Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.143.492ON69969928750.0
TPHA0D042503.492ON6293807102e-83
Suva_7.4183.492ON8313245774e-63
Smik_6.2263.492ON8393225775e-63
Skud_7.4413.492ON8073225722e-62
YGR130C3.492ON8163215687e-62
SAKL0F02772g3.492ON7733175103e-54
NCAS0E008103.492ON6923134782e-50
CAGL0I10516g3.492ON8132714292e-43
TDEL0D056003.492ON7004024201e-42
ZYRO0D09988g3.492ON9942964117e-41
KLTH0F14828g3.492ON8362733794e-37
Kwal_55.212293.492ON7872853511e-33
NDAI0G009403.492ON6563253445e-33
KLLA0D16236g3.492ON8713253154e-29
KNAG0B008103.492ON7573192932e-26
Ecym_12373.492ON7272982823e-25
KAFR0C019603.492ON5632782554e-22
TBLA0C044803.492ON802952476e-21
AFR310C3.492ON6232501895e-14
KAFR0G036903.492ON3631111696e-12
KNAG0A079403.492ON2751261481e-09
NCAS0F035503.492ON4411061020.001
AFR474W4.81ON30753800.40
TBLA0B069502.285ON79599800.52
Ecym_5473na 1ON31648733.1
KAFR0G020908.604ON73296733.6
NDAI0B058603.492ON68143724.8
TPHA0B008304.238ON253676725.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.14
         (699 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...  1112   0.0  
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   278   2e-83
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   226   4e-63
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   226   5e-63
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   224   2e-62
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   223   7e-62
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   201   3e-54
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   188   2e-50
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   169   2e-43
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   166   1e-42
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   162   7e-41
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   150   4e-37
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   139   1e-33
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   137   5e-33
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   125   4e-29
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   117   2e-26
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   113   3e-25
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   102   4e-22
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...   100   6e-21
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    77   5e-14
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    70   6e-12
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    62   1e-09
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    44   0.001
AFR474W Chr6 (1292986..1293256,1293320..1293972) [924 bp, 307 aa...    35   0.40 
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...    35   0.52 
Ecym_5473 Chr5 (967856..968806) [951 bp, 316 aa] {ON} similar to...    33   3.1  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    33   3.6  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    32   4.8  
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    32   5.5  

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/699 (81%), Positives = 568/699 (81%)

Query: 1   MFKKREGIVIDDTETDGNRSRSHSMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKME 60
           MFKKREGIVIDDTETDGNRSRSHSMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKME
Sbjct: 1   MFKKREGIVIDDTETDGNRSRSHSMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKME 60

Query: 61  RFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEAN 120
           RFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEAN
Sbjct: 61  RFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEAN 120

Query: 121 LKYLRNSQILLNENGTSTQTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LKYLRNSQILLNENGTSTQTK                                       
Sbjct: 121 LKYLRNSQILLNENGTSTQTKESSDEESSGDETSTDDATSTEASSTSTITTEGSEEETSN 180

Query: 181 XXXXXXXXXXXXXXXXXNVSSAGSVDQETIENEPTSTSLEADTVNQVIEEDRSQASITKA 240
                            NVSSAGSVDQETIENEPTSTSLEADTVNQVIEEDRSQASITKA
Sbjct: 181 EQESTEIVSEEEVATIENVSSAGSVDQETIENEPTSTSLEADTVNQVIEEDRSQASITKA 240

Query: 241 VEEPESATSTGAQNELETEEGEVNAPIEGSDANTKSXXXXXXXXXXXXXXXXXXXXXXXX 300
           VEEPESATSTGAQNELETEEGEVNAPIEGSDANTKS                        
Sbjct: 241 VEEPESATSTGAQNELETEEGEVNAPIEGSDANTKSENVEEEPEEGEEEEGNEPHEETED 300

Query: 301 XXXXXXXXKSLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSP 360
                   KSLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSP
Sbjct: 301 ESVQETEEKSLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSP 360

Query: 361 ENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQ 420
           ENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQ
Sbjct: 361 ENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQ 420

Query: 421 SKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNA 480
           SKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNA
Sbjct: 421 SKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNA 480

Query: 481 KQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDI 540
           KQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDI
Sbjct: 481 KQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDI 540

Query: 541 EQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLS 600
           EQEMAKLNISKM                  LLTDLNVRKNYLPRINEIDNEIAGRLEKLS
Sbjct: 541 EQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLS 600

Query: 601 TIKKETIEENNRLTILTKKLEDERIARENEIXXXXXXXXXXXXXXXXXXXXXXXXXHNEE 660
           TIKKETIEENNRLTILTKKLEDERIARENEI                         HNEE
Sbjct: 601 TIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLAELKAKHNEE 660

Query: 661 LLEIQKKYEKKMAQQPKAVELPTDNSLYEYVTEEEVFSL 699
           LLEIQKKYEKKMAQQPKAVELPTDNSLYEYVTEEEVFSL
Sbjct: 661 LLEIQKKYEKKMAQQPKAVELPTDNSLYEYVTEEEVFSL 699

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  278 bits (710), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/380 (40%), Positives = 225/380 (59%), Gaps = 20/380 (5%)

Query: 312 VEPINPDEAPMLHMGP------PQPQSSST-GIMAIFKGNSSSN-------------IQP 351
           V PI+P   PM+ + P        P++++T  I ++  G   SN             +  
Sbjct: 250 VGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAV 309

Query: 352 VSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTE 411
              + ++SPENPEY+++T ++  +SKAVYD++ Y+Q +H  WL N    E+EKY  KK E
Sbjct: 310 PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369

Query: 412 YEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471
           YED L ++Q ++D+I +      +K  QKIE+MEYQLVKN+LD+   +N  K K+ KETE
Sbjct: 370 YEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429

Query: 472 LMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIR 531
           LMKL+K+NAK+D ++KQ +++ EIE L+ E+  +T+++N WN  L  +T  LD KI  I 
Sbjct: 430 LMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIE 489

Query: 532 AKNQQKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNE 591
           A N+  + I++++  L + K+                  +L  LNV K+YLPR+NEID +
Sbjct: 490 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 549

Query: 592 IAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIXXXXXXXXXXXXXXXXXXXX 651
           IA + +KL+ IK ETI ENN+L+ILTKKLE+ERIA ENEI                    
Sbjct: 550 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLT 609

Query: 652 XXXXXHNEELLEIQKKYEKK 671
                HNEE+ EIQKKY++K
Sbjct: 610 ELQEKHNEEMAEIQKKYQEK 629

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 78/110 (70%), Gaps = 1/110 (0%)

Query: 23  HSMLKKVVSR-DHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGY 81
            + L + +SR   N EY+SPFR+P +   +NYAK+ K ++FPT SA+S+F++M P E+GY
Sbjct: 21  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 80

Query: 82  KNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131
            +++K+ KRAKDI FP +L+ NE+RQ  ++ +L++KE  L  L+ S  +L
Sbjct: 81  SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  226 bits (577), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 200/324 (61%), Gaps = 6/324 (1%)

Query: 312 VEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSK----NPMSSPENPEYVI 367
           + PI+P +AP +     +PQ   TG  A++K  +SS+ +  +     NP+++PENPE ++
Sbjct: 365 ITPIDPSKAPKVPFQE-RPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIV 423

Query: 368 KTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIH 427
           KTK+HGYLSKAVYDK+ YD+ +HQ WL +L   E+ KY  K TEY++ L D+Q++ID I 
Sbjct: 424 KTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIE 483

Query: 428 DLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISK 487
           + M +L+ +TSQKIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K + ++K
Sbjct: 484 NSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNK 543

Query: 488 QAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKL 547
           Q  ++ EI+ L+ E++ V  +FN+W + L+ ++ QLDA+I  I   N ++   + E+  L
Sbjct: 544 QTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNL 603

Query: 548 NISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETI 607
              K                   +L  +   K YLP+IN+ID +I+  L +++ I++E  
Sbjct: 604 EKQKKDLITQTEENKKLHEKNVEVLESVE-NKEYLPQINDIDTQISTLLNQMTIIRQENA 662

Query: 608 EENNRLTILTKKLEDERIARENEI 631
            E   L+ +TKKLEDER A E ++
Sbjct: 663 NERTHLSAITKKLEDERRAHEEQL 686

 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (62%), Gaps = 5/120 (4%)

Query: 21  RSHSMLKKVVSRD--HNVEYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMS 75
           + +  L+KVVS +     ++VSPFR  +     N   Y    K  +FPTVSA+S +S+  
Sbjct: 32  KPYQFLQKVVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQ 91

Query: 76  PNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENG 135
           P +LGYKNI K  KRAKDI FP++L  NE RQ  ++T+LELKE +LKYL+  Q + +  G
Sbjct: 92  PQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTG 151

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  226 bits (577), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQ----PVSKNPMSSPENPEYVIKT 369
           PI+P +AP +     +P+   TGI A++K ++SS+ Q        NP+++PE PE ++KT
Sbjct: 376 PIDPSKAPKVPFQE-RPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKT 434

Query: 370 KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDL 429
           K+HGYLSKAVYDK+ YD+ VHQ WL +L   E+ KY  K  EYE+ L D+Q++ID + D 
Sbjct: 435 KEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDS 494

Query: 430 MDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQA 489
           M  ++ +TS+KIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K   ++KQ 
Sbjct: 495 MKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQT 554

Query: 490 EIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNI 549
            ++ +I+ L+ E+T V  DFN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L  
Sbjct: 555 NVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQ 614

Query: 550 SKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEE 609
            K                   +L  +  R+ YLP+IN+IDN+I+  L +++ IK+E   E
Sbjct: 615 KKNALVTQTQENEKLHEKNVQVLESVENRE-YLPQINDIDNQISTLLNEMTIIKQENANE 673

Query: 610 NNRLTILTKKLEDERIARENEI 631
             +L+ +TK+LEDER A E ++
Sbjct: 674 KTQLSAITKRLEDERRAHEEQL 695

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 80/128 (62%), Gaps = 13/128 (10%)

Query: 23  HSMLKKVVSRD--HNVEYVSPFRDPSNVQAAN----YAKAKKMERFPTVSASSHFSRMSP 76
           +  L+KVVS +     E++SPFR  +     N    Y +  K  +FPTVSA+S +S+  P
Sbjct: 36  YQFLQKVVSNEPKGKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQP 95

Query: 77  NELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL----- 131
            +LGYKNI K+ KRAKDI FP++L  NE RQ  ++T+LELKE +L+YL+  Q +      
Sbjct: 96  KDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTKD 155

Query: 132 --NENGTS 137
             N+NGT+
Sbjct: 156 EKNDNGTA 163

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  224 bits (572), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 195/322 (60%), Gaps = 6/322 (1%)

Query: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQ----PVSKNPMSSPENPEYVIKT 369
           PI+P +AP +     +P+   TGI A++K  +SS+ Q        NP+++PENPE ++KT
Sbjct: 344 PIDPSKAPKVPFKE-RPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKT 402

Query: 370 KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDL 429
           K+HGYLSKAVYDK+ YD+ VHQ WL +L+  E+ KY    T Y + L D+Q++ID I + 
Sbjct: 403 KEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENS 462

Query: 430 MDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQA 489
           M  ++ +TS+KIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K + + KQ 
Sbjct: 463 MKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQT 522

Query: 490 EIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNI 549
            ++ EI+ L+  +T V  +FN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L  
Sbjct: 523 AVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQK 582

Query: 550 SKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEE 609
            K                    L  +   K YLP+IN+IDN+++  L K++ I++E   E
Sbjct: 583 KKEDLIAQTEENKKLHERNVQTLESVE-NKEYLPQINDIDNQVSTLLNKMTIIRQENANE 641

Query: 610 NNRLTILTKKLEDERIARENEI 631
              L+ +TK+LEDER A E ++
Sbjct: 642 KTELSAITKRLEDERRAHEEQL 663

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 21  RSHSMLKKVVSRD--HNVEYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMS 75
           + +  L+KVVS +     E+VSPFR  +  +  N   Y    K ++FPTVSA+S +S+  
Sbjct: 34  KPYQFLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQ 93

Query: 76  PNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQ 128
           P +LGYKNI K+ KRAKDI FP++L  NE RQ  ++T+LELKE +LKYL+  Q
Sbjct: 94  PKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQ 146

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  223 bits (568), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/321 (38%), Positives = 198/321 (61%), Gaps = 6/321 (1%)

Query: 315 INPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQ----PVSKNPMSSPENPEYVIKTK 370
           I+P +AP +    P  +   TGI A++K  +SS+ Q        NP+++PENPE ++KTK
Sbjct: 354 IDPSKAPKVPFQEP-SRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTK 412

Query: 371 QHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLM 430
           +HGYLSKAVYDK+ YD+ +HQ WL +L   E++KY  K  EY++ L D+Q++ID I + M
Sbjct: 413 EHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSM 472

Query: 431 DELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAE 490
             ++ +TS+KIEV + +LVK I+D+   HN+ K  I K+TE MK +KL  K + + KQ  
Sbjct: 473 KAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTN 532

Query: 491 IRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNIS 550
           ++ EI++L+ E+T V  +FN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L   
Sbjct: 533 VKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKK 592

Query: 551 KMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEEN 610
           K                   +L  +   K YLP+IN+IDN+I+  L +++ IK+E   E 
Sbjct: 593 KEDLVTQTEENKKLHEKNVQVLESVE-NKEYLPQINDIDNQISSLLNEVTIIKQENANEK 651

Query: 611 NRLTILTKKLEDERIARENEI 631
            +L+ +TK+LEDER A E ++
Sbjct: 652 TQLSAITKRLEDERRAHEEQL 672

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 73/111 (65%), Gaps = 5/111 (4%)

Query: 23  HSMLKKVVSRD--HNVEYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMSPN 77
           +  L+KVVS +     E+VSPFR  +     N   Y +  K  +FPTVSA+S +S+  P 
Sbjct: 36  YQFLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPK 95

Query: 78  ELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQ 128
           +LGYKNI K+ KRAKDI FP++L  NE RQ  ++T+LELKE +LKYL+  Q
Sbjct: 96  DLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQ 146

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  201 bits (510), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 190/317 (59%), Gaps = 14/317 (4%)

Query: 310 SLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKT 369
            L +PI+P++AP +      P  + TG+ A++  +   +       P+++P++PEY+++T
Sbjct: 316 GLAQPIDPNKAPRV------PFKAKTGVFALWTRSDKQD------QPLATPQDPEYIVRT 363

Query: 370 KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDL 429
            + GY+SKA+YDK++YD+ VHQ  L      + +KY   + EY D L  +QS+ID +   
Sbjct: 364 DK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQAT 422

Query: 430 MDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQA 489
           M++L+L T +KI+V E +L K +LD+  TH  SKN IFKETE +K +K+  + +  +K  
Sbjct: 423 MEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHE 482

Query: 490 EIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNI 549
           E++ EIE L+  +  V  +FNE+ +KL+++TAQLD+K+E I+  N ++++I   +A+LN 
Sbjct: 483 EVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQ 542

Query: 550 SKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEE 609
            K+                  +L  +   K YLP+IN ID+++A  L  L+ IK+E   +
Sbjct: 543 KKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLLGSLTLIKQENANQ 601

Query: 610 NNRLTILTKKLEDERIA 626
                 +TK+LE+ER A
Sbjct: 602 KTEFAAITKRLEEERKA 618

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 66/112 (58%), Gaps = 9/112 (8%)

Query: 25  MLKKVVS----RDHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELG 80
            L+KVV+     +   +Y SPFR    + AA   KAKK   FPTVSA+S     S  +LG
Sbjct: 28  FLRKVVTNKKKEEEEKDYSSPFRSQQELIAAKNVKAKK---FPTVSATS--GTASAADLG 82

Query: 81  YKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
           YK I  + +RAKDIS P +L   + +Q   +  LE KE +L+YL++SQ +++
Sbjct: 83  YKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD 134

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  188 bits (478), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 184/313 (58%), Gaps = 10/313 (3%)

Query: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHG 373
           PI+P  APM+      P   S       K  + +  +P   NP++SP N E ++KT Q G
Sbjct: 235 PIDPALAPMVPFSLATPNQKS-------KKETEAPEKP--SNPVASPTNQEEIVKTAQFG 285

Query: 374 YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDEL 433
           YLSKAVYDK+QYD+  H++WL + ET + EKY+ K  EY+ +L D+ +++  ++DL+++ 
Sbjct: 286 YLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKC 345

Query: 434 KLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRK 493
           +L T +KI+VM  QLVK + D      + K KIF ET+ +KLEKL+ K++ ++   E+++
Sbjct: 346 ELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQ 405

Query: 494 EIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMX 553
            I+ L+ E+  V  +++ W + +  I ++LDAK+  I   N  +++++ ++  L   K  
Sbjct: 406 TIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNN 465

Query: 554 XXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRL 613
                            L+  ++  K YLP++N+IDNEI G L +++ +K+E   E  +L
Sbjct: 466 LQDEIAKNKNIHDSNVKLVESVD-NKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQL 524

Query: 614 TILTKKLEDERIA 626
             +TKKLEDER A
Sbjct: 525 AEITKKLEDERRA 537

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 37  EYVSPFR-DPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDIS 95
           +Y SPFR + SNV   N    +K  RFPTVSA+S+++  +P + G+  I K    AKDI 
Sbjct: 72  DYASPFRAEYSNVNVQN----EKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127

Query: 96  FPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
           FP++L  NE+RQ   +  LE KE +LKYL++SQ +++
Sbjct: 128 FPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIID 164

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 166/271 (61%), Gaps = 1/271 (0%)

Query: 356 PMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDN 415
           P+++PENPE + KT+++GY+SK +YDKV YD++ H+RWL   + +E+ KY +K  EY + 
Sbjct: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477

Query: 416 LADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKL 475
           L ++Q +ID I++ M+ LK +T+ KIEV E  LVK I +    HN+ KNKIFKETE +K 
Sbjct: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKN 537

Query: 476 EKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQ 535
           +K+  K++ + K A ++ EI  L++ +  V ++F++W + +  +  QLDAKI  +     
Sbjct: 538 QKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITM 597

Query: 536 QKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGR 595
           ++ + ++E+ KL   K                   ++      K YLP+I+ IDN+I+  
Sbjct: 598 KQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYE-NKEYLPKIHTIDNQISEL 656

Query: 596 LEKLSTIKKETIEENNRLTILTKKLEDERIA 626
           L +L+ IK+E   E   L+ +TK+LE+ER A
Sbjct: 657 LNELAIIKQENANEQTELSKITKELEEERRA 687

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 5/94 (5%)

Query: 39  VSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPS 98
           V+PF   +N  A  Y K  K  +FPTVSA+S  +   P ELG+K + KSTKRAKDI FP 
Sbjct: 105 VNPF---TNKPA--YNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPV 159

Query: 99  FLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
           +L  NE RQ  I+ +LELKE  L+YL++SQ +++
Sbjct: 160 YLTENEFRQQTILKELELKEGKLQYLKDSQKIID 193

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  166 bits (420), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/402 (28%), Positives = 209/402 (51%), Gaps = 29/402 (7%)

Query: 316 NPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYL 375
           +P   PM+ +    P +    +  IFK   +        NP ++PENPE+V+KTK  GYL
Sbjct: 310 DPRSVPMVAL----PAAPRAFLDKIFKSPPAP-----VPNPPATPENPEHVVKTK-DGYL 359

Query: 376 SKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKL 435
           +K +YDK+      H  W+   +  E++K+ +K+ E    +  ++++I  I + M +L+ 
Sbjct: 360 TKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRS 419

Query: 436 KTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEI 495
            T  KIEV E +L +   +MTQ H   KN++FK+TE++K +KL+ K   + KQ E++KEI
Sbjct: 420 DTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEI 479

Query: 496 ENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMXXX 555
           + L+ E+  V ++  +W   + E++A++DAK+ D+   N ++ + ++E+ KL   K+   
Sbjct: 480 DELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDIL 539

Query: 556 XXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTI 615
                          ++      K YLP++NE+DN+I+  L +L+TI++    E   L+ 
Sbjct: 540 DQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSA 598

Query: 616 LTKKLEDERIARENEIXXXXXXXXXX-------XXXXXXXXXXXXXXXHNEEL------- 661
           +TKKL+ ER+  E ++                                H +E+       
Sbjct: 599 ITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDY 658

Query: 662 LEIQKKYEKKMAQQPKAVEL---PT-DNSLYEYVTEEEVFSL 699
            +++ K++++  Q+  A+     PT D+SLYEY TEEE+ ++
Sbjct: 659 TQLEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEILTV 700

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 63/92 (68%), Gaps = 3/92 (3%)

Query: 37  EYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISF 96
           +YVSPFRD   V +A   + ++ +RFPT SA+S +    P ELGYK I    KRAKDISF
Sbjct: 39  DYVSPFRDEQEVLSA---QRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95

Query: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQ 128
           P +L   E++Q  ++ +LE+KEA+L+YL++ Q
Sbjct: 96  PVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  162 bits (411), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 171/296 (57%), Gaps = 5/296 (1%)

Query: 337 IMAIF-KGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLD 395
           I +IF +   S N  P   NP+++PENPE ++KT + G+LSKAVYDKV+Y+   H  WL 
Sbjct: 471 IFSIFGRKKKSQNRAP---NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLT 527

Query: 396 NLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDM 455
              ++E+++Y+ K+ +Y++ L +++ +++ + + M E+K   ++ IE+   +L K  L+ 
Sbjct: 528 EFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLES 587

Query: 456 TQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSK 515
           TQ + + KN IF ET+ ++ +K     +   +Q E++KEI  L+ E+  +  +F  W ++
Sbjct: 588 TQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNR 647

Query: 516 LNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDL 575
           L + +A LDAK+  +    Q+    + ++ +L+  K                    + + 
Sbjct: 648 LADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAV-EK 706

Query: 576 NVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEI 631
           +  K YLP+++EID++I+  L +LS IK+E+  E  +L  +TKKLE ER A E ++
Sbjct: 707 HANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQL 762

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 3/97 (3%)

Query: 34  HNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKD 93
           H  E+ SPFR  SN + A   + ++++RFPTVS +S FS++ P ELGY+ + + ++RAKD
Sbjct: 65  HLGEFASPFRLESNEKDA---EKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121

Query: 94  ISFPSFLIANERRQGGIITDLELKEANLKYLRNSQIL 130
           I FP +L  NE RQ  ++T++E++E  L Y++NSQI+
Sbjct: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIV 158

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  150 bits (379), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 157/273 (57%), Gaps = 8/273 (2%)

Query: 334 STGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRW 393
           +TGI A++   S    QPV+     SP +PE+++K  + GY+SKA+YD ++Y++++H+R 
Sbjct: 360 ATGIFALWT-RSDKRGQPVA-----SPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKRE 412

Query: 394 LDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNIL 453
           +D+     + KY+ K  EYED L  ++S+I  +   M+ L+  T++KIE+ E +L   ++
Sbjct: 413 MDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMI 472

Query: 454 DMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWN 513
           D+   H+ SKN IFKETE MK  K+  K+   +KQ +++ E+E L + +  +  +  E  
Sbjct: 473 DLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQ 532

Query: 514 SKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLT 573
            +++E+TA+LDAK+  I+  N Q+ +++  +  L   K                   +L 
Sbjct: 533 GRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLE 592

Query: 574 DLNVRKNYLPRINEIDNEIAGRLEKLSTIKKET 606
            +   K YLP++N ID +I+  L  L+ +K+ET
Sbjct: 593 SIE-NKEYLPKLNAIDTKISELLTSLTVVKQET 624

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 77/140 (55%), Gaps = 12/140 (8%)

Query: 1   MFKKR----EGIVIDDTETDGNRSRSHSMLKKVVSRDH-NVEYVSPFRDPSNVQAANYAK 55
           MFKKR    E +        G+  +    L KVVS++     Y SPFR   ++ AA   +
Sbjct: 1   MFKKRQDPLEHLFQQSEPQTGDADKG--FLHKVVSKEQEQSAYNSPFRTSQSLAAA---Q 55

Query: 56  AKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLE 115
            +KM++FPTVSAS      S  ++GYK I  + +RAKDI+ P +L  N+ RQ   +  LE
Sbjct: 56  KRKMQKFPTVSASVSAHSSS--DMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLE 113

Query: 116 LKEANLKYLRNSQILLNENG 135
            KE  LKY ++SQ +++  G
Sbjct: 114 RKEDALKYKKDSQRIVDVRG 133

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  139 bits (351), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 161/285 (56%), Gaps = 10/285 (3%)

Query: 334 STGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRW 393
           +TGI A++   S    QPV+     SP++PE+++K  + GY+SKA+YD ++Y+++VH++ 
Sbjct: 332 ATGIFALW-TRSDKRGQPVA-----SPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQE 384

Query: 394 LDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNIL 453
           +D       +KY  K  EYED+L  ++S+I  +   M++L+L T+ KI +   +L   ++
Sbjct: 385 MDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMI 444

Query: 454 DMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFN-EW 512
           +    H+++KN IFKETE  K  K++ K   ++KQ E++ E E L E Q    D  N E 
Sbjct: 445 ESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEEL-EAQRAEADATNQEL 503

Query: 513 NSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLL 572
            S+++E+T QLD+K   I+  N Q+ +I+  +  L   K                   +L
Sbjct: 504 LSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAIL 563

Query: 573 TDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILT 617
             ++  K+YLP+IN +D++I+  L  L+ +K+ET  ++     ++
Sbjct: 564 EGIS-NKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVS 607

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (61%), Gaps = 6/115 (5%)

Query: 22  SHSMLKKVVSRDH-NVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELG 80
           S   L+KVV+++  +  Y SPFR     Q+   A+ +K++RFPTVSASS  +  +  E+G
Sbjct: 23  SKGFLRKVVTKEQEDATYSSPFR---TSQSQVEAQKRKVQRFPTVSASSGGNSSA--EMG 77

Query: 81  YKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENG 135
           +K I  + KRAKDI+ P +L  N+ RQ   +  LE KE +L+Y ++SQ ++   G
Sbjct: 78  FKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKG 132

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  137 bits (344), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 103/325 (31%), Positives = 178/325 (54%), Gaps = 13/325 (4%)

Query: 311 LVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQP----VSKNPMSSPENPEYV 366
           L +PI+P   PM+      P         +   N  + + P      +NP ++P + E +
Sbjct: 187 LEKPIDPKLTPMVSFQLSTP--------PVNNKNKKTQVVPEEEEKERNPKATPNSKEEI 238

Query: 367 IKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNI 426
           +KTK+ G LSK++YD++QYDQ  H+++L + +   +EKY  K  EYE+ L  +  KI   
Sbjct: 239 VKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVAS 298

Query: 427 HDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFIS 486
           ++L+++ K  T  K+++M  +LVK + D      D K KIF ET+L+K EK++ K +   
Sbjct: 299 NELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEE 358

Query: 487 KQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAK 546
              ++  EI+ L++E+  V D+FNEW   +  I  QLDAK+  I+  N  +++++ ++  
Sbjct: 359 LDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDG 418

Query: 547 LNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKET 606
           LN  K+                   + +++  K YLP++N ID++I   L +L+ IK+E 
Sbjct: 419 LNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYLPKLNNIDSQINDLLNQLTLIKQEN 477

Query: 607 IEENNRLTILTKKLEDERIARENEI 631
             E  +L+ LT+KLE ER+  E ++
Sbjct: 478 ANEKIQLSELTQKLEKERMDHEEKL 502

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 37  EYVSPFRDPSNVQAAN--YAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDI 94
           EY+SPFR  SN+   N  Y + +K +RFPTVSA+S+++  +  E+G+K I K    AKDI
Sbjct: 67  EYLSPFR--SNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124

Query: 95  SFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
            FPS+L  NE+RQ   +T L   E +L+Y ++SQ +++
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIID 162

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  125 bits (315), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 170/325 (52%), Gaps = 55/325 (16%)

Query: 333 SSTGIMAIFKGN-------------SSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAV 379
           +++G+ A+FK +             ++  + P    P+++PE+PE +++T Q GY+SK+V
Sbjct: 408 AASGLFALFKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRT-QEGYVSKSV 466

Query: 380 YDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQ 439
           YDK+QYD+  HQ  L      ++E+Y+ K  EYE+ +  IQ++I  +   M++++L+  +
Sbjct: 467 YDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEE 526

Query: 440 KIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLS 499
           K+++ + +  + +L+    H ++K  ++K+TE +K + ++ K+D       ++ EI+ L 
Sbjct: 527 KLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELL 586

Query: 500 EEQTGVTDDFNEWNSKLNEITAQLDAK--------------------IEDIRAKNQQKLD 539
             +  V  +  E  SK+ E+TA+LD K                    +E+ +A+ +Q++ 
Sbjct: 587 LLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIK 646

Query: 540 IEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKL 599
             QE+ + N+SK+                          K YLP++NEI+ EI+  L  L
Sbjct: 647 EAQELHQQNVSKIESIDN---------------------KEYLPKVNEINTEISSLLASL 685

Query: 600 STIKKETIEENNRLTILTKKLEDER 624
             I++E   +    + +T++LE+ER
Sbjct: 686 GLIQQEIANQKVEFSSVTRRLEEER 710

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 26/152 (17%)

Query: 1   MFKKREGI-----VIDDTETDGNRSRSH------SMLKKVVSR--------DHNVEYVSP 41
           +F+KR  I     ++DD +    + + H      S+LK+V ++        D N EY SP
Sbjct: 6   LFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDN-EYHSP 64

Query: 42  FRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNIS-KSTKRAKDISFPSFL 100
           FR     Q    A+  + E+FPT+S  +   ++ P ++GY  ++ KS K+AKDI  PS L
Sbjct: 65  FRTAEETQ---RARQVRQEKFPTLSQGA--VQLDPEQMGYSVVTDKSVKKAKDIIIPSGL 119

Query: 101 IANERRQGGIITDLELKEANLKYLRNSQILLN 132
              E  Q   +T LE KE  L+Y R SQ +++
Sbjct: 120 KDTEAEQKVRLTALEKKEKQLRYWRKSQKIVD 151

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/319 (27%), Positives = 159/319 (49%), Gaps = 7/319 (2%)

Query: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHG 373
           P++P   P L++     Q    G  A+        +     NP ++ + PE ++K  ++G
Sbjct: 256 PVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKLPKYG 315

Query: 374 YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDEL 433
           ++S AV++KV YD  VH+  + + +  +E K+  K  EYE  LA +  +  ++   M++ 
Sbjct: 316 HVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKMNDA 375

Query: 434 KLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQD--FIS-KQAE 490
           KL    K EV+E Q +K + D   T NDSK K+  E +L+KL+KL   QD  FIS K+  
Sbjct: 376 KLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKL---QDLKFISQKKTL 432

Query: 491 IRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNIS 550
           ++ E+  L+ E++    D++ W + L  IT +LDA++  +   N ++  I +++  L   
Sbjct: 433 MQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQR 492

Query: 551 KMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPR-INEIDNEIAGRLEKLSTIKKETIEE 609
           K                    L DL   ++     + ++ + I G+L+ L+ +K+E   E
Sbjct: 493 KTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGE 552

Query: 610 NNRLTILTKKLEDERIARE 628
             +L  +T ++E  R  RE
Sbjct: 553 RLKLIGITNEMERARAERE 571

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 66/112 (58%), Gaps = 1/112 (0%)

Query: 22  SHSMLKKVVSRDHNVEYVSPFRDPSNVQAAN-YAKAKKMERFPTVSASSHFSRMSPNELG 80
           S    ++ +      EYVSPFR     +A+    + ++ ++FPTVSA+S ++  +  ELG
Sbjct: 32  SRGSFRRAIGTAATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELG 91

Query: 81  YKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
           +  ++   +RA+DI FP +L+ NE RQ  I+ DLE +E  L +L+  Q +L+
Sbjct: 92  FSKVTDDQRRARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 160/298 (53%), Gaps = 13/298 (4%)

Query: 324 HMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKV 383
           H GP +   S  GI A++K +     +P   N  ++PE+PE+++ T++ GY+SK +YD++
Sbjct: 297 HRGPFK--FSKKGIFALWKRSE----KPEKLN--ATPEDPEFIVLTEK-GYMSKNIYDRL 347

Query: 384 QYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEV 443
           +Y++ +HQ  L +L+     KY++    YE+ LA + ++I  +H  MD+LK +T  +++ 
Sbjct: 348 EYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKA 407

Query: 444 MEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQT 503
           +E  L +N++D+   H++ K  + KE E  K  K+  K     K  ++  E+E L   + 
Sbjct: 408 IEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLEL 467

Query: 504 GVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMXXXXXXXXXXX 563
               +  ++ S++  +TA+LDA++ +++  + ++ ++   MA L   ++           
Sbjct: 468 ERKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNA 527

Query: 564 XXXXXXXLLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLE 621
                  LL +L   +N+ P I  +DN+++     +S +++E   + + LT L+ K E
Sbjct: 528 VVANNKELLQNL---ENH-PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 19/99 (19%)

Query: 37  EYVSPFRDPSNVQAANYAKAKKME--RFPTVSASSHFSRMSPNELGYKNISKSTKR-AKD 93
           EYVSPFRD   V     A+A+++   +FPT   + H S +         +  + KR A+D
Sbjct: 56  EYVSPFRDDKAV-----AEAERIRDLKFPT---TGHHSTV--------RVKDNVKRKAQD 99

Query: 94  ISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132
           I+ P      + +Q   + +L +KE  L+YLRNSQ +++
Sbjct: 100 IAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 147/278 (52%), Gaps = 8/278 (2%)

Query: 353 SKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEY 412
           SK P++SPEN E V+K      +SK VYDK+++D  V+ +++   +  +  K    K+EY
Sbjct: 244 SKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEY 303

Query: 413 EDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETEL 472
            + +  IQ +     + ++ L L++    EV++ +LVKN++D T T +D+K KI ++T  
Sbjct: 304 NEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQ 363

Query: 473 MKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRA 532
           +KL+KLN  +    K+  IR+E   ++ E+     +FN  N  LNEI  +LDAK+  +  
Sbjct: 364 LKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQ 423

Query: 533 KNQQKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEI 592
            N +  ++E E     I+K+                  L  D + ++     +NE+D +I
Sbjct: 424 DNIRNENLEHE-----INKLQSKKQTLLDEIDSIEYKKLHPDDDSKQ---LELNEMDEQI 475

Query: 593 AGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENE 630
             +L  L+ IK+E I E  +++ LT  L  + I  +NE
Sbjct: 476 NSKLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKNE 513

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 20  SRSHSMLKKVVSR-----DHNVEYVSPFRD--PSNVQAANYAKAKKMERFPTVSASSHFS 72
           ++ H  L KV +      D   +Y SPFR+  PS  Q       K   +FP VSA+S ++
Sbjct: 28  AKKHQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLK-TAKFPLVSATSTYN 86

Query: 73  RMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNS 127
             + +   YK++      A+DI FPS LI NE RQ  I+ DL++K+  L  L++S
Sbjct: 87  TDTKD--VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS 139

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 99.8 bits (247), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 61/95 (64%)

Query: 37  EYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISF 96
           +Y SPFRD       N A  KK  R+PT+SA+S +S M+P +LGYKNI  STKRAKDI F
Sbjct: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPF 114

Query: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131
           P  LI NE RQ  +   L  KE+ L YL+ SQ L+
Sbjct: 115 PVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 117/255 (45%), Gaps = 47/255 (18%)

Query: 328 PQPQSSSTGIMAIFK--------GNSSSNIQPVSKN-----------------PMSSPEN 362
           P P  S++    +FK         NS SN + V+ N                 P ++P+N
Sbjct: 324 PTPSRSTSSFFTVFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKATPKN 383

Query: 363 PEYVIKTKQHG---YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADI 419
           PE ++KT+ +     LSK+VYD V Y+  VH + + +       KY+ K  E+ +++ ++
Sbjct: 384 PELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINEL 443

Query: 420 QSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLN 479
             KI +I   + + K K      +M   + KN +D+   H         E  L+K  ++ 
Sbjct: 444 DLKIKSIEKDIIDYKAKID---SLMNDNVEKNDIDIENYH---------EKMLIKKNQII 491

Query: 480 AKQDFIS-------KQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRA 532
            K D I+         A I  + ++   +Q+  T    +W S+ +++  Q+D+K+  I+ 
Sbjct: 492 KKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVNVIKQ 551

Query: 533 KNQQKLDIEQEMAKL 547
            N+   D++Q++ +L
Sbjct: 552 LNKNLADVKQKITEL 566

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 126/250 (50%), Gaps = 2/250 (0%)

Query: 356 PMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDN 415
           P  +PE PE V+ T + GY+SKAVYD++  ++  H   L N +    + YQ     YE  
Sbjct: 279 PNGTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 416 LADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKL 475
           +AD+ ++I  +   +  L+ +T  +I+ +E  L KNI DM   + D ++ + ++ E  + 
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRA 397

Query: 476 EKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQ 535
           E+L  K++ + +  E++ EI+ L + +     +  E  ++++++  QLDA+  ++R    
Sbjct: 398 EQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457

Query: 536 QKLDIEQEMAKLNISKMXXXXXXXXXXXXXXXXXXLLTDLNVRKNYLPRINEIDNEIAGR 595
           Q+ ++   +A L   K                    L  LN + +Y   + EID + +  
Sbjct: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEI 516

Query: 596 LEKLSTIKKE 605
           L +++ I++E
Sbjct: 517 LTEIAKIRQE 526

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 17/105 (16%)

Query: 37  EYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISF 96
           EY SPFRD   V+ A+ +   K   FPT               G     ++ +R  DI  
Sbjct: 55  EYYSPFRDAIAVEEAHGSGTLK---FPTT--------------GTHVTEEARRRVPDIDE 97

Query: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTSTQTK 141
           P  L   + RQ   + +LELKE  L+  + SQ +++  G S  T+
Sbjct: 98  PKRLSTVDERQRQQLQELELKEGQLRLYKESQKIVDVRGKSDVTQ 142

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 24  SMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKN 83
           + LK  ++  H+ +Y SPFR   N    NY +  K  ++   + +S F++++ N +GYK 
Sbjct: 27  NFLKDTIA--HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKT 84

Query: 84  I---SKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131
           I    KS K AKDI FP  L  NE  Q   + +L+ KE NLK+L++SQ L+
Sbjct: 85  IPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV 135

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 70/125 (56%), Gaps = 4/125 (3%)

Query: 354 KNPMSSPENPEYVIKTKQHG----YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKK 409
           KN +++P+N E VI  ++      Y SK V+D +QY+  +H   L  L    +E++ +K 
Sbjct: 182 KNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKI 241

Query: 410 TEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKE 469
            EY+  ++++ +KID  ++ + +L  K S   +  +++  KN L     +N++K +++ E
Sbjct: 242 NEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGE 301

Query: 470 TELMK 474
            E +K
Sbjct: 302 IEAIK 306

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 4/126 (3%)

Query: 354 KNPMSSPENPEYVIKTKQ----HGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKK 409
           +NP+++PE PE V+  K     +   SK ++D +Q D   H  WL + E    ++   K 
Sbjct: 119 RNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKM 178

Query: 410 TEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKE 469
            EY   LA +  +I +    M+ L+ K  + I++ E +L K  L  TQ     KNKI+KE
Sbjct: 179 EEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKE 238

Query: 470 TELMKL 475
           TE +  
Sbjct: 239 TERLNF 244

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 56  AKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLE 115
            KK +  P  +  S ++ + P ELGYK      K A++I FP+ L  NE RQ  I+ DL+
Sbjct: 7   GKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLD 65

Query: 116 LKEANLKYLRNSQ 128
            KE +L +L+ SQ
Sbjct: 66  EKEQHLDHLKKSQ 78

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 21/106 (19%)

Query: 35  NVEYVSPFRDP--SNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAK 92
           N  +VS FR+P  +N   ANY    K +R P+                   + K   R  
Sbjct: 54  NARFVSTFREPLMNNRYYANYLYHMKQQRHPS-------------------LRKYESRNP 94

Query: 93  DISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTST 138
           +I  P FL   E +Q   + +L++KE NL+ L+NSQ ++  +   T
Sbjct: 95  NIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIITSSTART 140

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 351 PVSKNPMSSPENPEYVIKT--KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNK 408
           P  K P+++P+NPE +++    Q+  +SK  YD++   QS H  WL +        Y  +
Sbjct: 175 PSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQR 234

Query: 409 KTEYEDNLADIQSKIDNIHDLMDEL 433
              Y+  +  +  KI    ++ + L
Sbjct: 235 HQWYQKQIDVLDEKIRYYQEMSNVL 259

>AFR474W Chr6 (1292986..1293256,1293320..1293972) [924 bp, 307 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YGL033W (HOP2); 1-intron
          Length = 307

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 495 IENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKL 547
           +E L EE   +  D NEW ++LN++T      IE I   NQ+K+++E+   +L
Sbjct: 171 LEQLREECNALNSDINEWQTQLNQLTRD-PTNIELIEQINQRKVELEETKTRL 222

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 379 VYD-KVQYDQSVHQRWLDNLETTEEEK---YQNKKTEYEDNLAD--IQSKIDNIHDLMDE 432
            YD +++Y   +   + + ++   E+    Y+  K   E+ L +    S +DNI DLM +
Sbjct: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLK 121

Query: 433 LKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471
           L ++ +   E++E   +++   + +T ND++ ++ KETE
Sbjct: 122 LPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETE 160

>Ecym_5473 Chr5 (967856..968806) [951 bp, 316 aa] {ON} similar to
           Ashbya gossypii AAR135W
          Length = 316

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 324 HMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQ 371
           H  P  P S+   + A+FK ++  +++ V + P  + ++PE+VI  K+
Sbjct: 46  HALPRPPASTRIQLYALFKQSTEGDVESVIQKPSGNSDSPEFVIALKK 93

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
           Anc_8.604 YOR195W
          Length = 732

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 17/96 (17%)

Query: 468 KETELMKLE-KLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEI------- 519
           KE E+  LE K++A  + IS     +KEIENL+  +T + +D     SK  E+       
Sbjct: 437 KENEVSILESKISALNETISSLQSCQKEIENLNSTKTNLENDLTALKSKFEEVNDNSSIR 496

Query: 520 ---TAQLDAKIEDIRAKNQQ------KLDIEQEMAK 546
                +L+++IE +R  N Q      KLD E E+ K
Sbjct: 497 TAEVTELNSQIESLRESNDQLQELNSKLDEEIEILK 532

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTSTQ 139
           P+FLI N+ +Q  I+ D+  +E N  +L+N Q +++++   +Q
Sbjct: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQ 332

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 11/76 (14%)

Query: 477  KLNAKQDFISK----QAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRA 532
            KL+ KQD +S+     AE+  ++E   EE         + NS LN+I ++LD KI++  +
Sbjct: 1649 KLSLKQDALSEITNENAELNSQLEKHKEE-------IADLNSSLNDINSRLDLKIKNFDS 1701

Query: 533  KNQQKLDIEQEMAKLN 548
               +  D+E+E+ K+N
Sbjct: 1702 IESKNSDLEKELLKVN 1717

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,100,127
Number of extensions: 2561677
Number of successful extensions: 13549
Number of sequences better than 10.0: 845
Number of HSP's gapped: 13849
Number of HSP's successfully gapped: 1204
Length of query: 699
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 582
Effective length of database: 40,065,477
Effective search space: 23318107614
Effective search space used: 23318107614
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 69 (31.2 bits)