Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.153.490ON20720710561e-148
ZYRO0D10032g3.490ON2092013324e-38
SAKL0F02816g3.490ON1921973035e-34
Suva_7.4173.490ON2122092872e-31
TDEL0D055803.490ON1932002811e-30
Kwal_55.212263.490ON1962062751e-29
YGR129W (SYF2)3.490ON2152122751e-29
Skud_7.4403.490ON2132102646e-28
KLTH0F14784g3.490ON1951962574e-27
TPHA0D042403.490ON2092082577e-27
NCAS0E008203.490ON2021902568e-27
Smik_6.2253.490ON2132102523e-26
Ecym_12393.490ON1931982313e-23
AFR308W3.490ON1922012243e-22
NDAI0G009503.490ON2131992202e-21
KLLA0E04643g3.490ON2211942141e-20
TBLA0C044703.490ON2222301951e-17
CAGL0I10538g3.490ON2001981808e-16
KAFR0C019503.490ON1572021402e-10
KNAG0B008203.490ON2071611034e-05
ZYRO0C16016g3.345ON342196790.098
KLTH0A05962g6.308ON90773711.1
SAKL0H19690g8.161ON52359673.6
Kpol_513.285.9ON809108673.7
Suva_13.2982.419ON628119673.8
Smik_13.3142.419ON62679664.0
Smik_10.2525.165ON68434655.4
CAGL0I10384g3.503ON630109656.7
TDEL0D038803.236ON22858638.3
NCAS0I018203.173ON473114648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.15
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...   411   e-148
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   132   4e-38
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   121   5e-34
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   115   2e-31
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   112   1e-30
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   110   1e-29
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   110   1e-29
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   106   6e-28
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   103   4e-27
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...   103   7e-27
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   103   8e-27
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   101   3e-26
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    94   3e-23
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    91   3e-22
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    89   2e-21
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    87   1e-20
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    80   1e-17
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    74   8e-16
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    59   2e-10
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    44   4e-05
ZYRO0C16016g Chr3 (1256628..1257656) [1029 bp, 342 aa] {ON} high...    35   0.098
KLTH0A05962g Chr1 complement(492119..494842) [2724 bp, 907 aa] {...    32   1.1  
SAKL0H19690g Chr8 (1738416..1739987) [1572 bp, 523 aa] {ON} high...    30   3.6  
Kpol_513.28 s513 complement(84409..86838) [2430 bp, 809 aa] {ON}...    30   3.7  
Suva_13.298 Chr13 (484941..486827) [1887 bp, 628 aa] {ON} YMR119...    30   3.8  
Smik_13.314 Chr13 (488366..490246) [1881 bp, 626 aa] {ON} YMR119...    30   4.0  
Smik_10.252 Chr10 (399101..401155) [2055 bp, 684 aa] {ON} YJL019...    30   5.4  
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    30   6.7  
TDEL0D03880 Chr4 (710881..711567) [687 bp, 228 aa] {ON} Anc_3.23...    29   8.3  
NCAS0I01820 Chr9 complement(334312..335733) [1422 bp, 473 aa] {O...    29   8.6  

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score =  411 bits (1056), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MNMEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTG 60
           MNMEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTG
Sbjct: 1   MNMEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTG 60

Query: 61  TVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKS 120
           TVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKS
Sbjct: 61  TVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKS 120

Query: 121 TNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNEN 180
           TNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNEN
Sbjct: 121 TNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNEN 180

Query: 181 YSYINEKNKEFNDKLERQETKLLKDIN 207
           YSYINEKNKEFNDKLERQETKLLKDIN
Sbjct: 181 YSYINEKNKEFNDKLERQETKLLKDIN 207

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 130/201 (64%), Gaps = 12/201 (5%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M++ + +++F  LK+K+ +I +ENRKL++A ++EL    KP+ Y +E  A + ++ T   
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE--APEPSLPTQDD 68

Query: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTN 122
              ++L+NY+I++YEEW  +Q R + N    K    +   +AK+TYDK++ KL K     
Sbjct: 69  KHGNQLMNYTIQQYEEWNSRQ-RDQTN----KRDSGNLQDMAKYTYDKELNKLHKDTMLQ 123

Query: 123 D---NRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN- 178
           +   N G I K+ ++PKTGK+ + D  QL+K+LA+D+++T  ERY+   ++ ++++ QN 
Sbjct: 124 NRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNA 183

Query: 179 -ENYSYINEKNKEFNDKLERQ 198
                YINEKNK+FN+KL+RQ
Sbjct: 184 SSGGGYINEKNKQFNEKLDRQ 204

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  121 bits (303), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 126/197 (63%), Gaps = 13/197 (6%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTV-NTGT 61
           M++ + L + K LKRK VD+ ++NRK  +   ++ K++ KPK YSM    ED+T  +   
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMN---EDETFKDQKE 57

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKST 121
            D   +LLNYSI++YE+W+      K    +  S  +S   +AK+TYDK+I++++K  S 
Sbjct: 58  EDTRGKLLNYSIKDYEKWQ-----LKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSL 112

Query: 122 NDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENY 181
             NRGK++K R + K G+I +ND K+ ++QLA++LN++TK RY    ++ +K  D +   
Sbjct: 113 --NRGKVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEK-LDSSTTG 168

Query: 182 SYINEKNKEFNDKLERQ 198
            +IN+KNK+FN+KL RQ
Sbjct: 169 GFINDKNKQFNEKLSRQ 185

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  115 bits (287), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 122/209 (58%), Gaps = 15/209 (7%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M+++E   + K LKR+ VD  ++ RKL D   +E   N KP+ YSME+ ++D+ V     
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ---- 118
           D+ DR  +Y+++EY  WE+KQ + K     T+ + NS  Q+AK +YDK ++ L  Q    
Sbjct: 61  DDKDRAFHYTVQEYNAWEQKQKQRKSG--KTQGTGNSYDQLAKLSYDKTLRNLTTQNYGK 118

Query: 119 --KSTN--DNRG-----KISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQ 169
              S N  D++G     +I KI+K+  TGKI + D  +L+ +LA  L   +K+R+D   +
Sbjct: 119 HESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKR 178

Query: 170 KRQKNSDQNENYSYINEKNKEFNDKLERQ 198
           + +     +   S+IN+KNK+FN+KL R+
Sbjct: 179 QMENVKTPSGVESFINDKNKQFNEKLGRE 207

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  112 bits (281), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 120/200 (60%), Gaps = 17/200 (8%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M+++     FK LK+++VD+ I+ RK+ +   ++     KPK YSME+  E   + T  V
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNE---MGTRPV 57

Query: 63  DEADR----LLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ 118
           D ++R    L+NYS+REYEEW+KKQ + KE   V +   N   ++AK++Y+K    L + 
Sbjct: 58  DSSERRRLKLMNYSMREYEEWDKKQ-KGKE---VKRGGAN-VQELAKYSYEKD---LSRS 109

Query: 119 KSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN 178
           K  N NR  + KI  D KT ++ V D ++L+ +LA DL +TT+ER+    +  +K   + 
Sbjct: 110 KQNNGNR--VVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARA 167

Query: 179 ENYSYINEKNKEFNDKLERQ 198
               YINEKNK+FN KL+RQ
Sbjct: 168 TPGGYINEKNKQFNLKLDRQ 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  110 bits (275), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 119/206 (57%), Gaps = 22/206 (10%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSM------EELAEDDT 56
           M++ +  +  K LKRK +D+ ++N+  +    + +  + KP  YSM      EE+A+D  
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKD-- 58

Query: 57  VNTGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQ 116
                V EA++LL YS+ EYE+W   Q + K+N H  +    S   +AK TYDK++++L 
Sbjct: 59  -----VTEANKLLKYSMLEYEQW---QDKVKKNSHRLEGGA-SFQDLAKSTYDKEVQQLS 109

Query: 117 KQKSTNDNR-GKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNS 175
           K    + NR  K +K R + K GKIVV D +QL+  L E LN+T  ERY R  +K  +  
Sbjct: 110 K---IDGNRVNKNTKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQM 165

Query: 176 DQNENYSYINEKNKEFNDKLERQETK 201
           +   +  YINEKNK+FNDKLERQ  K
Sbjct: 166 NNTTSGGYINEKNKQFNDKLERQTKK 191

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  110 bits (275), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 122/212 (57%), Gaps = 18/212 (8%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAE-DDTVNTGT 61
           M+  +  E+ K LKRK VD+ I++RKL D   +E+  N KP+ YSME++ + D++V    
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKL------ 115
             E ++  +Y+++EY+ WE++  + K     ++    S  Q+AK +Y+K ++ L      
Sbjct: 61  SPEKEKAFHYTVQEYDAWERRHPQGK--TGQSQRGGISYDQLAKLSYEKTLRNLATQTQN 118

Query: 116 -QKQKSTNDN--------RGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDR 166
             KQ S+ D         +G+I K++KD KTGKI + D  +L+ +LA  L   +K+RY+ 
Sbjct: 119 SSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEA 178

Query: 167 TNQKRQKNSDQNENYSYINEKNKEFNDKLERQ 198
             ++ Q         S+IN+KNK+FN+KL R+
Sbjct: 179 RKRQMQNAKTLYGVESFINDKNKQFNEKLSRE 210

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  106 bits (264), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 120/210 (57%), Gaps = 16/210 (7%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAED-DTVNTGT 61
           ME+ +  ++ K LKRK V++ I+NRKL D   +E   N KPK YSME++ +  + V    
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKST 121
             + D+  +Y+++EY  W++KQ + K      + S NS  Q+AK +Y+K ++ L  Q S 
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQ--GQRSGNSYDQVAKLSYEKTLRNLVTQNSN 118

Query: 122 -NDNR------------GKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTN 168
            N+N             G I KI+++ KTGKI + D  +L+ +LA  L   +K+RY+   
Sbjct: 119 KNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARR 178

Query: 169 QKRQKNSDQNENYSYINEKNKEFNDKLERQ 198
           ++ +     +   S+IN+KNK+FN+KL R+
Sbjct: 179 KQMENAKTPSSVESFINDKNKQFNEKLSRE 208

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  103 bits (257), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 109/196 (55%), Gaps = 8/196 (4%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M++ +  +  K LKRK V + ++N++ +    ++    +KP  YSM+      +  T   
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTN 122
            EA +LL YS++++E+W+ K+ R  +      S V     +AKFTYDK++++L+K  +  
Sbjct: 61  KEA-KLLQYSMKDFEQWQDKERRKSQK----SSDVAKYQDLAKFTYDKEVQQLRKNYTNK 115

Query: 123 DNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYS 182
             + K   I K    GKIVV D   L+  LA+ LN+T  ERY R  +K  +    +    
Sbjct: 116 VEKPKKVSINK---KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGG 172

Query: 183 YINEKNKEFNDKLERQ 198
           +INEKNK+FNDK+ERQ
Sbjct: 173 FINEKNKQFNDKIERQ 188

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score =  103 bits (257), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 126/208 (60%), Gaps = 14/208 (6%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYS--MEELAEDDTVNTG 60
           M++   ++EFK LK++A+D LIE+RK L+A+ +E K   KPK YS  M++  + D  +  
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 61  TVDEADR-LLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK 119
             + ++R LL Y+IR+YEEWE+   R  +NV  T +S +S  Q AKFTYDK+I +++K++
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 120 ---STNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSD 176
              +T++   + S +++    GK+++ D K L+     D+N+ + +RY +  +    N+D
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNND 180

Query: 177 QNEN--------YSYINEKNKEFNDKLE 196
              +         SY N KNK+FNDKLE
Sbjct: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  103 bits (256), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 114/190 (60%), Gaps = 9/190 (4%)

Query: 12  FKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTVDEADR---L 68
            K LKRKA D  IENR L+D  +++++ + KP+ Y+M++  +D+ + T   D  D+   L
Sbjct: 11  LKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQD-DQDNQLETQEEDADDKVAKL 69

Query: 69  LNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKI 128
           +NY++R+YEEWEKKQ   K      K   +   Q+A F+YDK +  L + ++      + 
Sbjct: 70  MNYTLRQYEEWEKKQKDKK-----IKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTTTERE 124

Query: 129 SKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINEKN 188
            +I+ + KTGK+ + D K+L+  LA++L +T  +RY  T +K    S  +    YINE+N
Sbjct: 125 VQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINERN 184

Query: 189 KEFNDKLERQ 198
           K FN+KL+R+
Sbjct: 185 KHFNEKLDRE 194

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  101 bits (252), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 118/210 (56%), Gaps = 16/210 (7%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAE-DDTVNTGT 61
           M + +  +  K LK+K V++ I+NRKL D   +E   N KP+ Y+ME++ + D++V    
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK-S 120
             + DR  +Y+ +EY  WE++   H+  +  +K S  S  Q+AK +Y+K ++ L  Q  S
Sbjct: 61  SSDKDRAFHYTAQEYIAWEQRH--HQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLS 118

Query: 121 TNDNR------------GKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTN 168
             DN              +I +I+KD KTGKI + D  +L+ +LA  L   +K+RY+   
Sbjct: 119 EYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARK 178

Query: 169 QKRQKNSDQNENYSYINEKNKEFNDKLERQ 198
           ++ +     +   S+IN+KNK+FN+KL R+
Sbjct: 179 RQMESAVIPSGVESFINDKNKQFNEKLSRE 208

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 93.6 bits (231), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 119/198 (60%), Gaps = 13/198 (6%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSM-EELAEDDTVNTGT 61
           M+I +     +RLK K VDI I+NRK + +        SKP+ YS+ +E A  + V + +
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKST 121
             E  +LLNYS+ +YE+W++K+   + N   T S       IA  TY  +IK+L+K   T
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKE--KQANFDGTYS-----GDIAYSTYKNEIKQLRKGGLT 113

Query: 122 NDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKN-SDQNEN 180
              +GKI+K R   ++GK+ + D K+L+ +LA+ L +T++ER+ R  ++   + ++ +E 
Sbjct: 114 ---KGKITKGRI-SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSEL 169

Query: 181 YSYINEKNKEFNDKLERQ 198
            +++NEKN+ FN+KL RQ
Sbjct: 170 GNFVNEKNRHFNEKLSRQ 187

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 90.9 bits (224), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 109/201 (54%), Gaps = 20/201 (9%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M I++     ++LK+K VD  I NRK   +  R      KP+ YSM E   D+     T 
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ 60

Query: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQ-----K 117
            E  +LLNY I +YE+W++KQ RHK+      S      ++A  TY  ++ +L      K
Sbjct: 61  SEQLKLLNYRIADYEKWDEKQKRHKQ-----PSDGADLGELANSTYRSELHQLHRRGVVK 115

Query: 118 QKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQ 177
            ++TN   G+IS       +GK+V++D  +L+++LA  + QT K R++   +K  K+  +
Sbjct: 116 GRATN---GRIS------ASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGR 166

Query: 178 NENYSYINEKNKEFNDKLERQ 198
               S +N+KN+ FN+KL+R+
Sbjct: 167 ATAGS-LNDKNRHFNEKLDRE 186

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 89.4 bits (220), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 117/199 (58%), Gaps = 15/199 (7%)

Query: 10  EEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNT---GTVDEAD 66
           E  K LKR  +DI+ ENRK  D   +E  ++SKPK Y ++ + +DD  +T   G  D ++
Sbjct: 11  ENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSN 70

Query: 67  -------RLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK 119
                  +L+NY+IREYEEW+K+Q + K+   V  S +    ++A FTY+K++ KL   K
Sbjct: 71  EEEKRKFKLMNYTIREYEEWDKQQ-KDKQRKRVDGSDL---TELATFTYEKELSKLN-SK 125

Query: 120 STNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNE 179
             N +  +  +I  + + GK+ V D ++L+  L  +LN+T K+RY    +K Q  +  + 
Sbjct: 126 LENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSDI 185

Query: 180 NYSYINEKNKEFNDKLERQ 198
             +Y  +KNK+FN+KLER+
Sbjct: 186 AGNYFKDKNKQFNEKLERE 204

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 87.0 bits (214), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 110/194 (56%), Gaps = 18/194 (9%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDT-VNTGT 61
           MEI++ L   K L+++ V++ I N+K + A   E KKNS+ + YSM +  ED    N   
Sbjct: 40  MEIEKKL---KSLRKQKVEVSIRNKKAIIA---EEKKNSERRVYSMADDGEDKARSNKSE 93

Query: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKST 121
            ++  +L NYSIREYE+WE K    + N    KS +     IAK +Y K++  L K  S 
Sbjct: 94  PEDPIKLANYSIREYEKWEAKTQNSRHN----KSVMGDFQTIAKNSYKKEVDALPKDIS- 148

Query: 122 NDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENY 181
           +  +G I++       GK+ V D+ +L++++  DLN+ +K+RY    QK  K +  N + 
Sbjct: 149 HPLKGGITE------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDD 202

Query: 182 SYINEKNKEFNDKL 195
            +IN+KNK FN KL
Sbjct: 203 GFINDKNKRFNAKL 216

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 79.7 bits (195), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 116/230 (50%), Gaps = 40/230 (17%)

Query: 4   EIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTV------ 57
           +I E    +K LK KA +  I N+  L +   +   N+KPK YSM +  + D +      
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 58  ---NTGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVN-------STAQIAKFT 107
              N    +   +L+NY++REY++WE KQ     N + T+S  N       S   +AK T
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWELKQ-----NEYTTESQTNSKDDQIESLDSLAKRT 117

Query: 108 YDKQIKKLQKQ-KSTNDNR-----GKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTK 161
           YDK I+KL K  ++TN        GKI K  ++ ++ KIV+ D K L+++L  +L   + 
Sbjct: 118 YDKDIRKLNKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLKTKSD 176

Query: 162 ERYDRTNQKRQKNSDQNENYS-----YINEKNKEFNDKLERQETKLLKDI 206
             Y    ++R+       NYS     ++N KN+EFN+KL R+  KL   I
Sbjct: 177 RLYKHLGERRK-------NYSTTLSGHVNTKNQEFNEKLTREWKKLSNSI 219

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 73.9 bits (180), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 114/198 (57%), Gaps = 9/198 (4%)

Query: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62
           M +++  E+ K LK+   DI I NR LL     E +K  KP+ YSM +  EDD+    + 
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHD-DEDDSDEKRSS 59

Query: 63  DEAD----RLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ 118
           DE       L  Y+++++ +WEK+Q R K++   +KS +     +AK TYDK+++ L + 
Sbjct: 60  DEQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGM-RLQHLAKNTYDKELQNLPRP 118

Query: 119 KSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN 178
           +     + K ++ R +  +GK+ + D+K+L+++L+++L +T K+RYD +N+K   + +  
Sbjct: 119 EFK--MKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYD-SNRKIANDKEHT 175

Query: 179 ENYSYINEKNKEFNDKLE 196
                IN KN +FN  L+
Sbjct: 176 SLSGSINAKNLQFNKSLD 193

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 94/202 (46%), Gaps = 55/202 (27%)

Query: 1   MNMEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTG 60
           M M++    EEF+ L++K  +I IENRKL+          SKPKTYS+ E  E+      
Sbjct: 1   MEMDMANLREEFRDLRKKCREIKIENRKLISI-------ASKPKTYSIRE--EEIGAEVS 51

Query: 61  TVDEAD----RLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQ 116
             DE D    +LL   +RE+E             HV ++  +    I + TY+K++  L 
Sbjct: 52  DEDEDDSEIIKLLTKPLREFE----------TEAHVAENKED----IDRLTYNKEVMSLG 97

Query: 117 KQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSD 176
           K++                          K+ ++ L  ++N+ + ERY +  QKR++  D
Sbjct: 98  KRE--------------------------KRDVESLVSEMNRISDERYKKGAQKRRRLKD 131

Query: 177 QNENYSYINEKNKEFNDKLERQ 198
                 +INE+NK FN +LE++
Sbjct: 132 TER--GFINEQNKAFNLRLEKE 151

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 30/161 (18%)

Query: 42  KPKTYSME--ELAEDDTVNTGTVDEAD-RLLNYSIREYEEWEKKQGRHKENVHVTKSSVN 98
           KPK YS++  E + D       VD    +LLN  +R+ E  E ++G   EN     + V 
Sbjct: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRG---ENGDDAVARVE 123

Query: 99  STAQIAKFTYDKQIKKLQKQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQ 158
              ++AK TY K++  L ++ +    R  + +                     L   LN 
Sbjct: 124 GD-RVAKDTYKKELALLGRKSTRGTYRDNVER---------------------LVTHLND 161

Query: 159 TTKERY--DRTNQKRQKNSDQNENYSYINEKNKEFNDKLER 197
            +K+RY   +   KRQ     +    YINEKNK+FN KL+R
Sbjct: 162 VSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>ZYRO0C16016g Chr3 (1256628..1257656) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q12004 Saccharomyces cerevisiae
           YPR056W
          Length = 342

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 87/196 (44%), Gaps = 28/196 (14%)

Query: 9   LEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTVDEADRL 68
            E FK++  K+ D   + + ++DA +    + +KP+++  EE     TV    VD A RL
Sbjct: 4   FEPFKQISEKSAD---DKKPIMDAISDPTFQPTKPRSHLAEETPSLLTV---IVDTAPRL 57

Query: 69  LNYSIREYEEWEKKQGRHKE---------NVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK 119
                 E +    + G+  +         N H+  +S N  A IA   + + IK L  + 
Sbjct: 58  W----AELDNERNQTGKIIDMLKSLLVFLNAHLAFNSSNQVAVIA--AHSQGIKYLYPKS 111

Query: 120 STNDN---RGK-ISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNS 175
           S+N +   +GK +S I  D    +   N  + L+++L   L Q  KE+ D   QK     
Sbjct: 112 SSNQSNSLKGKDLSIINND--MYRQFRNVDETLVEEL-YGLFQQEKEQADEVTQKSTLAG 168

Query: 176 DQNENYSYINEKNKEF 191
             +   +Y+N  +KE 
Sbjct: 169 AMSAGLTYVNRVSKEL 184

>KLTH0A05962g Chr1 complement(492119..494842) [2724 bp, 907 aa] {ON}
           similar to uniprot|P27514 Saccharomyces cerevisiae
           YNR013C PHO91 Low-affinity phosphate transporter
           deletion of pho84 pho87 pho89 pho90 and pho91 causes
           synthetic lethality transcription independent of Pi and
           Pho4p activity overexpression results in vigorous growth
          Length = 907

 Score = 32.0 bits (71), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 51  LAEDDTVNTGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDK 110
           L+ D   +   ++EA+R L+  +RE+  WE+          V K  +N   Q   F    
Sbjct: 345 LSTDPNQDPAAIEEAERELSLHLREHVVWERNT--------VWKDMMNLERQAQNFKTAA 396

Query: 111 QIKKLQKQKSTND 123
             K+   QKS +D
Sbjct: 397 HAKRKATQKSLDD 409

>SAKL0H19690g Chr8 (1738416..1739987) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|P32316 Saccharomyces cerevisiae
           YBL015W ACH1 Acetyl-coA hydrolase primarily localized to
           mitochondria required for acetate utilization and for
           diploid pseudohyphal growth
          Length = 523

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 44  KTYSMEELAEDDTVNTGTV-DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTA 101
           +  ++ E  E D V   T  DE+ R +   + E+ E E K GR  EN+H  +S + + A
Sbjct: 224 RVVAIVESTERDKVPPNTPSDESSRAIASHLVEFFENEVKHGRMPENLHPLQSGIGNIA 282

>Kpol_513.28 s513 complement(84409..86838) [2430 bp, 809 aa] {ON}
           complement(84409..86838) [2430 nt, 810 aa]
          Length = 809

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 10/108 (9%)

Query: 93  TKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKISK--IRKDPKTGKIVVNDSKQLIK 150
           T   V++T ++A+F   K+   L    +T+   G      I  D +  K   N  +Q + 
Sbjct: 219 TSVEVDATPELAQFAVGKKTTDLSSIATTSSETGFFPALSIVLDSRGKK---NIDQQALA 275

Query: 151 QLAEDLNQTTKERYDR-----TNQKRQKNSDQNENYSYINEKNKEFND 193
           Q  +DL QTTK  Y++     T    + +S  N +Y  I++    +ND
Sbjct: 276 QSMDDLLQTTKTPYEKIIAYLTLIPIRLDSSTNLSYQPIDQWKATYND 323

>Suva_13.298 Chr13 (484941..486827) [1887 bp, 628 aa] {ON} YMR119W
           (REAL)
          Length = 628

 Score = 30.4 bits (67), Expect = 3.8,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 46/119 (38%), Gaps = 21/119 (17%)

Query: 108 YDKQIKKLQKQKSTND---NRGKISKIRKDPKTGKIVVNDSKQLIKQL--AEDLNQTTKE 162
           Y  ++ +  K   T+D    R  ISK R        ++   K+L+ QL  A    Q T E
Sbjct: 374 YLNELTQPSKDDKTSDFLKQRSSISKPRFFLMLPNFIIYVMKKLVGQLFFAFKNKQITDE 433

Query: 163 RYD----------------RTNQKRQKNSDQNENYSYINEKNKEFNDKLERQETKLLKD 205
           + D                  N     NSD  E +  +N  N++ ++  E  E + L+D
Sbjct: 434 KDDTAYSEPFKVLSTIEKNHVNNASLNNSDHEEGFELLNTNNEDLSEDYEPSEIESLRD 492

>Smik_13.314 Chr13 (488366..490246) [1881 bp, 626 aa] {ON} YMR119W
           (REAL)
          Length = 626

 Score = 30.0 bits (66), Expect = 4.0,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 38/79 (48%)

Query: 115 LQKQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKN 174
            +  K+  D   + SK+ K   TG +  N+ K +  +   +L  T+ E +    +  +  
Sbjct: 425 FKDNKNQEDRDNETSKLLKAGGTGFLDNNERKNVDHKDVTELLNTSDEDFSEDYEPSEVE 484

Query: 175 SDQNENYSYINEKNKEFND 193
           S ++ +  Y+NE + +F+D
Sbjct: 485 SLKDFDEEYLNEGSPDFSD 503

>Smik_10.252 Chr10 (399101..401155) [2055 bp, 684 aa] {ON} YJL019W
           (REAL)
          Length = 684

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 83  QGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQ 116
            GR   N+H+  S+    +   K TY K+IK LQ
Sbjct: 505 HGRFTNNLHIMNSAPRIISLYVKLTYTKEIKALQ 538

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 29.6 bits (65), Expect = 6.7,   Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 74  REYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKISKIRK 133
           R+Y    +K G +KE +H+T++    + Q    T D  I  +   ++T  N     +   
Sbjct: 31  RQYIPSNEKDG-NKERLHLTRTETVKSLQEMGMTQDAPIPDVNAPQTTTKNAIFPEEYTM 89

Query: 134 DPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYS 182
           +  TG + V  + Q + + +  ++++   + +R+  +R +N   + N S
Sbjct: 90  ETPTGLVPVA-TLQSLGRTSTAISKSRTRQIERSVSRRSQNIAASSNSS 137

>TDEL0D03880 Chr4 (710881..711567) [687 bp, 228 aa] {ON} Anc_3.236
           YBR035C
          Length = 228

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 149 IKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINEKNKEFNDKLERQETKLLKDI 206
           I+   E +N+TT ERY +T  +  K    +   S++ +  +E  D+L +Q  K  +DI
Sbjct: 121 IEGFTEHVNRTTSERYFKTRPRGSKIGAWSSPQSHVIQSREEL-DELTKQNEKRFQDI 177

>NCAS0I01820 Chr9 complement(334312..335733) [1422 bp, 473 aa] {ON}
           Anc_3.173 YDL020C
          Length = 473

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 65  ADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDN 124
           AD  L  +  + +E EKK   +K N H+ ++  N  A++        ++ +QK+   N++
Sbjct: 103 ADPSLTTTTTKDKEREKKNNINKLNFHIQRNHRNLLAKVKTI----NLRSIQKEPRPNES 158

Query: 125 RGKISKIRKDPKTGKI--VVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSD 176
              +S I   P T  +   +  S ++   + +D+N TT +  D T    + N D
Sbjct: 159 APFVSNIINGPVTSSVEEPIKMSTEVFDNIYKDINVTTPDS-DNTFSMNETNQD 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,862,366
Number of extensions: 1234089
Number of successful extensions: 9265
Number of sequences better than 10.0: 981
Number of HSP's gapped: 8915
Number of HSP's successfully gapped: 1200
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 63 (28.9 bits)