             K I+YC + G   WFLF+ +DHWV+  TR  +  +Y+       + ID+ D IPH+FV
Sbjct: 233 QDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFV 292

Query: 302 IKKSKYIVDQYF 313
           +K +KY ++ +F
Sbjct: 293 VKHAKYAINTFF 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  237 bits (604), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 200/333 (60%), Gaps = 27/333 (8%)

Query: 3   LVKVFEDSIYPTSIVHLDPLTK-ELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTW 61
           LVK + +S YPTSI+H++     E  P  +PLF+WIPGNPG+L+YY  FL  +HKK+P W
Sbjct: 2   LVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHW 61

Query: 62  EVLGISHAGMSYDGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSK---------NR 112
           E+L I HAGM     +            ++ L EQ++HK+++I  F +K          R
Sbjct: 62  EILAIPHAGM-----DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKR 116

Query: 113 PLIIMGHSVGAYLTQRVIMTNKLNGKLI-------KVGYLTPTVVDIHLSDKGIKMTKVF 165
           PL+IMGHSVG Y+ QR+++T +    ++       K+G++TPT++DI+LS KGI ++   
Sbjct: 117 PLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGL 176

Query: 166 NWTSN-LPHHVGWISQFIFHKLLPLF--FVKFFISKMIKCSEDSNAVLASGTLLRNANLI 222
             T   LP+ + ++S F+F  +L  F    +  I+ ++ C     A + +  LL N+ L+
Sbjct: 177 QLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLV 236

Query: 223 EQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQY 282
           +Q+LGLA+ EM+ I  +W   K+ ++ CN   ++ W LF E DHWV + TR ++I FYQ 
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 283 HNKP-ENIRIDIDT-IPHAFVIKKSKYIVDQYF 313
           + K    ++I++ +  PH+FV+  S ++V+++F
Sbjct: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  234 bits (597), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 180/300 (60%), Gaps = 9/300 (3%)

Query: 14  TSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSY 73
           +S+ HL PL +E++ + +PLFV+IPGNPGL+E+Y  FL  + KK+  WE+LGISHAGM  
Sbjct: 13  SSLYHLKPLNQEVNSQ-TPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGM-- 69

Query: 74  DGNEXXXXXXXXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMTN 133
                           V+ L++QVQHK+ +IN F S NRPLII GHS+GAY+ Q++ +  
Sbjct: 70  ----ITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDV 125

Query: 134 KLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVK 193
            L G + K+  LTPTV+DIHLS+KG K+  +  W  N   +V   S  +F K+LP    +
Sbjct: 126 SLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITE 185

Query: 194 FFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNET 253
             +S  +  SE +    A+  L+ N   ++Q+LGLA  EM+ + DDW F    + +C   
Sbjct: 186 KILSLFVG-SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQ 244

Query: 254 GVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDID-TIPHAFVIKKSKYIVDQY 312
            V+  FLFA  DHWV   TR ++ +FY  +   + + ID D  I H+FV+  +K +VD+Y
Sbjct: 245 EVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  201 bits (511), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 168/288 (58%), Gaps = 16/288 (5%)

Query: 33  LFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYD-GNEXXXXXXXXXXXXVF 91
           + +++PGNPGL+ +Y +FL  +H+KNPTWE++GISH GMS   G E            V+
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR--------VY 92

Query: 92  DLEEQVQHKVDIINKF--SSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVGYLTPTV 149
            L EQV+HKV  IN F  +  N  + ++GHS+GAY+ Q+V++   L   +  VG LTPT+
Sbjct: 93  TLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTI 152

Query: 150 VDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVKFFISKMIKCSEDSNAV 209
           +DIH S KG+++T++  W      +V  + + +   LLP  ++ +   K+I  S D   +
Sbjct: 153 IDIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGS-DECVL 211

Query: 210 LASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVA 269
            ++  L++N + + QALG+A  EM  + + W F ++ I  C E     W LF+  DHWV 
Sbjct: 212 QSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVH 271

Query: 270 HSTRKEVIDFYQYH---NKPENIRIDIDT-IPHAFVIKKSKYIVDQYF 313
             T K++++FY+     N    +RI ID  I H+FV+K +  +V+ YF
Sbjct: 272 SDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  196 bits (498), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 170/293 (58%), Gaps = 13/293 (4%)

Query: 27  SPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEXXXXXXXXX 86
           S    PL ++IPGNPGL+ +Y +FL  +H++NPTWEV+GI H GMS              
Sbjct: 20  STPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMS------SLRENNSL 73

Query: 87  XXXVFDLEEQVQHKVDIINKF--SSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVGY 144
              V  L+EQ++ KV +IN+F  +  +R + ++GHS+GAY+ Q++ +   L GK+  V  
Sbjct: 74  SGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVML 133

Query: 145 LTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVKFFISKMIKCSE 204
           LTPT++DIH S KG+++T++ +W      +   + + +F  +LP  ++++   K+I  S 
Sbjct: 134 LTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGS- 192

Query: 205 DSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAED 264
           D   + ++  L+     ++QALGLA  EM  + + W F  + I +C    +K  FLF+  
Sbjct: 193 DECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGH 252

Query: 265 DHWVAHSTRKEVIDFYQYH---NKPENIRIDIDT-IPHAFVIKKSKYIVDQYF 313
           DHWV   T K++I+ Y+     ++ + + I ID  I H+FV+K +  +V+ YF
Sbjct: 253 DHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 43/116 (37%), Gaps = 5/116 (4%)

Query: 32  PLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEXXXXXXXXXXXXVF 91
           PL ++I G  G L  +   L L H K   +  L +   G S +               V 
Sbjct: 82  PLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETIRSVV 141

Query: 92  DLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVGYLTP 147
           DL    Q  +       +    LI+ GHS+G YL      T   N  + K+  L+P
Sbjct: 142 DLATGNQKSLG-----ENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 8/124 (6%)

Query: 24  KELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEXXXXXX 83
           KE S  D  ++++I G  G LE ++  L L    N ++  + +   G S   +E      
Sbjct: 83  KEQSSIDE-IYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQSEFNDEYNIANY 141

Query: 84  XXXXXXVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVG 143
                  F L+ QV       +++ + N  +I+ GHS+G YL        K   ++ K+ 
Sbjct: 142 SMSSIIGF-LKSQV------FSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIV 194

Query: 144 YLTP 147
            L P
Sbjct: 195 LLAP 198

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 16/144 (11%)

Query: 33  LFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEXXXXXXXXXXXXVFD 92
           +FV++PG  G LE +   L LV      +  L +   G   D +E            +F 
Sbjct: 88  VFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFG---DSSEWSDYPMLKVVELIFI 144

Query: 93  L-------EEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIK-VGY 144
           L          V  K D +N F+     L+++GHS+G +L   +   + ++ K++K +  
Sbjct: 145 LLCDVLKGRPAVLSKDDNLNFFNG--HKLVLVGHSMGCFLACHLYEQHLVDAKVVKTLVL 202

Query: 145 LTPTVVDIHLSDKGIKMTKVFNWT 168
           LTP    I    K     +++ W 
Sbjct: 203 LTPPKAHIEQLSKD---KRIYQWV 223

>YGL197W Chr7 (124698..129161) [4464 bp, 1487 aa] {ON}  MDS3Putative
           component of the TOR regulatory pathway; negative
           regulator of early meiotic gene expression; required,
           with Pmd1p, for growth under alkaline conditions; has an
           N-terminal kelch-like domain
          Length = 1487

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 144 YLTPTVVDI-HLSDKGIKMTKVFNWTSNLPHHVGW-------ISQFIFHKLLPLFFVKFF 195
           Y +P+V    HLS  G+ +  +FN T  LPHH          I  F  HK  PL  V F 
Sbjct: 438 YYSPSVQRFDHLSTFGLPLVNIFNKTIQLPHHKISASSLPIPIENFAKHKDTPLKKVSFT 497

Query: 196 IS 197
            S
Sbjct: 498 SS 499

>TPHA0K00200 Chr11 complement(33601..34545) [945 bp, 314 aa] {ON}
           YKL216W
          Length = 314

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 44  LEYYVDFLALVHKKNPTWEVLGISHAGMSYDGN 76
            EYY+D+     KK+P  E L  S AGMS D N
Sbjct: 79  FEYYLDYALQRQKKHPDSEPLFFSIAGMSIDEN 111

>Skud_7.75 Chr7 (130412..134857) [4446 bp, 1481 aa] {ON} YGL197W
           (REAL)
          Length = 1481

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 144 YLTPTVVDI-HLSDKGIKMTKVFNWTSNLPHHV-------GWISQFIFHKLLPLFFVKFF 195
           Y +P+V    HLS  G+ +  +FN T  LPHH          I  F  HK  PL  + F 
Sbjct: 438 YYSPSVQRFDHLSTFGLPLVNIFNKTIQLPHHRISASSLPTPIENFAKHKDTPLRKLSFT 497

Query: 196 IS 197
            S
Sbjct: 498 SS 499

>ZYRO0G18942g Chr7 (1566521..1567999) [1479 bp, 492 aa] {ON} weakly
           similar to uniprot|P46945 Saccharomyces cerevisiae
           YGL176C Hypothetical ORF
          Length = 492

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 47/111 (42%), Gaps = 13/111 (11%)

Query: 172 PHHVGWISQFIFHKLLPLFF--VKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLA 229
           P   G  S F F  +  + F  +K  IS  IK  +D   V  SG +  N+    QAL   
Sbjct: 307 PIAQGTNSGFDFKAMRKIKFPNIKLIIS--IKPFKDEGMVAVSGIMDTNS----QAL--- 357

Query: 230 TYEMEAIHDDWGFHKKL-IDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDF 279
            + ++ + D      KL   +CN T  K  F    D H++ + TR    DF
Sbjct: 358 -FVLDVLSDPCQMVIKLQTSFCNLTRDKEIFEITSDGHYICYGTRAGKGDF 407

>TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON}
           Anc_8.242 YER176W
          Length = 1202

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query: 198 KMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVK 256
           K+I CS  +  +L + T + NAN I   LG    +    H+   FHK   +   +  ++
Sbjct: 680 KIIPCSPQTTRILFAMTQINNANFINLILGKNPIKQIEFHNRIQFHKSTFNESQKAAIQ 738

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,959,343
Number of extensions: 1539836
Number of successful extensions: 3622
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3655
Number of HSP's successfully gapped: 31
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)